contestId
int64 0
1.01k
| index
stringclasses 57
values | name
stringlengths 2
58
| type
stringclasses 2
values | rating
int64 0
3.5k
| tags
sequencelengths 0
11
| title
stringclasses 522
values | time-limit
stringclasses 8
values | memory-limit
stringclasses 8
values | problem-description
stringlengths 0
7.15k
| input-specification
stringlengths 0
2.05k
| output-specification
stringlengths 0
1.5k
| demo-input
sequencelengths 0
7
| demo-output
sequencelengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
425k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 14
values | testset
stringclasses 12
values | passedTestCount
int64 0
1k
| timeConsumedMillis
int64 0
15k
| memoryConsumedBytes
int64 0
805M
| code
stringlengths 3
65.5k
| prompt
stringlengths 262
8.2k
| response
stringlengths 17
65.5k
| score
float64 -1
3.99
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
119 | A | Epic Game | PROGRAMMING | 800 | [
"implementation"
] | null | null | Simon and Antisimon play a game. Initially each player receives one fixed positive integer that doesn't change throughout the game. Simon receives number *a* and Antisimon receives number *b*. They also have a heap of *n* stones. The players take turns to make a move and Simon starts. During a move a player should take from the heap the number of stones equal to the greatest common divisor of the fixed number he has received and the number of stones left in the heap. A player loses when he cannot take the required number of stones (i. e. the heap has strictly less stones left than one needs to take).
Your task is to determine by the given *a*, *b* and *n* who wins the game. | The only string contains space-separated integers *a*, *b* and *n* (1<=≤<=*a*,<=*b*,<=*n*<=≤<=100) — the fixed numbers Simon and Antisimon have received correspondingly and the initial number of stones in the pile. | If Simon wins, print "0" (without the quotes), otherwise print "1" (without the quotes). | [
"3 5 9\n",
"1 1 100\n"
] | [
"0",
"1"
] | The greatest common divisor of two non-negative integers *a* and *b* is such maximum positive integer *k*, that *a* is divisible by *k* without remainder and similarly, *b* is divisible by *k* without remainder. Let *gcd*(*a*, *b*) represent the operation of calculating the greatest common divisor of numbers *a* and *b*. Specifically, *gcd*(*x*, 0) = *gcd*(0, *x*) = *x*.
In the first sample the game will go like that:
- Simon should take *gcd*(3, 9) = 3 stones from the heap. After his move the heap has 6 stones left.- Antisimon should take *gcd*(5, 6) = 1 stone from the heap. After his move the heap has 5 stones left.- Simon should take *gcd*(3, 5) = 1 stone from the heap. After his move the heap has 4 stones left.- Antisimon should take *gcd*(5, 4) = 1 stone from the heap. After his move the heap has 3 stones left.- Simon should take *gcd*(3, 3) = 3 stones from the heap. After his move the heap has 0 stones left.- Antisimon should take *gcd*(5, 0) = 5 stones from the heap. As 0 < 5, it is impossible and Antisimon loses.
In the second sample each player during each move takes one stone from the heap. As *n* is even, Antisimon takes the last stone and Simon can't make a move after that. | 500 | [
{
"input": "3 5 9",
"output": "0"
},
{
"input": "1 1 100",
"output": "1"
},
{
"input": "23 12 16",
"output": "1"
},
{
"input": "95 26 29",
"output": "1"
},
{
"input": "73 32 99",
"output": "1"
},
{
"input": "1 1 1",
"output": "0"
},
{
"input": "41 12 65",
"output": "1"
},
{
"input": "13 61 100",
"output": "1"
},
{
"input": "100 100 10",
"output": "0"
},
{
"input": "12 24 26",
"output": "1"
},
{
"input": "73 21 96",
"output": "1"
},
{
"input": "17 22 81",
"output": "1"
},
{
"input": "14 88 97",
"output": "1"
},
{
"input": "42 81 17",
"output": "0"
},
{
"input": "34 36 19",
"output": "1"
},
{
"input": "21 87 12",
"output": "1"
},
{
"input": "97 92 98",
"output": "1"
},
{
"input": "49 25 62",
"output": "1"
},
{
"input": "29 17 44",
"output": "1"
},
{
"input": "10 1 10",
"output": "0"
},
{
"input": "99 98 100",
"output": "1"
},
{
"input": "100 100 1",
"output": "0"
},
{
"input": "11 99 55",
"output": "0"
},
{
"input": "8 13 21",
"output": "0"
},
{
"input": "34 55 89",
"output": "0"
},
{
"input": "21 34 55",
"output": "1"
},
{
"input": "13 21 34",
"output": "1"
},
{
"input": "34 21 55",
"output": "0"
},
{
"input": "10 20 84",
"output": "1"
},
{
"input": "4 2 5",
"output": "0"
},
{
"input": "3 2 3",
"output": "0"
},
{
"input": "31 23 1",
"output": "0"
},
{
"input": "100 100 100",
"output": "0"
},
{
"input": "100 1 100",
"output": "0"
},
{
"input": "1 100 100",
"output": "1"
},
{
"input": "1 1 100",
"output": "1"
},
{
"input": "17 23 100",
"output": "1"
},
{
"input": "99 98 100",
"output": "1"
},
{
"input": "1 1 2",
"output": "1"
},
{
"input": "2 1 1",
"output": "0"
},
{
"input": "1 2 1",
"output": "0"
},
{
"input": "2 1 2",
"output": "0"
},
{
"input": "10 10 3",
"output": "1"
},
{
"input": "2 2 1",
"output": "0"
},
{
"input": "9 5 1",
"output": "0"
}
] | 1,624,879,266 | 2,147,483,647 | Python 3 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | l = list(map(int,input().split()))
a = l[0]
b = l[1]
n = l[2]
while:
if math.gcd(a,n) >= n:
n -= math.gcd(a,n)
else:
print(0)
exit()
if math.gcd(b,n) >= n:
n -= math.gcd(b,n)
else:
print(1)
exit()
| Title: Epic Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Simon and Antisimon play a game. Initially each player receives one fixed positive integer that doesn't change throughout the game. Simon receives number *a* and Antisimon receives number *b*. They also have a heap of *n* stones. The players take turns to make a move and Simon starts. During a move a player should take from the heap the number of stones equal to the greatest common divisor of the fixed number he has received and the number of stones left in the heap. A player loses when he cannot take the required number of stones (i. e. the heap has strictly less stones left than one needs to take).
Your task is to determine by the given *a*, *b* and *n* who wins the game.
Input Specification:
The only string contains space-separated integers *a*, *b* and *n* (1<=≤<=*a*,<=*b*,<=*n*<=≤<=100) — the fixed numbers Simon and Antisimon have received correspondingly and the initial number of stones in the pile.
Output Specification:
If Simon wins, print "0" (without the quotes), otherwise print "1" (without the quotes).
Demo Input:
['3 5 9\n', '1 1 100\n']
Demo Output:
['0', '1']
Note:
The greatest common divisor of two non-negative integers *a* and *b* is such maximum positive integer *k*, that *a* is divisible by *k* without remainder and similarly, *b* is divisible by *k* without remainder. Let *gcd*(*a*, *b*) represent the operation of calculating the greatest common divisor of numbers *a* and *b*. Specifically, *gcd*(*x*, 0) = *gcd*(0, *x*) = *x*.
In the first sample the game will go like that:
- Simon should take *gcd*(3, 9) = 3 stones from the heap. After his move the heap has 6 stones left.- Antisimon should take *gcd*(5, 6) = 1 stone from the heap. After his move the heap has 5 stones left.- Simon should take *gcd*(3, 5) = 1 stone from the heap. After his move the heap has 4 stones left.- Antisimon should take *gcd*(5, 4) = 1 stone from the heap. After his move the heap has 3 stones left.- Simon should take *gcd*(3, 3) = 3 stones from the heap. After his move the heap has 0 stones left.- Antisimon should take *gcd*(5, 0) = 5 stones from the heap. As 0 < 5, it is impossible and Antisimon loses.
In the second sample each player during each move takes one stone from the heap. As *n* is even, Antisimon takes the last stone and Simon can't make a move after that. | ```python
l = list(map(int,input().split()))
a = l[0]
b = l[1]
n = l[2]
while:
if math.gcd(a,n) >= n:
n -= math.gcd(a,n)
else:
print(0)
exit()
if math.gcd(b,n) >= n:
n -= math.gcd(b,n)
else:
print(1)
exit()
``` | -1 |
|
723 | A | The New Year: Meeting Friends | PROGRAMMING | 800 | [
"implementation",
"math",
"sortings"
] | null | null | There are three friend living on the straight line *Ox* in Lineland. The first friend lives at the point *x*1, the second friend lives at the point *x*2, and the third friend lives at the point *x*3. They plan to celebrate the New Year together, so they need to meet at one point. What is the minimum total distance they have to travel in order to meet at some point and celebrate the New Year?
It's guaranteed that the optimal answer is always integer. | The first line of the input contains three distinct integers *x*1, *x*2 and *x*3 (1<=≤<=*x*1,<=*x*2,<=*x*3<=≤<=100) — the coordinates of the houses of the first, the second and the third friends respectively. | Print one integer — the minimum total distance the friends need to travel in order to meet together. | [
"7 1 4\n",
"30 20 10\n"
] | [
"6\n",
"20\n"
] | In the first sample, friends should meet at the point 4. Thus, the first friend has to travel the distance of 3 (from the point 7 to the point 4), the second friend also has to travel the distance of 3 (from the point 1 to the point 4), while the third friend should not go anywhere because he lives at the point 4. | 500 | [
{
"input": "7 1 4",
"output": "6"
},
{
"input": "30 20 10",
"output": "20"
},
{
"input": "1 4 100",
"output": "99"
},
{
"input": "100 1 91",
"output": "99"
},
{
"input": "1 45 100",
"output": "99"
},
{
"input": "1 2 3",
"output": "2"
},
{
"input": "71 85 88",
"output": "17"
},
{
"input": "30 38 99",
"output": "69"
},
{
"input": "23 82 95",
"output": "72"
},
{
"input": "22 41 47",
"output": "25"
},
{
"input": "9 94 77",
"output": "85"
},
{
"input": "1 53 51",
"output": "52"
},
{
"input": "25 97 93",
"output": "72"
},
{
"input": "42 53 51",
"output": "11"
},
{
"input": "81 96 94",
"output": "15"
},
{
"input": "21 5 93",
"output": "88"
},
{
"input": "50 13 75",
"output": "62"
},
{
"input": "41 28 98",
"output": "70"
},
{
"input": "69 46 82",
"output": "36"
},
{
"input": "87 28 89",
"output": "61"
},
{
"input": "44 45 40",
"output": "5"
},
{
"input": "86 97 68",
"output": "29"
},
{
"input": "43 92 30",
"output": "62"
},
{
"input": "16 70 1",
"output": "69"
},
{
"input": "40 46 19",
"output": "27"
},
{
"input": "71 38 56",
"output": "33"
},
{
"input": "82 21 80",
"output": "61"
},
{
"input": "75 8 35",
"output": "67"
},
{
"input": "75 24 28",
"output": "51"
},
{
"input": "78 23 56",
"output": "55"
},
{
"input": "85 31 10",
"output": "75"
},
{
"input": "76 50 9",
"output": "67"
},
{
"input": "95 37 34",
"output": "61"
},
{
"input": "84 61 35",
"output": "49"
},
{
"input": "87 85 37",
"output": "50"
},
{
"input": "1 3 2",
"output": "2"
},
{
"input": "4 2 6",
"output": "4"
},
{
"input": "6 9 3",
"output": "6"
},
{
"input": "12 4 8",
"output": "8"
},
{
"input": "15 10 5",
"output": "10"
},
{
"input": "1 50 17",
"output": "49"
},
{
"input": "10 5 15",
"output": "10"
},
{
"input": "8 1 9",
"output": "8"
},
{
"input": "3 5 4",
"output": "2"
},
{
"input": "2 1 3",
"output": "2"
},
{
"input": "1 8 2",
"output": "7"
},
{
"input": "1 100 2",
"output": "99"
},
{
"input": "1 4 6",
"output": "5"
}
] | 1,673,244,117 | 2,147,483,647 | Python 3 | OK | TESTS | 48 | 46 | 0 | a = list(map(int, input().split()))
print(max(a)-min(a))
| Title: The New Year: Meeting Friends
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are three friend living on the straight line *Ox* in Lineland. The first friend lives at the point *x*1, the second friend lives at the point *x*2, and the third friend lives at the point *x*3. They plan to celebrate the New Year together, so they need to meet at one point. What is the minimum total distance they have to travel in order to meet at some point and celebrate the New Year?
It's guaranteed that the optimal answer is always integer.
Input Specification:
The first line of the input contains three distinct integers *x*1, *x*2 and *x*3 (1<=≤<=*x*1,<=*x*2,<=*x*3<=≤<=100) — the coordinates of the houses of the first, the second and the third friends respectively.
Output Specification:
Print one integer — the minimum total distance the friends need to travel in order to meet together.
Demo Input:
['7 1 4\n', '30 20 10\n']
Demo Output:
['6\n', '20\n']
Note:
In the first sample, friends should meet at the point 4. Thus, the first friend has to travel the distance of 3 (from the point 7 to the point 4), the second friend also has to travel the distance of 3 (from the point 1 to the point 4), while the third friend should not go anywhere because he lives at the point 4. | ```python
a = list(map(int, input().split()))
print(max(a)-min(a))
``` | 3 |
|
245 | C | Game with Coins | PROGRAMMING | 1,700 | [
"greedy"
] | null | null | Two pirates Polycarpus and Vasily play a very interesting game. They have *n* chests with coins, the chests are numbered with integers from 1 to *n*. Chest number *i* has *a**i* coins.
Polycarpus and Vasily move in turns. Polycarpus moves first. During a move a player is allowed to choose a positive integer *x* (2·*x*<=+<=1<=≤<=*n*) and take a coin from each chest with numbers *x*, 2·*x*, 2·*x*<=+<=1. It may turn out that some chest has no coins, in this case the player doesn't take a coin from this chest. The game finishes when all chests get emptied.
Polycarpus isn't a greedy scrooge. Polycarpys is a lazy slob. So he wonders in what minimum number of moves the game can finish. Help Polycarpus, determine the minimum number of moves in which the game can finish. Note that Polycarpus counts not only his moves, he also counts Vasily's moves. | The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of chests with coins. The second line contains a sequence of space-separated integers: *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000), where *a**i* is the number of coins in the chest number *i* at the beginning of the game. | Print a single integer — the minimum number of moves needed to finish the game. If no sequence of turns leads to finishing the game, print -1. | [
"1\n1\n",
"3\n1 2 3\n"
] | [
"-1\n",
"3\n"
] | In the first test case there isn't a single move that can be made. That's why the players won't be able to empty the chests.
In the second sample there is only one possible move *x* = 1. This move should be repeated at least 3 times to empty the third chest. | 0 | [
{
"input": "1\n1",
"output": "-1"
},
{
"input": "3\n1 2 3",
"output": "3"
},
{
"input": "100\n269 608 534 956 993 409 297 735 258 451 468 422 125 407 580 769 857 383 419 67 377 230 842 113 169 427 287 75 372 133 456 450 644 303 638 40 217 445 427 730 168 341 371 633 237 951 142 596 528 509 236 782 44 467 607 326 267 15 564 858 499 337 74 346 443 436 48 795 206 403 379 313 382 620 341 978 209 696 879 810 872 336 983 281 602 521 762 782 733 184 307 567 245 983 201 966 546 70 5 973",
"output": "-1"
},
{
"input": "99\n557 852 325 459 557 350 719 719 400 228 985 674 942 322 212 553 191 58 720 262 798 884 20 275 576 971 684 340 581 175 641 552 190 277 293 928 261 504 83 950 423 211 571 159 44 428 131 273 181 555 430 437 901 376 361 989 225 399 712 935 279 975 525 631 442 558 457 904 491 598 321 396 537 555 73 415 842 162 284 847 847 139 305 150 300 664 831 894 260 747 466 563 97 907 42 340 553 471 411",
"output": "23450"
},
{
"input": "98\n204 880 89 270 128 298 522 176 611 49 492 475 977 701 197 837 600 361 355 70 640 472 312 510 914 665 869 105 411 812 74 324 727 412 161 703 392 364 752 74 446 156 333 82 557 764 145 803 36 293 776 276 810 909 877 488 521 865 200 817 445 577 49 165 755 961 867 819 260 836 276 756 649 169 457 28 598 328 692 487 673 563 24 310 913 639 824 346 481 538 509 861 764 108 479 14 552 752",
"output": "-1"
},
{
"input": "97\n691 452 909 730 594 55 622 633 13 359 246 925 172 25 535 930 170 528 933 878 130 548 253 745 116 494 862 574 888 609 18 448 208 354 133 181 330 89 364 198 412 157 152 300 910 99 808 228 435 872 985 364 911 634 289 235 761 978 631 212 314 828 277 347 965 524 222 381 84 970 743 116 57 975 33 289 194 493 853 584 338 987 686 926 718 806 170 902 349 137 849 671 783 853 564 495 711",
"output": "25165"
},
{
"input": "96\n529 832 728 246 165 3 425 338 520 373 945 726 208 404 329 918 579 183 319 38 268 136 353 980 614 483 47 987 717 54 451 275 938 841 649 147 917 949 169 322 626 103 266 415 423 627 822 757 641 610 331 203 172 814 806 734 706 147 119 798 480 622 153 176 278 735 632 944 853 400 699 476 976 589 417 446 141 307 557 576 355 763 404 87 332 429 516 649 570 279 893 969 154 246 353 920",
"output": "-1"
},
{
"input": "95\n368 756 196 705 632 759 228 794 922 387 803 176 755 727 963 658 797 190 249 845 110 916 941 215 655 17 95 751 2 396 395 47 419 784 325 626 856 969 838 501 945 48 84 689 423 963 485 831 848 189 540 42 273 243 322 288 106 260 550 681 542 224 677 902 295 490 338 858 325 638 6 484 88 746 697 355 385 472 262 864 77 378 419 55 945 109 862 101 982 70 936 323 822 447 437",
"output": "23078"
},
{
"input": "94\n311 135 312 221 906 708 32 251 677 753 502 329 790 106 949 942 558 845 532 949 952 800 585 450 857 198 88 516 832 193 532 171 253 918 194 752 339 534 450 625 967 345 199 612 936 650 499 256 191 576 590 73 374 968 382 139 50 725 38 76 763 827 905 83 801 53 748 421 94 420 665 844 496 360 81 512 685 638 671 960 902 802 785 863 558 276 15 305 202 669 276 621 841 192",
"output": "-1"
},
{
"input": "1\n546",
"output": "-1"
},
{
"input": "2\n707 629",
"output": "-1"
},
{
"input": "3\n868 762 256",
"output": "868"
},
{
"input": "4\n221 30 141 672",
"output": "-1"
},
{
"input": "5\n86 458 321 157 829",
"output": "1150"
},
{
"input": "6\n599 78 853 537 67 706",
"output": "-1"
},
{
"input": "7\n760 154 34 77 792 950 159",
"output": "2502"
},
{
"input": "8\n113 583 918 562 325 1 60 769",
"output": "-1"
},
{
"input": "9\n275 555 451 102 755 245 256 312 230",
"output": "1598"
},
{
"input": "10\n636 688 843 886 13 751 884 120 880 439",
"output": "-1"
},
{
"input": "11\n989 117 23 371 442 803 81 768 182 425 888",
"output": "3448"
},
{
"input": "55\n1 1 2 2 2 2 1 1 1 1 2 1 2 1 2 2 1 1 2 2 1 2 1 2 1 1 1 2 1 2 2 2 1 2 2 1 1 2 2 1 1 1 1 1 1 1 1 2 1 1 2 2 2 2 2",
"output": "32"
},
{
"input": "43\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "15"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "-1"
},
{
"input": "77\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000",
"output": "27000"
},
{
"input": "100\n999 1000 999 999 1000 1000 999 1000 999 999 999 999 1000 1000 1000 1000 1000 999 999 999 1000 999 1000 999 999 1000 1000 1000 1000 1000 1000 999 999 1000 1000 999 1000 1000 999 999 999 1000 999 1000 999 999 999 999 1000 1000 999 999 1000 999 1000 999 999 1000 999 1000 999 1000 1000 1000 999 1000 999 999 1000 1000 1000 1000 999 999 999 999 1000 1000 1000 1000 1000 1000 999 1000 1000 999 999 999 1000 999 1000 999 1000 1000 1000 999 999 1000 999 1000",
"output": "-1"
},
{
"input": "47\n16 17 18 13 14 12 18 13 19 13 13 11 13 17 10 18 16 16 19 11 20 17 14 18 12 15 16 20 11 16 17 19 12 16 19 16 18 19 19 10 11 19 13 12 11 17 13",
"output": "278"
},
{
"input": "74\n694 170 527 538 833 447 622 663 786 411 855 345 565 549 423 301 119 182 680 357 441 859 844 668 606 202 795 696 395 666 812 162 714 443 629 575 764 605 240 363 156 835 866 659 170 462 438 618 551 266 831 149 188 185 496 716 879 617 215 186 745 613 398 266 745 866 389 220 178 809 519 793 221 361",
"output": "-1"
},
{
"input": "99\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000",
"output": "34000"
},
{
"input": "99\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "34"
},
{
"input": "99\n1 1 1 1 1 2 2 1 2 2 1 2 2 2 1 1 2 1 1 1 1 1 1 1 1 2 2 2 1 2 1 2 1 2 2 2 1 2 2 2 1 1 2 1 2 1 1 2 2 2 1 2 2 2 1 2 1 1 1 2 1 2 1 1 1 1 2 1 1 1 1 2 1 2 2 1 2 2 2 2 1 1 2 2 1 2 1 1 1 2 1 1 2 1 1 1 1 2 2",
"output": "57"
},
{
"input": "99\n3 1 3 2 3 2 3 1 1 1 2 1 1 2 2 3 1 1 2 1 3 1 3 2 2 3 3 1 1 2 1 2 3 1 3 3 1 3 3 2 3 3 1 2 1 3 3 3 1 1 3 2 1 3 1 3 1 3 3 1 3 1 3 2 1 3 1 1 1 1 2 1 2 3 2 1 3 2 2 2 2 2 2 1 3 3 2 3 1 3 1 2 3 2 3 3 2 1 2",
"output": "92"
},
{
"input": "99\n3 3 3 3 3 2 2 3 3 2 2 3 2 2 2 3 3 3 2 3 3 3 3 2 2 2 3 2 3 3 3 3 3 2 2 2 3 2 3 2 2 2 3 2 3 3 3 2 2 3 2 3 2 2 2 3 3 2 3 2 2 3 2 2 2 3 2 2 3 3 3 3 3 3 3 3 3 3 2 3 3 2 3 2 3 3 2 2 3 3 3 3 3 3 3 2 2 2 3",
"output": "98"
},
{
"input": "23\n2 2 2 2 2 2 2 2 1 1 2 2 1 1 2 1 1 1 2 2 1 1 1",
"output": "15"
},
{
"input": "23\n1 2 1 3 2 2 3 1 3 3 3 2 1 1 2 3 1 2 3 3 2 1 1",
"output": "21"
},
{
"input": "23\n2 3 3 2 2 2 2 2 3 2 2 3 2 2 2 3 3 3 3 3 2 3 2",
"output": "22"
},
{
"input": "5\n2 2 2 2 2",
"output": "4"
},
{
"input": "5\n2 2 1 1 1",
"output": "3"
},
{
"input": "5\n2 1 2 2 1",
"output": "4"
},
{
"input": "5\n1 2 2 1 2",
"output": "4"
},
{
"input": "5\n1 1 2 4 4",
"output": "6"
}
] | 1,595,242,585 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 3 | 278 | 20,172,800 | n=int(input())
if n==1:
print(-1)
exit(0)
a=list(map(int,input().split(' ')))
a=[0]+a
# print(a)
ans=0
for i in range(1,n+1):
if 2*i+1>n:
continue
if a[i]==0 or a[2*i]==0 or a[2*i+1]==0 :
continue
mina=min([a[i],a[2*i],a[2*i+1]])
a[i],a[2*i],a[2*i+1]=a[i]-mina,a[2*i]-mina,a[2*i+1]-mina
ans+=mina
# print(a)
for i in range(1,n+1):
if 2*i+1>n:
continue
if a[i]>0 and a[2*i]>0:
mina=min([a[i],a[2*i]])
ans+=mina
a[i],a[2*i]=a[i]-mina,a[2*i]-mina
elif a[2*i+1]>0 and a[2*i]>0:
mina=min([a[2*i+1],a[2*i]])
ans+=mina
a[2*i+1],a[2*i]=a[2*i+1]-mina,a[2*i]-mina
elif a[2*i+1]>0 and a[i]>0:
mina=min([a[2*i+1],a[i]])
ans+=mina
a[2*i+1],a[i]=a[2*i+1]-mina,a[i]-mina
for i in range(1,n+1):
if 2*i+1>n:
continue
if a[i]>0:
ans+=a[i]
a[i]=0
elif a[2*i]>0:
ans+=a[2*i]
a[2*i]=0
elif a[2*i+1]>0:
ans+=a[2*i+1]
a[2*i+1]=0
for i in range(1,n+1):
if a[i]>0:
print(-1)
exit(0)
print(ans) | Title: Game with Coins
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Two pirates Polycarpus and Vasily play a very interesting game. They have *n* chests with coins, the chests are numbered with integers from 1 to *n*. Chest number *i* has *a**i* coins.
Polycarpus and Vasily move in turns. Polycarpus moves first. During a move a player is allowed to choose a positive integer *x* (2·*x*<=+<=1<=≤<=*n*) and take a coin from each chest with numbers *x*, 2·*x*, 2·*x*<=+<=1. It may turn out that some chest has no coins, in this case the player doesn't take a coin from this chest. The game finishes when all chests get emptied.
Polycarpus isn't a greedy scrooge. Polycarpys is a lazy slob. So he wonders in what minimum number of moves the game can finish. Help Polycarpus, determine the minimum number of moves in which the game can finish. Note that Polycarpus counts not only his moves, he also counts Vasily's moves.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of chests with coins. The second line contains a sequence of space-separated integers: *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000), where *a**i* is the number of coins in the chest number *i* at the beginning of the game.
Output Specification:
Print a single integer — the minimum number of moves needed to finish the game. If no sequence of turns leads to finishing the game, print -1.
Demo Input:
['1\n1\n', '3\n1 2 3\n']
Demo Output:
['-1\n', '3\n']
Note:
In the first test case there isn't a single move that can be made. That's why the players won't be able to empty the chests.
In the second sample there is only one possible move *x* = 1. This move should be repeated at least 3 times to empty the third chest. | ```python
n=int(input())
if n==1:
print(-1)
exit(0)
a=list(map(int,input().split(' ')))
a=[0]+a
# print(a)
ans=0
for i in range(1,n+1):
if 2*i+1>n:
continue
if a[i]==0 or a[2*i]==0 or a[2*i+1]==0 :
continue
mina=min([a[i],a[2*i],a[2*i+1]])
a[i],a[2*i],a[2*i+1]=a[i]-mina,a[2*i]-mina,a[2*i+1]-mina
ans+=mina
# print(a)
for i in range(1,n+1):
if 2*i+1>n:
continue
if a[i]>0 and a[2*i]>0:
mina=min([a[i],a[2*i]])
ans+=mina
a[i],a[2*i]=a[i]-mina,a[2*i]-mina
elif a[2*i+1]>0 and a[2*i]>0:
mina=min([a[2*i+1],a[2*i]])
ans+=mina
a[2*i+1],a[2*i]=a[2*i+1]-mina,a[2*i]-mina
elif a[2*i+1]>0 and a[i]>0:
mina=min([a[2*i+1],a[i]])
ans+=mina
a[2*i+1],a[i]=a[2*i+1]-mina,a[i]-mina
for i in range(1,n+1):
if 2*i+1>n:
continue
if a[i]>0:
ans+=a[i]
a[i]=0
elif a[2*i]>0:
ans+=a[2*i]
a[2*i]=0
elif a[2*i+1]>0:
ans+=a[2*i+1]
a[2*i+1]=0
for i in range(1,n+1):
if a[i]>0:
print(-1)
exit(0)
print(ans)
``` | 0 |
|
59 | A | Word | PROGRAMMING | 800 | [
"implementation",
"strings"
] | A. Word | 2 | 256 | Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. | The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. | Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. | [
"HoUse\n",
"ViP\n",
"maTRIx\n"
] | [
"house\n",
"VIP\n",
"matrix\n"
] | none | 500 | [
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,592,142,233 | 2,147,483,647 | Python 3 | OK | TESTS | 30 | 218 | 0 | s = input()
n = len(s)
lower = 0
upper = 0
for i in s:
if i.islower():
lower+=1
elif i.isupper():
upper+=1
if lower >= upper:
s = s.lower()
else:
s= s.upper()
print(s) | Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none | ```python
s = input()
n = len(s)
lower = 0
upper = 0
for i in s:
if i.islower():
lower+=1
elif i.isupper():
upper+=1
if lower >= upper:
s = s.lower()
else:
s= s.upper()
print(s)
``` | 3.9455 |
137 | A | Postcards and photos | PROGRAMMING | 900 | [
"implementation"
] | null | null | Polycarpus has postcards and photos hung in a row on the wall. He decided to put them away to the closet and hang on the wall a famous painter's picture. Polycarpus does it like that: he goes from the left to the right and removes the objects consecutively. As Polycarpus doesn't want any mix-ups to happen, he will not carry in his hands objects of two different types. In other words, Polycarpus can't carry both postcards and photos simultaneously. Sometimes he goes to the closet and puts the objects there, thus leaving his hands free. Polycarpus must put all the postcards and photos to the closet. He cannot skip objects. What minimum number of times he should visit the closet if he cannot carry more than 5 items? | The only line of the input data contains a non-empty string consisting of letters "С" and "P" whose length does not exceed 100 characters. If the *i*-th character in the string is the letter "С", that means that the *i*-th object (the numbering goes from the left to the right) on Polycarpus' wall is a postcard. And if the *i*-th character is the letter "P", than the *i*-th object on the wall is a photo. | Print the only number — the minimum number of times Polycarpus has to visit the closet. | [
"CPCPCPC\n",
"CCCCCCPPPPPP\n",
"CCCCCCPPCPPPPPPPPPP\n",
"CCCCCCCCCC\n"
] | [
"7\n",
"4\n",
"6\n",
"2\n"
] | In the first sample Polycarpus needs to take one item to the closet 7 times.
In the second sample Polycarpus can first take 3 postcards to the closet; then 3 more. He can take the 6 photos that are left in the similar way, going to the closet twice.
In the third sample Polycarpus can visit the closet twice, both times carrying 3 postcards. Then he can take there 2 photos at once, then one postcard and finally, he can carry the last 10 photos if he visits the closet twice.
In the fourth sample Polycarpus can visit the closet twice and take there all 10 postcards (5 items during each go). | 500 | [
{
"input": "CPCPCPC",
"output": "7"
},
{
"input": "CCCCCCPPPPPP",
"output": "4"
},
{
"input": "CCCCCCPPCPPPPPPPPPP",
"output": "6"
},
{
"input": "CCCCCCCCCC",
"output": "2"
},
{
"input": "CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC",
"output": "20"
},
{
"input": "CPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCPCP",
"output": "100"
},
{
"input": "CCCCCCPPPPPPCCCCCCPPPPPPCCCCCCPPPPPPCCCCCCPPPPPPCCCCCCPPPPPPCCCCCCPPPPPPCCCCCCPPPPPP",
"output": "28"
},
{
"input": "P",
"output": "1"
},
{
"input": "C",
"output": "1"
},
{
"input": "PC",
"output": "2"
},
{
"input": "PPPPP",
"output": "1"
},
{
"input": "PPPP",
"output": "1"
},
{
"input": "CCCCCCCCCC",
"output": "2"
},
{
"input": "CP",
"output": "2"
},
{
"input": "CPCCPCPPPC",
"output": "7"
},
{
"input": "PPCPCCPCPPCCPPPPPPCP",
"output": "12"
},
{
"input": "PCPCCPCPPCCPCPCCPPPPPCPCPCPCCC",
"output": "20"
},
{
"input": "CCPPPPPCPCCPPPCCPPCPCCPCPPCPPCCCPPCPPPCC",
"output": "21"
},
{
"input": "CPPCCCCCCPCCCCPCCPCPPPCPCCCCCCCPCCPPCCCPCCCCCPPCCC",
"output": "23"
},
{
"input": "PPCCCCPPCCPPPCCCCPPPPPCPPPCPPPCCCPCCCPCPPPCPCCCPCCPPCCPPPPPC",
"output": "26"
},
{
"input": "PPCPPCCCCCPCCCPCCPCCCCPPPCCCCPCPCCPCPCPCPPPPCCPPPPPPPCPCPPPCPCPCPCPPPC",
"output": "39"
},
{
"input": "CCPCPPPPCPPPPCCCCPCCPCPCCPPCPCCCPPCCCCPCCCPCPCCPPPCPPPCPCPPPPPCPCCPCCPPCCCPCPPPC",
"output": "43"
},
{
"input": "CCPPCPCPCPPCCCPCPPPCCCCCPCPPCCCPPCPCPPPPCPPCPPPPCCCPCCPCPPPCPCPPCCCPCCCCCCPCCCCPCCPPPPCCPP",
"output": "47"
},
{
"input": "PPCPPPPCCCCPPPPCPPPPPPPPCPCPPCCPPPPPPPPCPPPPCCCCPPPPCPPCPCPPPCCPPCPPCCCPCPPCCCCCCPCPCPCPPCPCPCPPPCCC",
"output": "49"
},
{
"input": "CCPCCCPPCPPCPCCCPCPPCPPCPPCCCCCCCPCPPCPCCPCCPCPCPCCCPCCCPPPCCPCCPPCCCCCPPPPCPCPPCPCPCCPCPPP",
"output": "53"
},
{
"input": "PCPCPPPPCPCPPPCPPCCCPCPCPCPPCPPPPCCPPPCPPPCPPPPCCPPCCCPCCPCCCCPCCPCPPCPCCCPCPPCP",
"output": "47"
},
{
"input": "PCCPPCCCPPCPPCC",
"output": "8"
},
{
"input": "CCCPPPPPPCCCCPCCPCCCCCCPCCCPPPCPC",
"output": "15"
},
{
"input": "CPPCCPPCCPPPCCCPPPPCPPPPPPPCCPCPCCPPPPCCCPPCCPCCPPCCCPCCPCPPPPCCPP",
"output": "31"
},
{
"input": "CCCCCPPPCCPCPCCPPPPCPCCCPCPPCPCPPPPPCCPCPCPC",
"output": "25"
},
{
"input": "PPPPPPPPPCPCP",
"output": "6"
},
{
"input": "PPPCPCPCCCPPCPCCPPPPCCCPCCP",
"output": "15"
},
{
"input": "PCPCCPCPPPPPPCPCCPCPCPCCPPPCPCPCPPCPPCCPCPCCCPCCCPPCPCPCCPCPPPPCCCCCCPPCCPCCCCCPCCCCPPPCPCCCCCPCPCP",
"output": "59"
},
{
"input": "PCCPCPPCCCCCPCCCPCCCPPCCCCCPPPCCPPPPPPPPCPPPCCPPCPPCPCP",
"output": "26"
},
{
"input": "CPCPCCPPPPCCPPCPPCPPCCCCCCPCCPPPCPPCPCCCCCCPCPCCCCCPCCCCCCPCCPPCCP",
"output": "35"
},
{
"input": "PPCCCCCCPP",
"output": "4"
},
{
"input": "CCCCCCCCCCCCPPCCCCPP",
"output": "6"
},
{
"input": "PPPPPPPPPPPCCCCCCCCCCCCCCCCCCP",
"output": "8"
},
{
"input": "PPPPPPPPPPPPPPPPPPPPPCCCCCCCCCCCPPPPCCCC",
"output": "10"
},
{
"input": "PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCCCCCCCCCPPPC",
"output": "12"
},
{
"input": "CCCCCCCCCPPPPPPPPPPPPPPPPPPPPCCCCCCCCCCCCCCCCCCCCCCCCPPPPPCC",
"output": "13"
},
{
"input": "CCCCCCCCCCCCCCCCCCCCCCCCCPPPCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC",
"output": "15"
},
{
"input": "CCCCCPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCCCCCCCCCCCCCPPPPPPPCCPPP",
"output": "18"
},
{
"input": "PPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPPCCCCCCCCCCCCCCCCCCCCCCCCCCCPPPPPPPPPPPPPPPPPPP",
"output": "19"
},
{
"input": "PPPPPPPPPPPPPPPPPPPPPPPCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCPPPPPCCCPPPPCCCCCPCC",
"output": "23"
}
] | 1,586,246,234 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 16 | 218 | 307,200 | # -*- coding: utf-8 -*-
"""
Created on Tue Apr 7 02:29:32 2020
@author: alexi
"""
#https://codeforces.com/problemset/problem/137/A --- Alexis Galvan
def post_cards():
string = input()
dic = {'C':0,'P':0}
output = 0
aux = string[0]
for i in range(len(string)):
if string[i] != aux:
dic[aux] = 0
dic[string[i]] = 1
aux = string[i]
output += 1
else:
dic[string[i]] += 1
if dic[string[i]] == 5:
dic[string[i]] = 0
output += 1
if dic['C'] > 0 and dic['P'] == 0 or dic['P'] > 0 and dic['C'] == 0:
output += 1
return output
A = post_cards()
print(A)
| Title: Postcards and photos
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarpus has postcards and photos hung in a row on the wall. He decided to put them away to the closet and hang on the wall a famous painter's picture. Polycarpus does it like that: he goes from the left to the right and removes the objects consecutively. As Polycarpus doesn't want any mix-ups to happen, he will not carry in his hands objects of two different types. In other words, Polycarpus can't carry both postcards and photos simultaneously. Sometimes he goes to the closet and puts the objects there, thus leaving his hands free. Polycarpus must put all the postcards and photos to the closet. He cannot skip objects. What minimum number of times he should visit the closet if he cannot carry more than 5 items?
Input Specification:
The only line of the input data contains a non-empty string consisting of letters "С" and "P" whose length does not exceed 100 characters. If the *i*-th character in the string is the letter "С", that means that the *i*-th object (the numbering goes from the left to the right) on Polycarpus' wall is a postcard. And if the *i*-th character is the letter "P", than the *i*-th object on the wall is a photo.
Output Specification:
Print the only number — the minimum number of times Polycarpus has to visit the closet.
Demo Input:
['CPCPCPC\n', 'CCCCCCPPPPPP\n', 'CCCCCCPPCPPPPPPPPPP\n', 'CCCCCCCCCC\n']
Demo Output:
['7\n', '4\n', '6\n', '2\n']
Note:
In the first sample Polycarpus needs to take one item to the closet 7 times.
In the second sample Polycarpus can first take 3 postcards to the closet; then 3 more. He can take the 6 photos that are left in the similar way, going to the closet twice.
In the third sample Polycarpus can visit the closet twice, both times carrying 3 postcards. Then he can take there 2 photos at once, then one postcard and finally, he can carry the last 10 photos if he visits the closet twice.
In the fourth sample Polycarpus can visit the closet twice and take there all 10 postcards (5 items during each go). | ```python
# -*- coding: utf-8 -*-
"""
Created on Tue Apr 7 02:29:32 2020
@author: alexi
"""
#https://codeforces.com/problemset/problem/137/A --- Alexis Galvan
def post_cards():
string = input()
dic = {'C':0,'P':0}
output = 0
aux = string[0]
for i in range(len(string)):
if string[i] != aux:
dic[aux] = 0
dic[string[i]] = 1
aux = string[i]
output += 1
else:
dic[string[i]] += 1
if dic[string[i]] == 5:
dic[string[i]] = 0
output += 1
if dic['C'] > 0 and dic['P'] == 0 or dic['P'] > 0 and dic['C'] == 0:
output += 1
return output
A = post_cards()
print(A)
``` | 0 |
|
514 | A | Chewbaсca and Number | PROGRAMMING | 1,200 | [
"greedy",
"implementation"
] | null | null | Luke Skywalker gave Chewbacca an integer number *x*. Chewbacca isn't good at numbers but he loves inverting digits in them. Inverting digit *t* means replacing it with digit 9<=-<=*t*.
Help Chewbacca to transform the initial number *x* to the minimum possible positive number by inverting some (possibly, zero) digits. The decimal representation of the final number shouldn't start with a zero. | The first line contains a single integer *x* (1<=≤<=*x*<=≤<=1018) — the number that Luke Skywalker gave to Chewbacca. | Print the minimum possible positive number that Chewbacca can obtain after inverting some digits. The number shouldn't contain leading zeroes. | [
"27\n",
"4545\n"
] | [
"22\n",
"4444\n"
] | none | 500 | [
{
"input": "27",
"output": "22"
},
{
"input": "4545",
"output": "4444"
},
{
"input": "1",
"output": "1"
},
{
"input": "9",
"output": "9"
},
{
"input": "8772",
"output": "1222"
},
{
"input": "81",
"output": "11"
},
{
"input": "71723447",
"output": "21223442"
},
{
"input": "91730629",
"output": "91230320"
},
{
"input": "420062703497",
"output": "420032203402"
},
{
"input": "332711047202",
"output": "332211042202"
},
{
"input": "3395184971407775",
"output": "3304114021402224"
},
{
"input": "8464062628894325",
"output": "1434032321104324"
},
{
"input": "164324828731963982",
"output": "134324121231033012"
},
{
"input": "384979173822804784",
"output": "314020123122104214"
},
{
"input": "41312150450968417",
"output": "41312140440031412"
},
{
"input": "2156",
"output": "2143"
},
{
"input": "1932",
"output": "1032"
},
{
"input": "5902",
"output": "4002"
},
{
"input": "5728",
"output": "4221"
},
{
"input": "8537",
"output": "1432"
},
{
"input": "55403857",
"output": "44403142"
},
{
"input": "270739",
"output": "220230"
},
{
"input": "28746918",
"output": "21243011"
},
{
"input": "10279211",
"output": "10220211"
},
{
"input": "40289679",
"output": "40210320"
},
{
"input": "545203238506",
"output": "444203231403"
},
{
"input": "461117063340",
"output": "431112033340"
},
{
"input": "658492686568",
"output": "341402313431"
},
{
"input": "857373361868",
"output": "142323331131"
},
{
"input": "429325660016",
"output": "420324330013"
},
{
"input": "9894448650287940",
"output": "9104441340212040"
},
{
"input": "6354510839296263",
"output": "3344410130203233"
},
{
"input": "6873575462224593",
"output": "3123424432224403"
},
{
"input": "4237951492601449",
"output": "4232041402301440"
},
{
"input": "2680352384836991",
"output": "2310342314133001"
},
{
"input": "606187734191890310",
"output": "303112234101100310"
},
{
"input": "351499943576823355",
"output": "341400043423123344"
},
{
"input": "180593481782177068",
"output": "110403411212122031"
},
{
"input": "999999999999999999",
"output": "900000000000000000"
},
{
"input": "1000000000000000000",
"output": "1000000000000000000"
},
{
"input": "9999",
"output": "9000"
},
{
"input": "99",
"output": "90"
},
{
"input": "9991",
"output": "9001"
}
] | 1,685,201,879 | 2,147,483,647 | PyPy 3-64 | RUNTIME_ERROR | TESTS | 0 | 61 | 2,764,800 | n=int(input())
s=str(n)
res=''
for i in range(len(s)):
if s[i]>=5 & s[i]<9:
res+=str(9-int(s[i]))
else:
res+=s[i]
print(res) | Title: Chewbaсca and Number
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Luke Skywalker gave Chewbacca an integer number *x*. Chewbacca isn't good at numbers but he loves inverting digits in them. Inverting digit *t* means replacing it with digit 9<=-<=*t*.
Help Chewbacca to transform the initial number *x* to the minimum possible positive number by inverting some (possibly, zero) digits. The decimal representation of the final number shouldn't start with a zero.
Input Specification:
The first line contains a single integer *x* (1<=≤<=*x*<=≤<=1018) — the number that Luke Skywalker gave to Chewbacca.
Output Specification:
Print the minimum possible positive number that Chewbacca can obtain after inverting some digits. The number shouldn't contain leading zeroes.
Demo Input:
['27\n', '4545\n']
Demo Output:
['22\n', '4444\n']
Note:
none | ```python
n=int(input())
s=str(n)
res=''
for i in range(len(s)):
if s[i]>=5 & s[i]<9:
res+=str(9-int(s[i]))
else:
res+=s[i]
print(res)
``` | -1 |
|
365 | A | Good Number | PROGRAMMING | 1,100 | [
"implementation"
] | null | null | Let's call a number *k*-good if it contains all digits not exceeding *k* (0,<=...,<=*k*). You've got a number *k* and an array *a* containing *n* numbers. Find out how many *k*-good numbers are in *a* (count each number every time it occurs in array *a*). | The first line contains integers *n* and *k* (1<=≤<=*n*<=≤<=100, 0<=≤<=*k*<=≤<=9). The *i*-th of the following *n* lines contains integer *a**i* without leading zeroes (1<=≤<=*a**i*<=≤<=109). | Print a single integer — the number of *k*-good numbers in *a*. | [
"10 6\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n",
"2 1\n1\n10\n"
] | [
"10\n",
"1\n"
] | none | 500 | [
{
"input": "10 6\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560",
"output": "10"
},
{
"input": "2 1\n1\n10",
"output": "1"
},
{
"input": "1 0\n1000000000",
"output": "1"
},
{
"input": "1 1\n1000000000",
"output": "1"
},
{
"input": "6 0\n10\n102\n120\n1032\n1212103\n1999999",
"output": "5"
},
{
"input": "1 3\n1000000000",
"output": "0"
},
{
"input": "1 9\n1000000000",
"output": "0"
},
{
"input": "1 0\n1",
"output": "0"
},
{
"input": "1 1\n1",
"output": "0"
},
{
"input": "1 3\n1",
"output": "0"
},
{
"input": "1 9\n1",
"output": "0"
},
{
"input": "2 8\n123456780\n123",
"output": "1"
},
{
"input": "2 8\n12345678\n1230",
"output": "0"
},
{
"input": "6 1\n10\n102\n120\n1032\n1212103\n1999999",
"output": "5"
},
{
"input": "6 2\n10\n102\n120\n1032\n1212103\n1999999",
"output": "4"
},
{
"input": "6 3\n10\n102\n120\n1032\n1212103\n1999999",
"output": "2"
},
{
"input": "6 9\n10\n102\n120\n1032\n1212103\n1999999",
"output": "0"
},
{
"input": "1 2\n2220",
"output": "0"
}
] | 1,663,699,693 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 2 | 46 | 0 | n, k = map(int, input().split())
count = 0
for i in range(n):
test = input()
Mistaken = False
for j in range(k+1):
if test.find(str(j)) == -1:
Mistaken = True
break
for l in range(k+1, 10):
if test.find(str(l)) != -1:
Mistaken = True
break
if not Mistaken:
count += 1
print(count)
| Title: Good Number
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Let's call a number *k*-good if it contains all digits not exceeding *k* (0,<=...,<=*k*). You've got a number *k* and an array *a* containing *n* numbers. Find out how many *k*-good numbers are in *a* (count each number every time it occurs in array *a*).
Input Specification:
The first line contains integers *n* and *k* (1<=≤<=*n*<=≤<=100, 0<=≤<=*k*<=≤<=9). The *i*-th of the following *n* lines contains integer *a**i* without leading zeroes (1<=≤<=*a**i*<=≤<=109).
Output Specification:
Print a single integer — the number of *k*-good numbers in *a*.
Demo Input:
['10 6\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n1234560\n', '2 1\n1\n10\n']
Demo Output:
['10\n', '1\n']
Note:
none | ```python
n, k = map(int, input().split())
count = 0
for i in range(n):
test = input()
Mistaken = False
for j in range(k+1):
if test.find(str(j)) == -1:
Mistaken = True
break
for l in range(k+1, 10):
if test.find(str(l)) != -1:
Mistaken = True
break
if not Mistaken:
count += 1
print(count)
``` | 0 |
|
455 | A | Boredom | PROGRAMMING | 1,500 | [
"dp"
] | null | null | Alex doesn't like boredom. That's why whenever he gets bored, he comes up with games. One long winter evening he came up with a game and decided to play it.
Given a sequence *a* consisting of *n* integers. The player can make several steps. In a single step he can choose an element of the sequence (let's denote it *a**k*) and delete it, at that all elements equal to *a**k*<=+<=1 and *a**k*<=-<=1 also must be deleted from the sequence. That step brings *a**k* points to the player.
Alex is a perfectionist, so he decided to get as many points as possible. Help him. | The first line contains integer *n* (1<=≤<=*n*<=≤<=105) that shows how many numbers are in Alex's sequence.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=105). | Print a single integer — the maximum number of points that Alex can earn. | [
"2\n1 2\n",
"3\n1 2 3\n",
"9\n1 2 1 3 2 2 2 2 3\n"
] | [
"2\n",
"4\n",
"10\n"
] | Consider the third test example. At first step we need to choose any element equal to 2. After that step our sequence looks like this [2, 2, 2, 2]. Then we do 4 steps, on each step we choose any element equals to 2. In total we earn 10 points. | 500 | [
{
"input": "2\n1 2",
"output": "2"
},
{
"input": "3\n1 2 3",
"output": "4"
},
{
"input": "9\n1 2 1 3 2 2 2 2 3",
"output": "10"
},
{
"input": "5\n3 3 4 5 4",
"output": "11"
},
{
"input": "5\n5 3 5 3 4",
"output": "16"
},
{
"input": "5\n4 2 3 2 5",
"output": "9"
},
{
"input": "10\n10 5 8 9 5 6 8 7 2 8",
"output": "46"
},
{
"input": "10\n1 1 1 1 1 1 2 3 4 4",
"output": "14"
},
{
"input": "100\n6 6 8 9 7 9 6 9 5 7 7 4 5 3 9 1 10 3 4 5 8 9 6 5 6 4 10 9 1 4 1 7 1 4 9 10 8 2 9 9 10 5 8 9 5 6 8 7 2 8 7 6 2 6 10 8 6 2 5 5 3 2 8 8 5 3 6 2 1 4 7 2 7 3 7 4 10 10 7 5 4 7 5 10 7 1 1 10 7 7 7 2 3 4 2 8 4 7 4 4",
"output": "296"
},
{
"input": "100\n6 1 5 7 10 10 2 7 3 7 2 10 7 6 3 5 5 5 3 7 2 4 2 7 7 4 2 8 2 10 4 7 9 1 1 7 9 7 1 10 10 9 5 6 10 1 7 5 8 1 1 5 3 10 2 4 3 5 2 7 4 9 5 10 1 3 7 6 6 9 3 6 6 10 1 10 6 1 10 3 4 1 7 9 2 7 8 9 3 3 2 4 6 6 1 2 9 4 1 2",
"output": "313"
},
{
"input": "100\n7 6 3 8 8 3 10 5 3 8 6 4 6 9 6 7 3 9 10 7 5 5 9 10 7 2 3 8 9 5 4 7 9 3 6 4 9 10 7 6 8 7 6 6 10 3 7 4 5 7 7 5 1 5 4 8 7 3 3 4 7 8 5 9 2 2 3 1 6 4 6 6 6 1 7 10 7 4 5 3 9 2 4 1 5 10 9 3 9 6 8 5 2 1 10 4 8 5 10 9",
"output": "298"
},
{
"input": "100\n2 10 9 1 2 6 7 2 2 8 9 9 9 5 6 2 5 1 1 10 7 4 5 5 8 1 9 4 10 1 9 3 1 8 4 10 8 8 2 4 6 5 1 4 2 2 1 2 8 5 3 9 4 10 10 7 8 6 1 8 2 6 7 1 6 7 3 10 10 3 7 7 6 9 6 8 8 10 4 6 4 3 3 3 2 3 10 6 8 5 5 10 3 7 3 1 1 1 5 5",
"output": "312"
},
{
"input": "100\n4 9 7 10 4 7 2 6 1 9 1 8 7 5 5 7 6 7 9 8 10 5 3 5 7 10 3 2 1 3 8 9 4 10 4 7 6 4 9 6 7 1 9 4 3 5 8 9 2 7 10 5 7 5 3 8 10 3 8 9 3 4 3 10 6 5 1 8 3 2 5 8 4 7 5 3 3 2 6 9 9 8 2 7 6 3 2 2 8 8 4 5 6 9 2 3 2 2 5 2",
"output": "287"
},
{
"input": "100\n4 8 10 1 8 8 8 1 10 3 1 8 6 8 6 1 10 3 3 3 3 7 2 1 1 6 10 1 7 9 8 10 3 8 6 2 1 6 5 6 10 8 9 7 4 3 10 5 3 9 10 5 10 8 8 5 7 8 9 5 3 9 9 2 7 8 1 10 4 9 2 8 10 10 5 8 5 1 7 3 4 5 2 5 9 3 2 5 6 2 3 10 1 5 9 6 10 4 10 8",
"output": "380"
},
{
"input": "100\n4 8 10 1 8 8 8 1 10 3 1 8 6 8 6 1 10 3 3 3 3 7 2 1 1 6 10 1 7 9 8 10 3 8 6 2 1 6 5 6 10 8 9 7 4 3 10 5 3 9 10 5 10 8 8 5 7 8 9 5 3 9 9 2 7 8 1 10 4 9 2 8 10 10 5 8 5 1 7 3 4 5 2 5 9 3 2 5 6 2 3 10 1 5 9 6 10 4 10 8",
"output": "380"
},
{
"input": "100\n10 5 8 4 4 4 1 4 5 8 3 10 2 4 1 10 8 1 1 6 8 4 2 9 1 3 1 7 7 9 3 5 5 8 6 9 9 4 8 1 3 3 2 6 1 5 4 5 3 5 5 6 7 5 7 9 3 5 4 9 2 6 8 1 1 7 7 3 8 9 8 7 3 2 4 1 6 1 3 9 4 2 2 8 5 10 1 8 8 5 1 5 6 9 4 5 6 5 10 2",
"output": "265"
},
{
"input": "100\n7 5 1 8 5 6 6 2 6 2 7 7 3 6 2 4 4 2 10 2 2 2 10 6 6 1 5 10 9 1 5 9 8 9 4 1 10 5 7 5 7 6 4 8 8 1 7 8 3 8 2 1 8 4 10 3 5 6 6 10 9 6 5 1 10 7 6 9 9 2 10 10 9 1 2 1 7 7 4 10 1 10 5 5 3 8 9 8 1 4 10 2 4 5 4 4 1 6 2 9",
"output": "328"
},
{
"input": "100\n5 6 10 7 1 7 10 1 9 1 5 1 4 1 3 3 7 9 1 6 1 6 5 7 1 6 3 1 3 6 3 8 2 4 1 5 2 10 7 3 10 4 10 1 5 4 2 9 7 9 5 7 10 4 1 4 8 9 3 1 3 7 7 4 3 7 7 10 6 9 5 5 6 5 3 9 8 8 5 5 4 10 9 4 10 4 1 8 3 5 4 10 9 3 10 4 10 7 10 9",
"output": "324"
},
{
"input": "10\n7 4 5 3 9 1 10 3 4 5",
"output": "34"
},
{
"input": "10\n8 9 6 5 6 4 10 9 1 4",
"output": "39"
},
{
"input": "10\n1 7 1 4 9 10 8 2 9 9",
"output": "40"
},
{
"input": "1\n100000",
"output": "100000"
}
] | 1,669,053,157 | 2,147,483,647 | Python 3 | OK | TESTS | 47 | 140 | 7,065,600 | # -*- coding: utf-8 -*-
"""
Created on Tue Nov 22 01:12:17 2022
@author: thinkpad
"""
n = int(input())
a = [int(i) for i in input().split()]
s = [0]*100002
for i in a:
s[i]+=i
res,b=0,0
for d in s:
res,b = max(res,b),res+d
print(res) | Title: Boredom
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Alex doesn't like boredom. That's why whenever he gets bored, he comes up with games. One long winter evening he came up with a game and decided to play it.
Given a sequence *a* consisting of *n* integers. The player can make several steps. In a single step he can choose an element of the sequence (let's denote it *a**k*) and delete it, at that all elements equal to *a**k*<=+<=1 and *a**k*<=-<=1 also must be deleted from the sequence. That step brings *a**k* points to the player.
Alex is a perfectionist, so he decided to get as many points as possible. Help him.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) that shows how many numbers are in Alex's sequence.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=105).
Output Specification:
Print a single integer — the maximum number of points that Alex can earn.
Demo Input:
['2\n1 2\n', '3\n1 2 3\n', '9\n1 2 1 3 2 2 2 2 3\n']
Demo Output:
['2\n', '4\n', '10\n']
Note:
Consider the third test example. At first step we need to choose any element equal to 2. After that step our sequence looks like this [2, 2, 2, 2]. Then we do 4 steps, on each step we choose any element equals to 2. In total we earn 10 points. | ```python
# -*- coding: utf-8 -*-
"""
Created on Tue Nov 22 01:12:17 2022
@author: thinkpad
"""
n = int(input())
a = [int(i) for i in input().split()]
s = [0]*100002
for i in a:
s[i]+=i
res,b=0,0
for d in s:
res,b = max(res,b),res+d
print(res)
``` | 3 |
|
637 | A | Voting for Photos | PROGRAMMING | 1,000 | [
"*special",
"constructive algorithms",
"implementation"
] | null | null | After celebrating the midcourse the students of one of the faculties of the Berland State University decided to conduct a vote for the best photo. They published the photos in the social network and agreed on the rules to choose a winner: the photo which gets most likes wins. If multiple photoes get most likes, the winner is the photo that gets this number first.
Help guys determine the winner photo by the records of likes. | The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the total likes to the published photoes.
The second line contains *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1<=000<=000), where *a**i* is the identifier of the photo which got the *i*-th like. | Print the identifier of the photo which won the elections. | [
"5\n1 3 2 2 1\n",
"9\n100 200 300 200 100 300 300 100 200\n"
] | [
"2\n",
"300\n"
] | In the first test sample the photo with id 1 got two likes (first and fifth), photo with id 2 got two likes (third and fourth), and photo with id 3 got one like (second).
Thus, the winner is the photo with identifier 2, as it got:
- more likes than the photo with id 3; - as many likes as the photo with id 1, but the photo with the identifier 2 got its second like earlier. | 500 | [
{
"input": "5\n1 3 2 2 1",
"output": "2"
},
{
"input": "9\n100 200 300 200 100 300 300 100 200",
"output": "300"
},
{
"input": "1\n5",
"output": "5"
},
{
"input": "1\n1000000",
"output": "1000000"
},
{
"input": "5\n1 3 4 2 2",
"output": "2"
},
{
"input": "10\n2 1 2 3 1 5 8 7 4 8",
"output": "2"
},
{
"input": "7\n1 1 2 2 2 3 3",
"output": "2"
},
{
"input": "12\n2 3 1 2 3 3 3 2 1 1 2 1",
"output": "3"
},
{
"input": "15\n7 6 8 4 9 8 7 3 4 6 7 5 4 2 8",
"output": "7"
},
{
"input": "15\n100 200 300 500 300 400 600 300 100 200 400 300 600 200 100",
"output": "300"
},
{
"input": "10\n677171 677171 677171 677171 672280 677171 677171 672280 672280 677171",
"output": "677171"
},
{
"input": "15\n137419 137419 531977 438949 137419 438949 438949 137419 438949 531977 531977 531977 438949 438949 438949",
"output": "438949"
},
{
"input": "20\n474463 517819 640039 640039 640039 640039 474463 474463 474463 640039 640039 474463 474463 425567 474463 517819 640039 474463 517819 517819",
"output": "474463"
},
{
"input": "40\n119631 119631 772776 119631 658661 119631 108862 524470 125132 700668 69196 844949 154577 108862 108862 108862 597344 940938 989698 108862 154577 69196 125132 687080 940938 125132 69196 69196 125132 566152 953083 406319 380068 119631 154577 125132 413984 69196 154577 154577",
"output": "108862"
},
{
"input": "5\n1 1 1000000 1000000 1000000",
"output": "1000000"
},
{
"input": "5\n1000000 1 1 1000000 1",
"output": "1"
},
{
"input": "10\n1 1 1000000 1000000 1000000 1 1000000 1 1 1000000",
"output": "1"
},
{
"input": "8\n1000000 1000000 1 1 1 1000000 1000000 1",
"output": "1000000"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "2\n1 1",
"output": "1"
},
{
"input": "2\n1000000 1",
"output": "1000000"
},
{
"input": "2\n1 1000000",
"output": "1"
},
{
"input": "2\n1000000 1000000",
"output": "1000000"
},
{
"input": "3\n1 1 1",
"output": "1"
},
{
"input": "3\n1 1 2",
"output": "1"
},
{
"input": "3\n1 2 1",
"output": "1"
},
{
"input": "3\n2 1 1",
"output": "1"
},
{
"input": "4\n1 1000000 1000000 1",
"output": "1000000"
}
] | 1,457,897,193 | 26,793 | Python 3 | OK | TESTS | 65 | 77 | 819,200 | # -*- coding: utf-8 -*-
"""
Created on Sun Mar 13 19:40:03 2016
@author: Kostya S.
"""
from functools import cmp_to_key
n = int(input())
d = {}
a = [int(i) for i in input().split()]
for i,e in enumerate(a):
d[e] = (i+1,1,e) if d.get(e) == None else (i+1,d[e][1] + 1,e)
t1 = sorted(list(d.values()),key = lambda x: x[1])
t2 = list(filter(lambda x: x[1] == t1[-1][1],t1))
t2 = sorted(t2,key = lambda x: x[0])
print(t2[0][-1]) | Title: Voting for Photos
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After celebrating the midcourse the students of one of the faculties of the Berland State University decided to conduct a vote for the best photo. They published the photos in the social network and agreed on the rules to choose a winner: the photo which gets most likes wins. If multiple photoes get most likes, the winner is the photo that gets this number first.
Help guys determine the winner photo by the records of likes.
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the total likes to the published photoes.
The second line contains *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1<=000<=000), where *a**i* is the identifier of the photo which got the *i*-th like.
Output Specification:
Print the identifier of the photo which won the elections.
Demo Input:
['5\n1 3 2 2 1\n', '9\n100 200 300 200 100 300 300 100 200\n']
Demo Output:
['2\n', '300\n']
Note:
In the first test sample the photo with id 1 got two likes (first and fifth), photo with id 2 got two likes (third and fourth), and photo with id 3 got one like (second).
Thus, the winner is the photo with identifier 2, as it got:
- more likes than the photo with id 3; - as many likes as the photo with id 1, but the photo with the identifier 2 got its second like earlier. | ```python
# -*- coding: utf-8 -*-
"""
Created on Sun Mar 13 19:40:03 2016
@author: Kostya S.
"""
from functools import cmp_to_key
n = int(input())
d = {}
a = [int(i) for i in input().split()]
for i,e in enumerate(a):
d[e] = (i+1,1,e) if d.get(e) == None else (i+1,d[e][1] + 1,e)
t1 = sorted(list(d.values()),key = lambda x: x[1])
t2 = list(filter(lambda x: x[1] == t1[-1][1],t1))
t2 = sorted(t2,key = lambda x: x[0])
print(t2[0][-1])
``` | 3 |
|
371 | C | Hamburgers | PROGRAMMING | 1,600 | [
"binary search",
"brute force"
] | null | null | Polycarpus loves hamburgers very much. He especially adores the hamburgers he makes with his own hands. Polycarpus thinks that there are only three decent ingredients to make hamburgers from: a bread, sausage and cheese. He writes down the recipe of his favorite "Le Hamburger de Polycarpus" as a string of letters 'B' (bread), 'S' (sausage) и 'C' (cheese). The ingredients in the recipe go from bottom to top, for example, recipe "ВSCBS" represents the hamburger where the ingredients go from bottom to top as bread, sausage, cheese, bread and sausage again.
Polycarpus has *n**b* pieces of bread, *n**s* pieces of sausage and *n**c* pieces of cheese in the kitchen. Besides, the shop nearby has all three ingredients, the prices are *p**b* rubles for a piece of bread, *p**s* for a piece of sausage and *p**c* for a piece of cheese.
Polycarpus has *r* rubles and he is ready to shop on them. What maximum number of hamburgers can he cook? You can assume that Polycarpus cannot break or slice any of the pieces of bread, sausage or cheese. Besides, the shop has an unlimited number of pieces of each ingredient. | The first line of the input contains a non-empty string that describes the recipe of "Le Hamburger de Polycarpus". The length of the string doesn't exceed 100, the string contains only letters 'B' (uppercase English B), 'S' (uppercase English S) and 'C' (uppercase English C).
The second line contains three integers *n**b*, *n**s*, *n**c* (1<=≤<=*n**b*,<=*n**s*,<=*n**c*<=≤<=100) — the number of the pieces of bread, sausage and cheese on Polycarpus' kitchen. The third line contains three integers *p**b*, *p**s*, *p**c* (1<=≤<=*p**b*,<=*p**s*,<=*p**c*<=≤<=100) — the price of one piece of bread, sausage and cheese in the shop. Finally, the fourth line contains integer *r* (1<=≤<=*r*<=≤<=1012) — the number of rubles Polycarpus has.
Please, do not write the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier. | Print the maximum number of hamburgers Polycarpus can make. If he can't make any hamburger, print 0. | [
"BBBSSC\n6 4 1\n1 2 3\n4\n",
"BBC\n1 10 1\n1 10 1\n21\n",
"BSC\n1 1 1\n1 1 3\n1000000000000\n"
] | [
"2\n",
"7\n",
"200000000001\n"
] | none | 1,500 | [
{
"input": "BBBSSC\n6 4 1\n1 2 3\n4",
"output": "2"
},
{
"input": "BBC\n1 10 1\n1 10 1\n21",
"output": "7"
},
{
"input": "BSC\n1 1 1\n1 1 3\n1000000000000",
"output": "200000000001"
},
{
"input": "B\n1 1 1\n1 1 1\n381",
"output": "382"
},
{
"input": "BSC\n3 5 6\n7 3 9\n100",
"output": "10"
},
{
"input": "BSC\n100 1 1\n100 1 1\n100",
"output": "51"
},
{
"input": "SBBCCSBB\n1 50 100\n31 59 21\n100000",
"output": "370"
},
{
"input": "BBBBCCCCCCCCCCCCCCCCCCCCSSSSBBBBBBBBSS\n100 100 100\n1 1 1\n3628800",
"output": "95502"
},
{
"input": "BBBBBBBBBBCCCCCCCCCCCCCCCCCCCCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\n10 20 40\n100 100 100\n200",
"output": "0"
},
{
"input": "BBBBBBBBBBCCCCCCCCCCCCCCCCCCCCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\n10 20 40\n100 100 100\n2000",
"output": "1"
},
{
"input": "BBBBBBBBBBCCCCCCCCCCCCCCCCCCCCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\n10 20 40\n100 100 100\n300",
"output": "0"
},
{
"input": "BBBBBBBBBBCCCCCCCCCCCCCCCCCCCCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\n10 20 40\n100 100 100\n300000000",
"output": "42858"
},
{
"input": "BBBBBBBBBBCCCCCCCCCCCCCCCCCCCCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\n10 20 40\n100 100 100\n914159265358",
"output": "130594181"
},
{
"input": "SSSSSSSSSSBBBBBBBBBCCCCCCCCCCCCCCCCCCCSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSBB\n31 53 97\n13 17 31\n914159265358",
"output": "647421579"
},
{
"input": "BBBCSBSBBSSSSCCCCBBCSBBBBSSBBBCBSCCSSCSSCSBSSSCCCCBSCSSBSSSCCCBBCCCSCBCBBCCSCCCCSBBCCBBBBCCCCCCBSSCB\n91 87 17\n64 44 43\n958532915587",
"output": "191668251"
},
{
"input": "CSSCBBCCCSBSCBBBCSBBBCBSBCSCBCSCBCBSBCBCSSBBSBBCBBBBSCSBBCCBCCBCBBSBSBCSCSBBSSBBCSSBCSCSCCSSBCBBCBSB\n56 34 48\n78 6 96\n904174875419",
"output": "140968956"
},
{
"input": "CCSCCCSBBBSCBSCSCCSSBBBSSBBBSBBBCBCSSBCSCBBCCCBCBCBCCCSSBSBBCCCCCBBSCBSCBCBBCBBCSSBCSBSSCCSCCSCCBBBS\n33 73 67\n4 56 42\n886653164314",
"output": "277425898"
},
{
"input": "SBCSSCBBSSBCSSBBBSSBSCBSSSCBBSBBBBCSBCSBSCBSCBSCBSBSSCCCCBSBCCBCBSCCCBSCCBSBBCBSSCCCCSBSBBBSSSBCSCBC\n94 16 85\n14 18 91\n836590091442",
"output": "217522127"
},
{
"input": "BSCSBSCCSCSSCCCSBCSSBCBBSCCBSCCSSSSSSSSSCCSBSCCBBCBBSBSCCCCBCSBSBSSBBBBBSSBSSCBCCSSBSSSCBBCSBBSBCCCB\n67 54 8\n36 73 37\n782232051273",
"output": "154164772"
},
{
"input": "CBBCBSBCCSCBSSCCBCSBCSBBSCBBCSCCBSCCSCSBBSSBSBSCBBSBBCSSSSBBBBSBBCBCSBBCBCSSBBCSBSCCSCSBCSCBSCCBBCSC\n71 71 52\n52 88 3\n654400055575",
"output": "137826467"
},
{
"input": "CBBCBSBCCSCBSSCCBCSBCSBBSCBBCSCCBSCCSCSBBSBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBCBBCSC\n100 1 1\n1 17 23\n954400055575",
"output": "1355681897"
},
{
"input": "C\n100 100 100\n1 1 1\n1000000000000",
"output": "1000000000100"
},
{
"input": "SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\n100 100 100\n100 100 100\n1000000000000",
"output": "100000001"
},
{
"input": "B\n100 100 100\n1 1 1\n1",
"output": "101"
},
{
"input": "SC\n2 1 1\n1 1 1\n100000000000",
"output": "50000000001"
},
{
"input": "B\n100 1 1\n1 1 1\n1000000000000",
"output": "1000000000100"
},
{
"input": "BBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB\n1 1 1\n100 100 100\n1000000000000",
"output": "100000000"
},
{
"input": "CC\n1 1 1\n100 100 100\n1",
"output": "0"
},
{
"input": "B\n100 100 100\n1 1 1\n1000000000000",
"output": "1000000000100"
},
{
"input": "BSC\n100 100 100\n1 1 1\n1000000000000",
"output": "333333333433"
},
{
"input": "BSC\n100 100 100\n1 1 1\n1",
"output": "100"
}
] | 1,657,973,911 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 15 | 0 | import time
t=int(input())
while t:
rec=input()
s=input().split()
nb,ns,nc=map(int,s)
s=input().split()
pb,ps,pc=map(int,s)
r=int(input())
c={'B':0,'S':0,'C':0}
for i in rec:
c[i]+=1
ans=0
low,high=0,r+100
while low<=high:
mid = (low+high)//2
cost=max(0,c['B']*mid-nb)*pb + max(0,c['S']*mid-ns)*ps + max(0,c['C']*mid-nc)*pc
if cost<r:
low=mid+1
ans=mid
elif cost>r:
high=mid-1
else:
ans=mid
break
# while r>0:
# # print(nb,ns,nc,r)
# # time.sleep(1)
# if c['B']==0:
# a=float("inf")
# else:
# a=nb//c['B']
# if c['S']==0:
# b=float("inf")
# else:
# b=ns//c['S']
# if c['C']==0:
# d=float("inf")
# else:
# d=nc//c['C']
# minnum=min(a,b,d)
# # print("minimum ",minnum,a,b,d)
# nb-=minnum*c['B']
# ns-=minnum*c['S']
# nc-=minnum*c['C']
# ans+=minnum
# if nb<c['B']:
# if pb*(c['B']-nb)<=r:
# r-=pb*(c['B']-nb)
# nb+=(c['B']-nb)
# else:
# break
# elif ns<c['S']:
# if ps*(c['S']-ns)<=r:
# r-=ps*(c['S']-ns)
# ns+=(c['S']-ns)
# else:
# break
# elif nc<c['C']:
# if pc*(c['C']-nc)<=r:
# r-=pc*(c['C']-nc)
# nc+=(c['C']-nc)
# else:
# break
# else:
# break
print(ans)
t-=1
| Title: Hamburgers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarpus loves hamburgers very much. He especially adores the hamburgers he makes with his own hands. Polycarpus thinks that there are only three decent ingredients to make hamburgers from: a bread, sausage and cheese. He writes down the recipe of his favorite "Le Hamburger de Polycarpus" as a string of letters 'B' (bread), 'S' (sausage) и 'C' (cheese). The ingredients in the recipe go from bottom to top, for example, recipe "ВSCBS" represents the hamburger where the ingredients go from bottom to top as bread, sausage, cheese, bread and sausage again.
Polycarpus has *n**b* pieces of bread, *n**s* pieces of sausage and *n**c* pieces of cheese in the kitchen. Besides, the shop nearby has all three ingredients, the prices are *p**b* rubles for a piece of bread, *p**s* for a piece of sausage and *p**c* for a piece of cheese.
Polycarpus has *r* rubles and he is ready to shop on them. What maximum number of hamburgers can he cook? You can assume that Polycarpus cannot break or slice any of the pieces of bread, sausage or cheese. Besides, the shop has an unlimited number of pieces of each ingredient.
Input Specification:
The first line of the input contains a non-empty string that describes the recipe of "Le Hamburger de Polycarpus". The length of the string doesn't exceed 100, the string contains only letters 'B' (uppercase English B), 'S' (uppercase English S) and 'C' (uppercase English C).
The second line contains three integers *n**b*, *n**s*, *n**c* (1<=≤<=*n**b*,<=*n**s*,<=*n**c*<=≤<=100) — the number of the pieces of bread, sausage and cheese on Polycarpus' kitchen. The third line contains three integers *p**b*, *p**s*, *p**c* (1<=≤<=*p**b*,<=*p**s*,<=*p**c*<=≤<=100) — the price of one piece of bread, sausage and cheese in the shop. Finally, the fourth line contains integer *r* (1<=≤<=*r*<=≤<=1012) — the number of rubles Polycarpus has.
Please, do not write the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
Output Specification:
Print the maximum number of hamburgers Polycarpus can make. If he can't make any hamburger, print 0.
Demo Input:
['BBBSSC\n6 4 1\n1 2 3\n4\n', 'BBC\n1 10 1\n1 10 1\n21\n', 'BSC\n1 1 1\n1 1 3\n1000000000000\n']
Demo Output:
['2\n', '7\n', '200000000001\n']
Note:
none | ```python
import time
t=int(input())
while t:
rec=input()
s=input().split()
nb,ns,nc=map(int,s)
s=input().split()
pb,ps,pc=map(int,s)
r=int(input())
c={'B':0,'S':0,'C':0}
for i in rec:
c[i]+=1
ans=0
low,high=0,r+100
while low<=high:
mid = (low+high)//2
cost=max(0,c['B']*mid-nb)*pb + max(0,c['S']*mid-ns)*ps + max(0,c['C']*mid-nc)*pc
if cost<r:
low=mid+1
ans=mid
elif cost>r:
high=mid-1
else:
ans=mid
break
# while r>0:
# # print(nb,ns,nc,r)
# # time.sleep(1)
# if c['B']==0:
# a=float("inf")
# else:
# a=nb//c['B']
# if c['S']==0:
# b=float("inf")
# else:
# b=ns//c['S']
# if c['C']==0:
# d=float("inf")
# else:
# d=nc//c['C']
# minnum=min(a,b,d)
# # print("minimum ",minnum,a,b,d)
# nb-=minnum*c['B']
# ns-=minnum*c['S']
# nc-=minnum*c['C']
# ans+=minnum
# if nb<c['B']:
# if pb*(c['B']-nb)<=r:
# r-=pb*(c['B']-nb)
# nb+=(c['B']-nb)
# else:
# break
# elif ns<c['S']:
# if ps*(c['S']-ns)<=r:
# r-=ps*(c['S']-ns)
# ns+=(c['S']-ns)
# else:
# break
# elif nc<c['C']:
# if pc*(c['C']-nc)<=r:
# r-=pc*(c['C']-nc)
# nc+=(c['C']-nc)
# else:
# break
# else:
# break
print(ans)
t-=1
``` | -1 |
|
437 | C | The Child and Toy | PROGRAMMING | 1,400 | [
"graphs",
"greedy",
"sortings"
] | null | null | On Children's Day, the child got a toy from Delayyy as a present. However, the child is so naughty that he can't wait to destroy the toy.
The toy consists of *n* parts and *m* ropes. Each rope links two parts, but every pair of parts is linked by at most one rope. To split the toy, the child must remove all its parts. The child can remove a single part at a time, and each remove consume an energy. Let's define an energy value of part *i* as *v**i*. The child spend *v**f*1<=+<=*v**f*2<=+<=...<=+<=*v**f**k* energy for removing part *i* where *f*1,<=*f*2,<=...,<=*f**k* are the parts that are directly connected to the *i*-th and haven't been removed.
Help the child to find out, what is the minimum total energy he should spend to remove all *n* parts. | The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=1000; 0<=≤<=*m*<=≤<=2000). The second line contains *n* integers: *v*1,<=*v*2,<=...,<=*v**n* (0<=≤<=*v**i*<=≤<=105). Then followed *m* lines, each line contains two integers *x**i* and *y**i*, representing a rope from part *x**i* to part *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=*n*; *x**i*<=≠<=*y**i*).
Consider all the parts are numbered from 1 to *n*. | Output the minimum total energy the child should spend to remove all *n* parts of the toy. | [
"4 3\n10 20 30 40\n1 4\n1 2\n2 3\n",
"4 4\n100 100 100 100\n1 2\n2 3\n2 4\n3 4\n",
"7 10\n40 10 20 10 20 80 40\n1 5\n4 7\n4 5\n5 2\n5 7\n6 4\n1 6\n1 3\n4 3\n1 4\n"
] | [
"40\n",
"400\n",
"160\n"
] | One of the optimal sequence of actions in the first sample is:
- First, remove part 3, cost of the action is 20. - Then, remove part 2, cost of the action is 10. - Next, remove part 4, cost of the action is 10. - At last, remove part 1, cost of the action is 0.
So the total energy the child paid is 20 + 10 + 10 + 0 = 40, which is the minimum.
In the second sample, the child will spend 400 no matter in what order he will remove the parts. | 1,500 | [
{
"input": "4 3\n10 20 30 40\n1 4\n1 2\n2 3",
"output": "40"
},
{
"input": "4 4\n100 100 100 100\n1 2\n2 3\n2 4\n3 4",
"output": "400"
},
{
"input": "7 10\n40 10 20 10 20 80 40\n1 5\n4 7\n4 5\n5 2\n5 7\n6 4\n1 6\n1 3\n4 3\n1 4",
"output": "160"
},
{
"input": "1 0\n23333",
"output": "0"
},
{
"input": "5 4\n1 2 2 2 2\n1 2\n1 3\n1 4\n1 5",
"output": "4"
},
{
"input": "10 30\n3 6 17 15 13 15 6 12 9 1\n3 8\n1 10\n4 7\n1 7\n3 7\n2 9\n8 10\n3 1\n3 4\n8 6\n10 3\n3 9\n2 3\n10 4\n2 10\n5 8\n9 5\n6 1\n2 1\n7 2\n7 6\n7 10\n4 8\n5 6\n3 6\n4 1\n8 9\n7 9\n4 2\n5 10",
"output": "188"
},
{
"input": "3 3\n1 1 1\n1 2\n2 3\n3 1",
"output": "3"
}
] | 1,406,647,274 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 3 | 62 | 0 | import sys
lines = sys.stdin.readlines()
nm = lines[0].strip().split(" ")
n = int(nm[0])
m = int(nm[1])
energies = lines[1].strip().split(" ")
energydict = {}
neighbours = {}
for i in range(1, len(energies)+1):
energydict[i] = int(energies[i-1])
for line in lines[2:]:
parts = line.strip().split(" ")
if int(parts[0]) not in neighbours:
neighbours[int(parts[0])] = set()
if int(parts[1]) not in neighbours:
neighbours[int(parts[1])] = set()
neighbours[int(parts[0])].add(int(parts[1]))
neighbours[int(parts[1])].add(int(parts[0]))
removecosts = []
for i in range(1, n+1):
removecosts.append((i, neighbours[i]))
def energy(node):
return energydict[node[0]]
def update_neighbours_and_del(node):
for neighbour in node[1]:
if node[0] in neighbours[neighbour]:
neighbours[neighbour].remove(node[0])
del neighbours[node[0]]
removecosts.sort(key=energy)
summa = 0
for i in range(len(removecosts)):
popped = removecosts.pop()
for neighbour in popped[1]:
summa = summa + energydict[neighbour]
update_neighbours_and_del(popped)
print(summa) | Title: The Child and Toy
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
On Children's Day, the child got a toy from Delayyy as a present. However, the child is so naughty that he can't wait to destroy the toy.
The toy consists of *n* parts and *m* ropes. Each rope links two parts, but every pair of parts is linked by at most one rope. To split the toy, the child must remove all its parts. The child can remove a single part at a time, and each remove consume an energy. Let's define an energy value of part *i* as *v**i*. The child spend *v**f*1<=+<=*v**f*2<=+<=...<=+<=*v**f**k* energy for removing part *i* where *f*1,<=*f*2,<=...,<=*f**k* are the parts that are directly connected to the *i*-th and haven't been removed.
Help the child to find out, what is the minimum total energy he should spend to remove all *n* parts.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=1000; 0<=≤<=*m*<=≤<=2000). The second line contains *n* integers: *v*1,<=*v*2,<=...,<=*v**n* (0<=≤<=*v**i*<=≤<=105). Then followed *m* lines, each line contains two integers *x**i* and *y**i*, representing a rope from part *x**i* to part *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=*n*; *x**i*<=≠<=*y**i*).
Consider all the parts are numbered from 1 to *n*.
Output Specification:
Output the minimum total energy the child should spend to remove all *n* parts of the toy.
Demo Input:
['4 3\n10 20 30 40\n1 4\n1 2\n2 3\n', '4 4\n100 100 100 100\n1 2\n2 3\n2 4\n3 4\n', '7 10\n40 10 20 10 20 80 40\n1 5\n4 7\n4 5\n5 2\n5 7\n6 4\n1 6\n1 3\n4 3\n1 4\n']
Demo Output:
['40\n', '400\n', '160\n']
Note:
One of the optimal sequence of actions in the first sample is:
- First, remove part 3, cost of the action is 20. - Then, remove part 2, cost of the action is 10. - Next, remove part 4, cost of the action is 10. - At last, remove part 1, cost of the action is 0.
So the total energy the child paid is 20 + 10 + 10 + 0 = 40, which is the minimum.
In the second sample, the child will spend 400 no matter in what order he will remove the parts. | ```python
import sys
lines = sys.stdin.readlines()
nm = lines[0].strip().split(" ")
n = int(nm[0])
m = int(nm[1])
energies = lines[1].strip().split(" ")
energydict = {}
neighbours = {}
for i in range(1, len(energies)+1):
energydict[i] = int(energies[i-1])
for line in lines[2:]:
parts = line.strip().split(" ")
if int(parts[0]) not in neighbours:
neighbours[int(parts[0])] = set()
if int(parts[1]) not in neighbours:
neighbours[int(parts[1])] = set()
neighbours[int(parts[0])].add(int(parts[1]))
neighbours[int(parts[1])].add(int(parts[0]))
removecosts = []
for i in range(1, n+1):
removecosts.append((i, neighbours[i]))
def energy(node):
return energydict[node[0]]
def update_neighbours_and_del(node):
for neighbour in node[1]:
if node[0] in neighbours[neighbour]:
neighbours[neighbour].remove(node[0])
del neighbours[node[0]]
removecosts.sort(key=energy)
summa = 0
for i in range(len(removecosts)):
popped = removecosts.pop()
for neighbour in popped[1]:
summa = summa + energydict[neighbour]
update_neighbours_and_del(popped)
print(summa)
``` | -1 |
|
401 | A | Vanya and Cards | PROGRAMMING | 800 | [
"implementation",
"math"
] | null | null | Vanya loves playing. He even has a special set of cards to play with. Each card has a single integer. The number on the card can be positive, negative and can even be equal to zero. The only limit is, the number on each card doesn't exceed *x* in the absolute value.
Natasha doesn't like when Vanya spends a long time playing, so she hid all of his cards. Vanya became sad and started looking for the cards but he only found *n* of them. Vanya loves the balance, so he wants the sum of all numbers on found cards equal to zero. On the other hand, he got very tired of looking for cards. Help the boy and say what is the minimum number of cards does he need to find to make the sum equal to zero?
You can assume that initially Vanya had infinitely many cards with each integer number from <=-<=*x* to *x*. | The first line contains two integers: *n* (1<=≤<=*n*<=≤<=1000) — the number of found cards and *x* (1<=≤<=*x*<=≤<=1000) — the maximum absolute value of the number on a card. The second line contains *n* space-separated integers — the numbers on found cards. It is guaranteed that the numbers do not exceed *x* in their absolute value. | Print a single number — the answer to the problem. | [
"3 2\n-1 1 2\n",
"2 3\n-2 -2\n"
] | [
"1\n",
"2\n"
] | In the first sample, Vanya needs to find a single card with number -2.
In the second sample, Vanya needs to find two cards with number 2. He can't find a single card with the required number as the numbers on the lost cards do not exceed 3 in their absolute value. | 500 | [
{
"input": "3 2\n-1 1 2",
"output": "1"
},
{
"input": "2 3\n-2 -2",
"output": "2"
},
{
"input": "4 4\n1 2 3 4",
"output": "3"
},
{
"input": "2 2\n-1 -1",
"output": "1"
},
{
"input": "15 5\n-2 -1 2 -4 -3 4 -4 -2 -2 2 -2 -1 1 -4 -2",
"output": "4"
},
{
"input": "15 16\n-15 -5 -15 -14 -8 15 -15 -12 -5 -3 5 -7 3 8 -15",
"output": "6"
},
{
"input": "1 4\n-3",
"output": "1"
},
{
"input": "10 7\n6 4 6 6 -3 4 -1 2 3 3",
"output": "5"
},
{
"input": "2 1\n1 -1",
"output": "0"
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "8 13\n-11 -1 -11 12 -2 -2 -10 -11",
"output": "3"
},
{
"input": "16 11\n3 -7 7 -9 -2 -3 -4 -2 -6 8 10 7 1 4 6 7",
"output": "2"
},
{
"input": "67 15\n-2 -2 6 -4 -7 4 3 13 -9 -4 11 -7 -6 -11 1 11 -1 11 14 10 -8 7 5 11 -13 1 -1 7 -14 9 -11 -11 13 -4 12 -11 -8 -5 -11 6 10 -2 6 9 9 6 -11 -2 7 -10 -1 9 -8 -5 1 -7 -2 3 -1 -13 -6 -9 -8 10 13 -3 9",
"output": "1"
},
{
"input": "123 222\n44 -190 -188 -185 -55 17 190 176 157 176 -24 -113 -54 -61 -53 53 -77 68 -12 -114 -217 163 -122 37 -37 20 -108 17 -140 -210 218 19 -89 54 18 197 111 -150 -36 -131 -172 36 67 16 -202 72 169 -137 -34 -122 137 -72 196 -17 -104 180 -102 96 -69 -184 21 -15 217 -61 175 -221 62 173 -93 -106 122 -135 58 7 -110 -108 156 -141 -102 -50 29 -204 -46 -76 101 -33 -190 99 52 -197 175 -71 161 -140 155 10 189 -217 -97 -170 183 -88 83 -149 157 -208 154 -3 77 90 74 165 198 -181 -166 -4 -200 -89 -200 131 100 -61 -149",
"output": "8"
},
{
"input": "130 142\n58 -50 43 -126 84 -92 -108 -92 57 127 12 -135 -49 89 141 -112 -31 47 75 -19 80 81 -5 17 10 4 -26 68 -102 -10 7 -62 -135 -123 -16 55 -72 -97 -34 21 21 137 130 97 40 -18 110 -52 73 52 85 103 -134 -107 88 30 66 97 126 82 13 125 127 -87 81 22 45 102 13 95 4 10 -35 39 -43 -112 -5 14 -46 19 61 -44 -116 137 -116 -80 -39 92 -75 29 -65 -15 5 -108 -114 -129 -5 52 -21 118 -41 35 -62 -125 130 -95 -11 -75 19 108 108 127 141 2 -130 54 96 -81 -102 140 -58 -102 132 50 -126 82 6 45 -114 -42",
"output": "5"
},
{
"input": "7 12\n2 5 -1 -4 -7 4 3",
"output": "1"
},
{
"input": "57 53\n-49 7 -41 7 38 -51 -23 8 45 1 -24 26 37 28 -31 -40 38 25 -32 -47 -3 20 -40 -32 -44 -36 5 33 -16 -5 28 10 -22 3 -10 -51 -32 -51 27 -50 -22 -12 41 3 15 24 30 -12 -34 -15 -29 38 -10 -35 -9 6 -51",
"output": "8"
},
{
"input": "93 273\n-268 -170 -163 19 -69 18 -244 35 -34 125 -224 -48 179 -247 127 -150 271 -49 -102 201 84 -151 -70 -46 -16 216 240 127 3 218 -209 223 -227 -201 228 -8 203 46 -100 -207 126 255 40 -58 -217 93 172 -97 23 183 102 -92 -157 -117 173 47 144 -235 -227 -62 -128 13 -151 158 110 -116 68 -2 -148 -206 -52 79 -152 -223 74 -149 -69 232 38 -70 -256 -213 -236 132 -189 -200 199 -57 -108 -53 269 -101 -134",
"output": "8"
},
{
"input": "1 1000\n997",
"output": "1"
},
{
"input": "4 3\n2 -1 -2 -1",
"output": "1"
},
{
"input": "1 1\n-1",
"output": "1"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "2 2\n1 -1",
"output": "0"
},
{
"input": "2 2\n-1 1",
"output": "0"
},
{
"input": "2 3\n-1 1",
"output": "0"
},
{
"input": "2 2\n-2 2",
"output": "0"
},
{
"input": "2 2\n2 2",
"output": "2"
},
{
"input": "4 2\n-1 -1 -1 -1",
"output": "2"
},
{
"input": "4 1\n-1 -1 -1 1",
"output": "2"
},
{
"input": "3 2\n2 2 2",
"output": "3"
},
{
"input": "10 300\n300 300 300 300 300 300 300 300 300 300",
"output": "10"
}
] | 1,652,528,551 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 31 | 0 | word1 = input().split()
maxnum = int(word1[1])
word2 = input().split()
word2 = [ int(x) for x in word2 ]
sum1 = sum(word2)
#sum1 = abs(sum1)
final = 0
flst = []
for elm in range(min(word2),maxnum+1):
if sum1 != 0 and elm !=0:
count = 0
while sum1 !=0:
if sum1 %elm == 0:
sum1 ==0
final = sum1 // elm
break
else:
#print(sum1)
sum1-=1
count = 1
#print(count)
#print("hehe",abs(final))
if count == 1:
final = abs(final) + 1
flst.append(abs(final))
print(flst)
print(min(flst))
| Title: Vanya and Cards
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vanya loves playing. He even has a special set of cards to play with. Each card has a single integer. The number on the card can be positive, negative and can even be equal to zero. The only limit is, the number on each card doesn't exceed *x* in the absolute value.
Natasha doesn't like when Vanya spends a long time playing, so she hid all of his cards. Vanya became sad and started looking for the cards but he only found *n* of them. Vanya loves the balance, so he wants the sum of all numbers on found cards equal to zero. On the other hand, he got very tired of looking for cards. Help the boy and say what is the minimum number of cards does he need to find to make the sum equal to zero?
You can assume that initially Vanya had infinitely many cards with each integer number from <=-<=*x* to *x*.
Input Specification:
The first line contains two integers: *n* (1<=≤<=*n*<=≤<=1000) — the number of found cards and *x* (1<=≤<=*x*<=≤<=1000) — the maximum absolute value of the number on a card. The second line contains *n* space-separated integers — the numbers on found cards. It is guaranteed that the numbers do not exceed *x* in their absolute value.
Output Specification:
Print a single number — the answer to the problem.
Demo Input:
['3 2\n-1 1 2\n', '2 3\n-2 -2\n']
Demo Output:
['1\n', '2\n']
Note:
In the first sample, Vanya needs to find a single card with number -2.
In the second sample, Vanya needs to find two cards with number 2. He can't find a single card with the required number as the numbers on the lost cards do not exceed 3 in their absolute value. | ```python
word1 = input().split()
maxnum = int(word1[1])
word2 = input().split()
word2 = [ int(x) for x in word2 ]
sum1 = sum(word2)
#sum1 = abs(sum1)
final = 0
flst = []
for elm in range(min(word2),maxnum+1):
if sum1 != 0 and elm !=0:
count = 0
while sum1 !=0:
if sum1 %elm == 0:
sum1 ==0
final = sum1 // elm
break
else:
#print(sum1)
sum1-=1
count = 1
#print(count)
#print("hehe",abs(final))
if count == 1:
final = abs(final) + 1
flst.append(abs(final))
print(flst)
print(min(flst))
``` | 0 |
|
908 | A | New Year and Counting Cards | PROGRAMMING | 800 | [
"brute force",
"implementation"
] | null | null | Your friend has *n* cards.
You know that each card has a lowercase English letter on one side and a digit on the other.
Currently, your friend has laid out the cards on a table so only one side of each card is visible.
You would like to know if the following statement is true for cards that your friend owns: "If a card has a vowel on one side, then it has an even digit on the other side." More specifically, a vowel is one of 'a', 'e', 'i', 'o' or 'u', and even digit is one of '0', '2', '4', '6' or '8'.
For example, if a card has 'a' on one side, and '6' on the other side, then this statement is true for it. Also, the statement is true, for example, for a card with 'b' and '4', and for a card with 'b' and '3' (since the letter is not a vowel). The statement is false, for example, for card with 'e' and '5'. You are interested if the statement is true for all cards. In particular, if no card has a vowel, the statement is true.
To determine this, you can flip over some cards to reveal the other side. You would like to know what is the minimum number of cards you need to flip in the worst case in order to verify that the statement is true. | The first and only line of input will contain a string *s* (1<=≤<=|*s*|<=≤<=50), denoting the sides of the cards that you can see on the table currently. Each character of *s* is either a lowercase English letter or a digit. | Print a single integer, the minimum number of cards you must turn over to verify your claim. | [
"ee\n",
"z\n",
"0ay1\n"
] | [
"2\n",
"0\n",
"2\n"
] | In the first sample, we must turn over both cards. Note that even though both cards have the same letter, they could possibly have different numbers on the other side.
In the second sample, we don't need to turn over any cards. The statement is vacuously true, since you know your friend has no cards with a vowel on them.
In the third sample, we need to flip the second and fourth cards. | 500 | [
{
"input": "ee",
"output": "2"
},
{
"input": "z",
"output": "0"
},
{
"input": "0ay1",
"output": "2"
},
{
"input": "0abcdefghijklmnopqrstuvwxyz1234567896",
"output": "10"
},
{
"input": "0a0a9e9e2i2i9o9o6u6u9z9z4x4x9b9b",
"output": "18"
},
{
"input": "01234567890123456789012345678901234567890123456789",
"output": "25"
},
{
"input": "qwertyuioplkjhgfdsazxcvbnmqwertyuioplkjhgfdsazxcvb",
"output": "10"
},
{
"input": "cjw2dwmr10pku4yxohe0wglktd",
"output": "4"
},
{
"input": "6z2tx805jie8cfybwtfqvmlveec3iak5z5u3lu62vbxyqht6",
"output": "13"
},
{
"input": "kaq7jyialrfp4ilkni90eq8v3amcbygon7py0hb8z26fbl8ss1",
"output": "13"
},
{
"input": "hpwn50zgbmct80k9rizjqg40nycgs0acwikjqt11nr6m61krfs",
"output": "8"
},
{
"input": "l3rw91a4m25l8iytxyeuixsegzcbm4h41ornf3pixkrmwznrzc",
"output": "14"
},
{
"input": "2222",
"output": "0"
},
{
"input": "13579",
"output": "5"
},
{
"input": "1",
"output": "1"
},
{
"input": "0",
"output": "0"
},
{
"input": "a",
"output": "1"
},
{
"input": "y",
"output": "0"
},
{
"input": "w",
"output": "0"
},
{
"input": "oo",
"output": "2"
},
{
"input": "oy",
"output": "1"
},
{
"input": "yo",
"output": "1"
},
{
"input": "yy",
"output": "0"
},
{
"input": "a0",
"output": "1"
},
{
"input": "a9",
"output": "2"
},
{
"input": "y0",
"output": "0"
},
{
"input": "y7",
"output": "1"
},
{
"input": "0a",
"output": "1"
},
{
"input": "3a",
"output": "2"
},
{
"input": "06",
"output": "0"
},
{
"input": "07",
"output": "1"
},
{
"input": "70",
"output": "1"
},
{
"input": "77",
"output": "2"
},
{
"input": "13570",
"output": "4"
},
{
"input": "0000000000011111",
"output": "5"
},
{
"input": "1357",
"output": "4"
},
{
"input": "uuuuuuuuuuuuuuuuuu",
"output": "18"
},
{
"input": "gabieurat",
"output": "5"
}
] | 1,599,229,810 | 2,147,483,647 | Python 3 | OK | TESTS | 38 | 109 | 0 | from sys import stdin, stdout
def need_to_check(card, vowels=['a','e','i','o','u']):
return (ord(card) >= ord('0') and ord(card) <= ord('9') and int(card) % 2 == 1) or (card in vowels)
def number_of_reveals(cards):
count = 0
for card in cards:
count = count+1 if need_to_check(card) else count
return count
stdout.write( str(number_of_reveals(stdin.readline())) +'\n')
| Title: New Year and Counting Cards
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Your friend has *n* cards.
You know that each card has a lowercase English letter on one side and a digit on the other.
Currently, your friend has laid out the cards on a table so only one side of each card is visible.
You would like to know if the following statement is true for cards that your friend owns: "If a card has a vowel on one side, then it has an even digit on the other side." More specifically, a vowel is one of 'a', 'e', 'i', 'o' or 'u', and even digit is one of '0', '2', '4', '6' or '8'.
For example, if a card has 'a' on one side, and '6' on the other side, then this statement is true for it. Also, the statement is true, for example, for a card with 'b' and '4', and for a card with 'b' and '3' (since the letter is not a vowel). The statement is false, for example, for card with 'e' and '5'. You are interested if the statement is true for all cards. In particular, if no card has a vowel, the statement is true.
To determine this, you can flip over some cards to reveal the other side. You would like to know what is the minimum number of cards you need to flip in the worst case in order to verify that the statement is true.
Input Specification:
The first and only line of input will contain a string *s* (1<=≤<=|*s*|<=≤<=50), denoting the sides of the cards that you can see on the table currently. Each character of *s* is either a lowercase English letter or a digit.
Output Specification:
Print a single integer, the minimum number of cards you must turn over to verify your claim.
Demo Input:
['ee\n', 'z\n', '0ay1\n']
Demo Output:
['2\n', '0\n', '2\n']
Note:
In the first sample, we must turn over both cards. Note that even though both cards have the same letter, they could possibly have different numbers on the other side.
In the second sample, we don't need to turn over any cards. The statement is vacuously true, since you know your friend has no cards with a vowel on them.
In the third sample, we need to flip the second and fourth cards. | ```python
from sys import stdin, stdout
def need_to_check(card, vowels=['a','e','i','o','u']):
return (ord(card) >= ord('0') and ord(card) <= ord('9') and int(card) % 2 == 1) or (card in vowels)
def number_of_reveals(cards):
count = 0
for card in cards:
count = count+1 if need_to_check(card) else count
return count
stdout.write( str(number_of_reveals(stdin.readline())) +'\n')
``` | 3 |
|
109 | A | Lucky Sum of Digits | PROGRAMMING | 1,000 | [
"brute force",
"implementation"
] | A. Lucky Sum of Digits | 2 | 256 | Petya loves lucky numbers. We all know that lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Petya wonders eagerly what minimum lucky number has the sum of digits equal to *n*. Help him cope with the task. | The single line contains an integer *n* (1<=≤<=*n*<=≤<=106) — the sum of digits of the required lucky number. | Print on the single line the result — the minimum lucky number, whose sum of digits equals *n*. If such number does not exist, print -1. | [
"11\n",
"10\n"
] | [
"47\n",
"-1\n"
] | none | 500 | [
{
"input": "11",
"output": "47"
},
{
"input": "10",
"output": "-1"
},
{
"input": "64",
"output": "4477777777"
},
{
"input": "1",
"output": "-1"
},
{
"input": "4",
"output": "4"
},
{
"input": "7",
"output": "7"
},
{
"input": "12",
"output": "444"
},
{
"input": "1000000",
"output": "4477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "47",
"output": "44477777"
},
{
"input": "100",
"output": "4444777777777777"
},
{
"input": "700",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "485",
"output": "44447777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "111",
"output": "444447777777777777"
},
{
"input": "85",
"output": "4477777777777"
},
{
"input": "114",
"output": "444477777777777777"
},
{
"input": "474",
"output": "444777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "74",
"output": "47777777777"
},
{
"input": "1000",
"output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "1024",
"output": "4444777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "4444",
"output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "45784",
"output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "10000",
"output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "9854",
"output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "186",
"output": "477777777777777777777777777"
},
{
"input": "10416",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "10417",
"output": "4477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "3840",
"output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "100000",
"output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "9876",
"output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "99999",
"output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "777777",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "854759",
"output": "4444447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "11000",
"output": "4444447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "18951",
"output": "4444777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "999999",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "888887",
"output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "999998",
"output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "40008",
"output": "4444447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "10691",
"output": "4444777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "5",
"output": "-1"
},
{
"input": "6",
"output": "-1"
},
{
"input": "9",
"output": "-1"
},
{
"input": "8",
"output": "44"
},
{
"input": "2",
"output": "-1"
},
{
"input": "3",
"output": "-1"
},
{
"input": "999997",
"output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "999996",
"output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "999990",
"output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "999980",
"output": "4444777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "800000",
"output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "980000",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
}
] | 1,585,398,173 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 186 | 307,200 | def func(numero, soma, digitos, n, results):
total4 = soma+4
total7 = soma+7
novo = numero+4*pow(10, digitos)
if n > total4:
func(novo, total4, digitos+1, n, results)
elif n < total4:
return
else:
results.append(novo)
novo = numero+7*pow(10, digitos)
if n > total7:
func(novo, total7, digitos+1, n, results)
elif n < total7:
return
else:
results.append(novo)
n = int(input())
if n <= 17:
results = []
func(0, 0, 0, n, results)
if len(results) > 0:
results.sort()
print(results[0])
else:
print("-1")
else:
resultado = 0
if n%7 == 0:
t = int(n/7)
for i in range(t):
resultado += 7*pow(10, i)
elif n%4 == 0:
t = int(n/4)
for i in range(t):
resultado += 4*pow(10, i)
else:
resto = n%7
t = int(n/7)
if resto == 0:
for i in range(t):
resultado += 7*pow(10, i)
print(resultado)
exit()
elif resto == 1:
t -= 1
x = 2
elif resto == 2:
t -= 2
x = 4
elif resto == 3:
t -= 3
x = 6
elif resto == 4:
x = 1
elif resto == 5:
t -= 1
x = 3
elif resto == 6:
t -= 2
x = 5
for i in range(t):
resultado += 7*pow(10, i)
for y in range(x):
i += 1
resultado += 4*pow(10, i)
print(resultado)
| Title: Lucky Sum of Digits
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Petya loves lucky numbers. We all know that lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Petya wonders eagerly what minimum lucky number has the sum of digits equal to *n*. Help him cope with the task.
Input Specification:
The single line contains an integer *n* (1<=≤<=*n*<=≤<=106) — the sum of digits of the required lucky number.
Output Specification:
Print on the single line the result — the minimum lucky number, whose sum of digits equals *n*. If such number does not exist, print -1.
Demo Input:
['11\n', '10\n']
Demo Output:
['47\n', '-1\n']
Note:
none | ```python
def func(numero, soma, digitos, n, results):
total4 = soma+4
total7 = soma+7
novo = numero+4*pow(10, digitos)
if n > total4:
func(novo, total4, digitos+1, n, results)
elif n < total4:
return
else:
results.append(novo)
novo = numero+7*pow(10, digitos)
if n > total7:
func(novo, total7, digitos+1, n, results)
elif n < total7:
return
else:
results.append(novo)
n = int(input())
if n <= 17:
results = []
func(0, 0, 0, n, results)
if len(results) > 0:
results.sort()
print(results[0])
else:
print("-1")
else:
resultado = 0
if n%7 == 0:
t = int(n/7)
for i in range(t):
resultado += 7*pow(10, i)
elif n%4 == 0:
t = int(n/4)
for i in range(t):
resultado += 4*pow(10, i)
else:
resto = n%7
t = int(n/7)
if resto == 0:
for i in range(t):
resultado += 7*pow(10, i)
print(resultado)
exit()
elif resto == 1:
t -= 1
x = 2
elif resto == 2:
t -= 2
x = 4
elif resto == 3:
t -= 3
x = 6
elif resto == 4:
x = 1
elif resto == 5:
t -= 1
x = 3
elif resto == 6:
t -= 2
x = 5
for i in range(t):
resultado += 7*pow(10, i)
for y in range(x):
i += 1
resultado += 4*pow(10, i)
print(resultado)
``` | 0 |
606 | A | Magic Spheres | PROGRAMMING | 1,200 | [
"implementation"
] | null | null | Carl is a beginner magician. He has *a* blue, *b* violet and *c* orange magic spheres. In one move he can transform two spheres of the same color into one sphere of any other color. To make a spell that has never been seen before, he needs at least *x* blue, *y* violet and *z* orange spheres. Can he get them (possible, in multiple actions)? | The first line of the input contains three integers *a*, *b* and *c* (0<=≤<=*a*,<=*b*,<=*c*<=≤<=1<=000<=000) — the number of blue, violet and orange spheres that are in the magician's disposal.
The second line of the input contains three integers, *x*, *y* and *z* (0<=≤<=*x*,<=*y*,<=*z*<=≤<=1<=000<=000) — the number of blue, violet and orange spheres that he needs to get. | If the wizard is able to obtain the required numbers of spheres, print "Yes". Otherwise, print "No". | [
"4 4 0\n2 1 2\n",
"5 6 1\n2 7 2\n",
"3 3 3\n2 2 2\n"
] | [
"Yes\n",
"No\n",
"Yes\n"
] | In the first sample the wizard has 4 blue and 4 violet spheres. In his first action he can turn two blue spheres into one violet one. After that he will have 2 blue and 5 violet spheres. Then he turns 4 violet spheres into 2 orange spheres and he ends up with 2 blue, 1 violet and 2 orange spheres, which is exactly what he needs. | 500 | [
{
"input": "4 4 0\n2 1 2",
"output": "Yes"
},
{
"input": "5 6 1\n2 7 2",
"output": "No"
},
{
"input": "3 3 3\n2 2 2",
"output": "Yes"
},
{
"input": "0 0 0\n0 0 0",
"output": "Yes"
},
{
"input": "0 0 0\n0 0 1",
"output": "No"
},
{
"input": "0 1 0\n0 0 0",
"output": "Yes"
},
{
"input": "1 0 0\n1 0 0",
"output": "Yes"
},
{
"input": "2 2 1\n1 1 2",
"output": "No"
},
{
"input": "1 3 1\n2 1 1",
"output": "Yes"
},
{
"input": "1000000 1000000 1000000\n1000000 1000000 1000000",
"output": "Yes"
},
{
"input": "1000000 500000 500000\n0 750000 750000",
"output": "Yes"
},
{
"input": "500000 1000000 500000\n750001 0 750000",
"output": "No"
},
{
"input": "499999 500000 1000000\n750000 750000 0",
"output": "No"
},
{
"input": "500000 500000 0\n0 0 500000",
"output": "Yes"
},
{
"input": "0 500001 499999\n500000 0 0",
"output": "No"
},
{
"input": "1000000 500000 1000000\n500000 1000000 500000",
"output": "Yes"
},
{
"input": "1000000 1000000 499999\n500000 500000 1000000",
"output": "No"
},
{
"input": "500000 1000000 1000000\n1000000 500001 500000",
"output": "No"
},
{
"input": "1000000 500000 500000\n0 1000000 500000",
"output": "Yes"
},
{
"input": "500000 500000 1000000\n500001 1000000 0",
"output": "No"
},
{
"input": "500000 999999 500000\n1000000 0 500000",
"output": "No"
},
{
"input": "4 0 3\n2 2 1",
"output": "Yes"
},
{
"input": "0 2 4\n2 0 2",
"output": "Yes"
},
{
"input": "3 1 0\n1 1 1",
"output": "Yes"
},
{
"input": "4 4 1\n1 3 2",
"output": "Yes"
},
{
"input": "1 2 4\n2 1 3",
"output": "No"
},
{
"input": "1 1 0\n0 0 1",
"output": "No"
},
{
"input": "4 0 0\n0 1 1",
"output": "Yes"
},
{
"input": "0 3 0\n1 0 1",
"output": "No"
},
{
"input": "0 0 3\n1 0 1",
"output": "Yes"
},
{
"input": "1 12 1\n4 0 4",
"output": "Yes"
},
{
"input": "4 0 4\n1 2 1",
"output": "Yes"
},
{
"input": "4 4 0\n1 1 3",
"output": "No"
},
{
"input": "0 9 0\n2 2 2",
"output": "No"
},
{
"input": "0 10 0\n2 2 2",
"output": "Yes"
},
{
"input": "9 0 9\n0 8 0",
"output": "Yes"
},
{
"input": "0 9 9\n9 0 0",
"output": "No"
},
{
"input": "9 10 0\n0 0 9",
"output": "Yes"
},
{
"input": "10 0 9\n0 10 0",
"output": "No"
},
{
"input": "0 10 10\n10 0 0",
"output": "Yes"
},
{
"input": "10 10 0\n0 0 11",
"output": "No"
},
{
"input": "307075 152060 414033\n381653 222949 123101",
"output": "No"
},
{
"input": "569950 228830 153718\n162186 357079 229352",
"output": "No"
},
{
"input": "149416 303568 749016\n238307 493997 190377",
"output": "No"
},
{
"input": "438332 298094 225324\n194220 400244 245231",
"output": "No"
},
{
"input": "293792 300060 511272\n400687 382150 133304",
"output": "No"
},
{
"input": "295449 518151 368838\n382897 137148 471892",
"output": "No"
},
{
"input": "191789 291147 691092\n324321 416045 176232",
"output": "Yes"
},
{
"input": "286845 704749 266526\n392296 104421 461239",
"output": "Yes"
},
{
"input": "135522 188282 377041\n245719 212473 108265",
"output": "Yes"
},
{
"input": "404239 359124 133292\n180069 184791 332544",
"output": "No"
},
{
"input": "191906 624432 244408\n340002 367217 205432",
"output": "No"
},
{
"input": "275980 429361 101824\n274288 302579 166062",
"output": "No"
},
{
"input": "136092 364927 395302\n149173 343146 390922",
"output": "No"
},
{
"input": "613852 334661 146012\n363786 326286 275233",
"output": "No"
},
{
"input": "348369 104625 525203\n285621 215396 366411",
"output": "No"
},
{
"input": "225307 153572 114545\n154753 153282 149967",
"output": "Yes"
},
{
"input": "438576 124465 629784\n375118 276028 390116",
"output": "Yes"
},
{
"input": "447521 327510 158732\n395759 178458 259139",
"output": "Yes"
},
{
"input": "8 5 5\n5 5 5",
"output": "Yes"
},
{
"input": "100 100 100\n1 1 1",
"output": "Yes"
},
{
"input": "100 100 100\n0 0 0",
"output": "Yes"
},
{
"input": "3 2 3\n2 3 2",
"output": "No"
},
{
"input": "5 4 3\n2 2 2",
"output": "Yes"
},
{
"input": "14 9 8\n12 5 10",
"output": "Yes"
},
{
"input": "10 10 10\n1 1 1",
"output": "Yes"
},
{
"input": "6 3 3\n3 3 3",
"output": "Yes"
},
{
"input": "10 0 4\n2 4 2",
"output": "Yes"
},
{
"input": "100 100 100\n2 2 2",
"output": "Yes"
},
{
"input": "4 6 0\n2 1 2",
"output": "Yes"
},
{
"input": "4 6 3\n4 2 3",
"output": "Yes"
},
{
"input": "5 5 5\n1 1 1",
"output": "Yes"
},
{
"input": "41 17 34\n0 19 24",
"output": "Yes"
},
{
"input": "8 8 8\n3 3 3",
"output": "Yes"
},
{
"input": "7 7 1\n1 1 2",
"output": "Yes"
},
{
"input": "6 6 0\n2 2 2",
"output": "Yes"
},
{
"input": "5 5 5\n2 2 2",
"output": "Yes"
},
{
"input": "400 400 400\n1 1 1",
"output": "Yes"
},
{
"input": "4 4 4\n2 2 2",
"output": "Yes"
}
] | 1,484,674,766 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 7 | 92 | 4,608,000 | a,b,c = map(int, input().split())
x, y, z = map(int, input().split())
if a >= x and b >= y and c >= z:
print("YES")
else:
extra = 0
if a >= x:
extra += (a - x) / 2
if b >= y:
extra += (b - x) / 2
if c >= z:
extra += (c - z) / 2
if a < x and (a + extra) >= x:
extra -= (x - a)
a = x
if b < y and (b + extra) >= y:
extra -= (y - b)
b = y
if c < z and (c + extra) >= z:
extra -= (z - c)
c = z
if a >= x and b >= y and c >= z:
print("YES")
else:
print("NO") | Title: Magic Spheres
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Carl is a beginner magician. He has *a* blue, *b* violet and *c* orange magic spheres. In one move he can transform two spheres of the same color into one sphere of any other color. To make a spell that has never been seen before, he needs at least *x* blue, *y* violet and *z* orange spheres. Can he get them (possible, in multiple actions)?
Input Specification:
The first line of the input contains three integers *a*, *b* and *c* (0<=≤<=*a*,<=*b*,<=*c*<=≤<=1<=000<=000) — the number of blue, violet and orange spheres that are in the magician's disposal.
The second line of the input contains three integers, *x*, *y* and *z* (0<=≤<=*x*,<=*y*,<=*z*<=≤<=1<=000<=000) — the number of blue, violet and orange spheres that he needs to get.
Output Specification:
If the wizard is able to obtain the required numbers of spheres, print "Yes". Otherwise, print "No".
Demo Input:
['4 4 0\n2 1 2\n', '5 6 1\n2 7 2\n', '3 3 3\n2 2 2\n']
Demo Output:
['Yes\n', 'No\n', 'Yes\n']
Note:
In the first sample the wizard has 4 blue and 4 violet spheres. In his first action he can turn two blue spheres into one violet one. After that he will have 2 blue and 5 violet spheres. Then he turns 4 violet spheres into 2 orange spheres and he ends up with 2 blue, 1 violet and 2 orange spheres, which is exactly what he needs. | ```python
a,b,c = map(int, input().split())
x, y, z = map(int, input().split())
if a >= x and b >= y and c >= z:
print("YES")
else:
extra = 0
if a >= x:
extra += (a - x) / 2
if b >= y:
extra += (b - x) / 2
if c >= z:
extra += (c - z) / 2
if a < x and (a + extra) >= x:
extra -= (x - a)
a = x
if b < y and (b + extra) >= y:
extra -= (y - b)
b = y
if c < z and (c + extra) >= z:
extra -= (z - c)
c = z
if a >= x and b >= y and c >= z:
print("YES")
else:
print("NO")
``` | 0 |
|
669 | A | Little Artem and Presents | PROGRAMMING | 800 | [
"math"
] | null | null | Little Artem got *n* stones on his birthday and now wants to give some of them to Masha. He knows that Masha cares more about the fact of receiving the present, rather than the value of that present, so he wants to give her stones as many times as possible. However, Masha remembers the last present she received, so Artem can't give her the same number of stones twice in a row. For example, he can give her 3 stones, then 1 stone, then again 3 stones, but he can't give her 3 stones and then again 3 stones right after that.
How many times can Artem give presents to Masha? | The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=109) — number of stones Artem received on his birthday. | Print the maximum possible number of times Artem can give presents to Masha. | [
"1\n",
"2\n",
"3\n",
"4\n"
] | [
"1\n",
"1\n",
"2\n",
"3\n"
] | In the first sample, Artem can only give 1 stone to Masha.
In the second sample, Atrem can give Masha 1 or 2 stones, though he can't give her 1 stone two times.
In the third sample, Atrem can first give Masha 2 stones, a then 1 more stone.
In the fourth sample, Atrem can first give Masha 1 stone, then 2 stones, and finally 1 stone again. | 500 | [
{
"input": "1",
"output": "1"
},
{
"input": "2",
"output": "1"
},
{
"input": "3",
"output": "2"
},
{
"input": "4",
"output": "3"
},
{
"input": "100",
"output": "67"
},
{
"input": "101",
"output": "67"
},
{
"input": "102",
"output": "68"
},
{
"input": "1000000000",
"output": "666666667"
},
{
"input": "5",
"output": "3"
},
{
"input": "6",
"output": "4"
},
{
"input": "999999999",
"output": "666666666"
},
{
"input": "999999998",
"output": "666666665"
},
{
"input": "999999997",
"output": "666666665"
},
{
"input": "999999996",
"output": "666666664"
},
{
"input": "999999995",
"output": "666666663"
},
{
"input": "999999994",
"output": "666666663"
},
{
"input": "999999993",
"output": "666666662"
},
{
"input": "999999992",
"output": "666666661"
},
{
"input": "999999991",
"output": "666666661"
},
{
"input": "1000",
"output": "667"
},
{
"input": "10000",
"output": "6667"
},
{
"input": "100000",
"output": "66667"
},
{
"input": "1000000",
"output": "666667"
},
{
"input": "10000000",
"output": "6666667"
},
{
"input": "100000000",
"output": "66666667"
},
{
"input": "7",
"output": "5"
}
] | 1,461,667,736 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 3 | 92 | 4,608,000 | n = int(input())
print ((n + 3) // 3) | Title: Little Artem and Presents
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Artem got *n* stones on his birthday and now wants to give some of them to Masha. He knows that Masha cares more about the fact of receiving the present, rather than the value of that present, so he wants to give her stones as many times as possible. However, Masha remembers the last present she received, so Artem can't give her the same number of stones twice in a row. For example, he can give her 3 stones, then 1 stone, then again 3 stones, but he can't give her 3 stones and then again 3 stones right after that.
How many times can Artem give presents to Masha?
Input Specification:
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=109) — number of stones Artem received on his birthday.
Output Specification:
Print the maximum possible number of times Artem can give presents to Masha.
Demo Input:
['1\n', '2\n', '3\n', '4\n']
Demo Output:
['1\n', '1\n', '2\n', '3\n']
Note:
In the first sample, Artem can only give 1 stone to Masha.
In the second sample, Atrem can give Masha 1 or 2 stones, though he can't give her 1 stone two times.
In the third sample, Atrem can first give Masha 2 stones, a then 1 more stone.
In the fourth sample, Atrem can first give Masha 1 stone, then 2 stones, and finally 1 stone again. | ```python
n = int(input())
print ((n + 3) // 3)
``` | 0 |
|
469 | A | I Wanna Be the Guy | PROGRAMMING | 800 | [
"greedy",
"implementation"
] | null | null | There is a game called "I Wanna Be the Guy", consisting of *n* levels. Little X and his friend Little Y are addicted to the game. Each of them wants to pass the whole game.
Little X can pass only *p* levels of the game. And Little Y can pass only *q* levels of the game. You are given the indices of levels Little X can pass and the indices of levels Little Y can pass. Will Little X and Little Y pass the whole game, if they cooperate each other? | The first line contains a single integer *n* (1<=≤<=<=*n*<=≤<=100).
The next line contains an integer *p* (0<=≤<=*p*<=≤<=*n*) at first, then follows *p* distinct integers *a*1,<=*a*2,<=...,<=*a**p* (1<=≤<=*a**i*<=≤<=*n*). These integers denote the indices of levels Little X can pass. The next line contains the levels Little Y can pass in the same format. It's assumed that levels are numbered from 1 to *n*. | If they can pass all the levels, print "I become the guy.". If it's impossible, print "Oh, my keyboard!" (without the quotes). | [
"4\n3 1 2 3\n2 2 4\n",
"4\n3 1 2 3\n2 2 3\n"
] | [
"I become the guy.\n",
"Oh, my keyboard!\n"
] | In the first sample, Little X can pass levels [1 2 3], and Little Y can pass level [2 4], so they can pass all the levels both.
In the second sample, no one can pass level 4. | 500 | [
{
"input": "4\n3 1 2 3\n2 2 4",
"output": "I become the guy."
},
{
"input": "4\n3 1 2 3\n2 2 3",
"output": "Oh, my keyboard!"
},
{
"input": "10\n5 8 6 1 5 4\n6 1 3 2 9 4 6",
"output": "Oh, my keyboard!"
},
{
"input": "10\n8 8 10 7 3 1 4 2 6\n8 9 5 10 3 7 2 4 8",
"output": "I become the guy."
},
{
"input": "10\n9 6 1 8 3 9 7 5 10 4\n7 1 3 2 7 6 9 5",
"output": "I become the guy."
},
{
"input": "100\n75 83 69 73 30 76 37 48 14 41 42 21 35 15 50 61 86 85 46 3 31 13 78 10 2 44 80 95 56 82 38 75 77 4 99 9 84 53 12 11 36 74 39 72 43 89 57 28 54 1 51 66 27 22 93 59 68 88 91 29 7 20 63 8 52 23 64 58 100 79 65 49 96 71 33 45\n83 50 89 73 34 28 99 67 77 44 19 60 68 42 8 27 94 85 14 39 17 78 24 21 29 63 92 32 86 22 71 81 31 82 65 48 80 59 98 3 70 55 37 12 15 72 47 9 11 33 16 7 91 74 13 64 38 84 6 61 93 90 45 69 1 54 52 100 57 10 35 49 53 75 76 43 62 5 4 18 36 96 79 23",
"output": "Oh, my keyboard!"
},
{
"input": "1\n1 1\n1 1",
"output": "I become the guy."
},
{
"input": "1\n0\n1 1",
"output": "I become the guy."
},
{
"input": "1\n1 1\n0",
"output": "I become the guy."
},
{
"input": "1\n0\n0",
"output": "Oh, my keyboard!"
},
{
"input": "100\n0\n0",
"output": "Oh, my keyboard!"
},
{
"input": "100\n44 71 70 55 49 43 16 53 7 95 58 56 38 76 67 94 20 73 29 90 25 30 8 84 5 14 77 52 99 91 66 24 39 37 22 44 78 12 63 59 32 51 15 82 34\n56 17 10 96 80 69 13 81 31 57 4 48 68 89 50 45 3 33 36 2 72 100 64 87 21 75 54 74 92 65 23 40 97 61 18 28 98 93 35 83 9 79 46 27 41 62 88 6 47 60 86 26 42 85 19 1 11",
"output": "I become the guy."
},
{
"input": "100\n78 63 59 39 11 58 4 2 80 69 22 95 90 26 65 16 30 100 66 99 67 79 54 12 23 28 45 56 70 74 60 82 73 91 68 43 92 75 51 21 17 97 86 44 62 47 85 78 72 64 50 81 71 5 57 13 31 76 87 9 49 96 25 42 19 35 88 53 7 83 38 27 29 41 89 93 10 84 18\n78 1 16 53 72 99 9 36 59 49 75 77 94 79 35 4 92 42 82 83 76 97 20 68 55 47 65 50 14 30 13 67 98 8 7 40 64 32 87 10 33 90 93 18 26 71 17 46 24 28 89 58 37 91 39 34 25 48 84 31 96 95 80 88 3 51 62 52 85 61 12 15 27 6 45 38 2 22 60",
"output": "I become the guy."
},
{
"input": "2\n2 2 1\n0",
"output": "I become the guy."
},
{
"input": "2\n1 2\n2 1 2",
"output": "I become the guy."
},
{
"input": "80\n57 40 1 47 36 69 24 76 5 72 26 4 29 62 6 60 3 70 8 64 18 37 16 14 13 21 25 7 66 68 44 74 61 39 38 33 15 63 34 65 10 23 56 51 80 58 49 75 71 12 50 57 2 30 54 27 17 52\n61 22 67 15 28 41 26 1 80 44 3 38 18 37 79 57 11 7 65 34 9 36 40 5 48 29 64 31 51 63 27 4 50 13 24 32 58 23 19 46 8 73 39 2 21 56 77 53 59 78 43 12 55 45 30 74 33 68 42 47 17 54",
"output": "Oh, my keyboard!"
},
{
"input": "100\n78 87 96 18 73 32 38 44 29 64 40 70 47 91 60 69 24 1 5 34 92 94 99 22 83 65 14 68 15 20 74 31 39 100 42 4 97 46 25 6 8 56 79 9 71 35 54 19 59 93 58 62 10 85 57 45 33 7 86 81 30 98 26 61 84 41 23 28 88 36 66 51 80 53 37 63 43 95 75\n76 81 53 15 26 37 31 62 24 87 41 39 75 86 46 76 34 4 51 5 45 65 67 48 68 23 71 27 94 47 16 17 9 96 84 89 88 100 18 52 69 42 6 92 7 64 49 12 98 28 21 99 25 55 44 40 82 19 36 30 77 90 14 43 50 3 13 95 78 35 20 54 58 11 2 1 33",
"output": "Oh, my keyboard!"
},
{
"input": "100\n77 55 26 98 13 91 78 60 23 76 12 11 36 62 84 80 18 1 68 92 81 67 19 4 2 10 17 77 96 63 15 69 46 97 82 42 83 59 50 72 14 40 89 9 52 29 56 31 74 39 45 85 22 99 44 65 95 6 90 38 54 32 49 34 3 70 75 33 94 53 21 71 5 66 73 41 100 24\n69 76 93 5 24 57 59 6 81 4 30 12 44 15 67 45 73 3 16 8 47 95 20 64 68 85 54 17 90 86 66 58 13 37 42 51 35 32 1 28 43 80 7 14 48 19 62 55 2 91 25 49 27 26 38 79 89 99 22 60 75 53 88 82 34 21 87 71 72 61",
"output": "I become the guy."
},
{
"input": "100\n74 96 32 63 12 69 72 99 15 22 1 41 79 77 71 31 20 28 75 73 85 37 38 59 42 100 86 89 55 87 68 4 24 57 52 8 92 27 56 98 95 58 34 9 45 14 11 36 66 76 61 19 25 23 78 49 90 26 80 43 70 13 65 10 5 74 81 21 44 60 97 3 47 93 6\n64 68 21 27 16 91 23 22 33 12 71 88 90 50 62 43 28 29 57 59 5 74 10 95 35 1 67 93 36 32 86 40 6 64 78 46 89 15 84 53 18 30 17 85 2 3 47 92 25 48 76 51 20 82 52 83 99 63 80 11 94 54 39 7 58",
"output": "I become the guy."
},
{
"input": "100\n75 11 98 44 47 88 94 23 78 59 70 2 43 39 34 63 71 19 42 61 30 74 14 77 97 53 92 60 67 36 37 13 6 86 62 46 41 3 25 93 7 12 27 48 55 49 31 35 51 10 57 54 95 82 28 90 73 26 17 50 81 56 20 87 40 85 72 64 99 29 91 5 80 18 24 52\n72 93 59 5 88 47 9 58 48 1 43 50 100 87 61 91 45 98 99 56 25 84 53 73 78 54 63 38 37 2 77 95 89 85 4 90 10 33 12 22 74 32 34 70 71 52 96 57 15 66 31 27 75 8 21 39 62 44 67 94 81 68 14 19 36 28 11 79 16 65 46 83 76",
"output": "Oh, my keyboard!"
},
{
"input": "3\n1 2\n2 2 3",
"output": "Oh, my keyboard!"
},
{
"input": "4\n1 2\n3 1 3 4",
"output": "I become the guy."
},
{
"input": "6\n2 1 2\n3 4 5 6",
"output": "Oh, my keyboard!"
}
] | 1,694,057,583 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 26 | 46 | 0 | n=int(input())
li1=list(map(int,input().split()))
li2=list(map(int,input().split()))
li3=li1+li2
s=set(li3)
sumt=(n*(n+1))/2
li=list(s)
if sum(li)==sumt:
print("I become the guy.")
else:
print("Oh, my keyboard!")
| Title: I Wanna Be the Guy
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There is a game called "I Wanna Be the Guy", consisting of *n* levels. Little X and his friend Little Y are addicted to the game. Each of them wants to pass the whole game.
Little X can pass only *p* levels of the game. And Little Y can pass only *q* levels of the game. You are given the indices of levels Little X can pass and the indices of levels Little Y can pass. Will Little X and Little Y pass the whole game, if they cooperate each other?
Input Specification:
The first line contains a single integer *n* (1<=≤<=<=*n*<=≤<=100).
The next line contains an integer *p* (0<=≤<=*p*<=≤<=*n*) at first, then follows *p* distinct integers *a*1,<=*a*2,<=...,<=*a**p* (1<=≤<=*a**i*<=≤<=*n*). These integers denote the indices of levels Little X can pass. The next line contains the levels Little Y can pass in the same format. It's assumed that levels are numbered from 1 to *n*.
Output Specification:
If they can pass all the levels, print "I become the guy.". If it's impossible, print "Oh, my keyboard!" (without the quotes).
Demo Input:
['4\n3 1 2 3\n2 2 4\n', '4\n3 1 2 3\n2 2 3\n']
Demo Output:
['I become the guy.\n', 'Oh, my keyboard!\n']
Note:
In the first sample, Little X can pass levels [1 2 3], and Little Y can pass level [2 4], so they can pass all the levels both.
In the second sample, no one can pass level 4. | ```python
n=int(input())
li1=list(map(int,input().split()))
li2=list(map(int,input().split()))
li3=li1+li2
s=set(li3)
sumt=(n*(n+1))/2
li=list(s)
if sum(li)==sumt:
print("I become the guy.")
else:
print("Oh, my keyboard!")
``` | 0 |
|
25 | A | IQ test | PROGRAMMING | 1,300 | [
"brute force"
] | A. IQ test | 2 | 256 | Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness. | The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness. | Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order. | [
"5\n2 4 7 8 10\n",
"4\n1 2 1 1\n"
] | [
"3\n",
"2\n"
] | none | 0 | [
{
"input": "5\n2 4 7 8 10",
"output": "3"
},
{
"input": "4\n1 2 1 1",
"output": "2"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n100 99 100",
"output": "2"
},
{
"input": "3\n5 3 2",
"output": "3"
},
{
"input": "4\n43 28 1 91",
"output": "2"
},
{
"input": "4\n75 13 94 77",
"output": "3"
},
{
"input": "4\n97 8 27 3",
"output": "2"
},
{
"input": "10\n95 51 12 91 85 3 1 31 25 7",
"output": "3"
},
{
"input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46",
"output": "4"
},
{
"input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36",
"output": "26"
},
{
"input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83",
"output": "48"
},
{
"input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25",
"output": "1"
},
{
"input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46",
"output": "25"
},
{
"input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73",
"output": "13"
},
{
"input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76",
"output": "99"
},
{
"input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14",
"output": "1"
},
{
"input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22",
"output": "93"
},
{
"input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23",
"output": "1"
},
{
"input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98",
"output": "1"
},
{
"input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94",
"output": "93"
},
{
"input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29",
"output": "32"
},
{
"input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47",
"output": "26"
},
{
"input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72",
"output": "56"
},
{
"input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86",
"output": "97"
},
{
"input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42",
"output": "79"
},
{
"input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52",
"output": "25"
},
{
"input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86",
"output": "78"
},
{
"input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68",
"output": "70"
},
{
"input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81",
"output": "39"
},
{
"input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83",
"output": "88"
},
{
"input": "3\n100 100 1",
"output": "3"
}
] | 1,602,371,164 | 2,147,483,647 | Python 3 | OK | TESTS | 32 | 218 | 0 | n=int(input())
a=[int(x) for x in input().split()]
b=[]
for i in range(n):
b.append(a[i]%2)
if b.count(1)>b.count(0):
c=[1]*n
else:
c=[0]*n
for i in range(n):
if b[i]-c[i]!=0:
print(i+1) | Title: IQ test
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output Specification:
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
Demo Input:
['5\n2 4 7 8 10\n', '4\n1 2 1 1\n']
Demo Output:
['3\n', '2\n']
Note:
none | ```python
n=int(input())
a=[int(x) for x in input().split()]
b=[]
for i in range(n):
b.append(a[i]%2)
if b.count(1)>b.count(0):
c=[1]*n
else:
c=[0]*n
for i in range(n):
if b[i]-c[i]!=0:
print(i+1)
``` | 3.9455 |
625 | B | War of the Corporations | PROGRAMMING | 1,200 | [
"constructive algorithms",
"greedy",
"strings"
] | null | null | A long time ago, in a galaxy far far away two giant IT-corporations Pineapple and Gogol continue their fierce competition. Crucial moment is just around the corner: Gogol is ready to release it's new tablet Lastus 3000.
This new device is equipped with specially designed artificial intelligence (AI). Employees of Pineapple did their best to postpone the release of Lastus 3000 as long as possible. Finally, they found out, that the name of the new artificial intelligence is similar to the name of the phone, that Pineapple released 200 years ago. As all rights on its name belong to Pineapple, they stand on changing the name of Gogol's artificial intelligence.
Pineapple insists, that the name of their phone occurs in the name of AI as a substring. Because the name of technology was already printed on all devices, the Gogol's director decided to replace some characters in AI name with "#". As this operation is pretty expensive, you should find the minimum number of characters to replace with "#", such that the name of AI doesn't contain the name of the phone as a substring.
Substring is a continuous subsequence of a string. | The first line of the input contains the name of AI designed by Gogol, its length doesn't exceed 100<=000 characters. Second line contains the name of the phone released by Pineapple 200 years ago, its length doesn't exceed 30. Both string are non-empty and consist of only small English letters. | Print the minimum number of characters that must be replaced with "#" in order to obtain that the name of the phone doesn't occur in the name of AI as a substring. | [
"intellect\ntell\n",
"google\napple\n",
"sirisiri\nsir\n"
] | [
"1",
"0",
"2"
] | In the first sample AI's name may be replaced with "int#llect".
In the second sample Gogol can just keep things as they are.
In the third sample one of the new possible names of AI may be "s#ris#ri". | 750 | [
{
"input": "intellect\ntell",
"output": "1"
},
{
"input": "google\napple",
"output": "0"
},
{
"input": "sirisiri\nsir",
"output": "2"
},
{
"input": "sirisiri\nsiri",
"output": "2"
},
{
"input": "aaaaaaa\naaaa",
"output": "1"
},
{
"input": "bbbbbb\nbb",
"output": "3"
},
{
"input": "abc\nabcabc",
"output": "0"
},
{
"input": "kek\nkekekek",
"output": "0"
},
{
"input": "aaaaa\naaa",
"output": "1"
},
{
"input": "abcdabcv\nabcd",
"output": "1"
},
{
"input": "abcabcabczabcabcabcz\ncab",
"output": "4"
},
{
"input": "aatopotopotopotaa\ntopot",
"output": "2"
},
{
"input": "abcabcabcabcabcabcabcabcabcabc\nabcabcabcabcabcabcabcabcabcabc",
"output": "1"
},
{
"input": "sosossosos\nsos",
"output": "2"
},
{
"input": "sosossosossosossosossosossosossosossosossosossosossosossosossosossosossosossosossosossosossosossosos\nsos",
"output": "20"
},
{
"input": "tatatx\ntatx",
"output": "1"
},
{
"input": "sxxsxxsxxd\nsxxsxxd",
"output": "1"
}
] | 1,498,085,255 | 2,147,483,647 | Python 3 | OK | TESTS | 56 | 140 | 5,632,000 | # Description of the problem can be found at http://codeforces.com/problemset/problem/625/B
x = input()
s = input()
print(x.count(s)) | Title: War of the Corporations
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A long time ago, in a galaxy far far away two giant IT-corporations Pineapple and Gogol continue their fierce competition. Crucial moment is just around the corner: Gogol is ready to release it's new tablet Lastus 3000.
This new device is equipped with specially designed artificial intelligence (AI). Employees of Pineapple did their best to postpone the release of Lastus 3000 as long as possible. Finally, they found out, that the name of the new artificial intelligence is similar to the name of the phone, that Pineapple released 200 years ago. As all rights on its name belong to Pineapple, they stand on changing the name of Gogol's artificial intelligence.
Pineapple insists, that the name of their phone occurs in the name of AI as a substring. Because the name of technology was already printed on all devices, the Gogol's director decided to replace some characters in AI name with "#". As this operation is pretty expensive, you should find the minimum number of characters to replace with "#", such that the name of AI doesn't contain the name of the phone as a substring.
Substring is a continuous subsequence of a string.
Input Specification:
The first line of the input contains the name of AI designed by Gogol, its length doesn't exceed 100<=000 characters. Second line contains the name of the phone released by Pineapple 200 years ago, its length doesn't exceed 30. Both string are non-empty and consist of only small English letters.
Output Specification:
Print the minimum number of characters that must be replaced with "#" in order to obtain that the name of the phone doesn't occur in the name of AI as a substring.
Demo Input:
['intellect\ntell\n', 'google\napple\n', 'sirisiri\nsir\n']
Demo Output:
['1', '0', '2']
Note:
In the first sample AI's name may be replaced with "int#llect".
In the second sample Gogol can just keep things as they are.
In the third sample one of the new possible names of AI may be "s#ris#ri". | ```python
# Description of the problem can be found at http://codeforces.com/problemset/problem/625/B
x = input()
s = input()
print(x.count(s))
``` | 3 |
|
776 | A | A Serial Killer | PROGRAMMING | 900 | [
"brute force",
"implementation",
"strings"
] | null | null | Our beloved detective, Sherlock is currently trying to catch a serial killer who kills a person each day. Using his powers of deduction, he came to know that the killer has a strategy for selecting his next victim.
The killer starts with two potential victims on his first day, selects one of these two, kills selected victim and replaces him with a new person. He repeats this procedure each day. This way, each day he has two potential victims to choose from. Sherlock knows the initial two potential victims. Also, he knows the murder that happened on a particular day and the new person who replaced this victim.
You need to help him get all the pairs of potential victims at each day so that Sherlock can observe some pattern. | First line of input contains two names (length of each of them doesn't exceed 10), the two initials potential victims. Next line contains integer *n* (1<=≤<=*n*<=≤<=1000), the number of days.
Next *n* lines contains two names (length of each of them doesn't exceed 10), first being the person murdered on this day and the second being the one who replaced that person.
The input format is consistent, that is, a person murdered is guaranteed to be from the two potential victims at that time. Also, all the names are guaranteed to be distinct and consists of lowercase English letters. | Output *n*<=+<=1 lines, the *i*-th line should contain the two persons from which the killer selects for the *i*-th murder. The (*n*<=+<=1)-th line should contain the two persons from which the next victim is selected. In each line, the two names can be printed in any order. | [
"ross rachel\n4\nross joey\nrachel phoebe\nphoebe monica\nmonica chandler\n",
"icm codeforces\n1\ncodeforces technex\n"
] | [
"ross rachel\njoey rachel\njoey phoebe\njoey monica\njoey chandler\n",
"icm codeforces\nicm technex\n"
] | In first example, the killer starts with ross and rachel.
- After day 1, ross is killed and joey appears. - After day 2, rachel is killed and phoebe appears. - After day 3, phoebe is killed and monica appears. - After day 4, monica is killed and chandler appears. | 500 | [
{
"input": "ross rachel\n4\nross joey\nrachel phoebe\nphoebe monica\nmonica chandler",
"output": "ross rachel\njoey rachel\njoey phoebe\njoey monica\njoey chandler"
},
{
"input": "icm codeforces\n1\ncodeforces technex",
"output": "icm codeforces\nicm technex"
},
{
"input": "a b\n3\na c\nb d\nd e",
"output": "a b\nc b\nc d\nc e"
},
{
"input": "ze udggmyop\n4\nze szhrbmft\nudggmyop mjorab\nszhrbmft ojdtfnzxj\nojdtfnzxj yjlkg",
"output": "ze udggmyop\nszhrbmft udggmyop\nszhrbmft mjorab\nojdtfnzxj mjorab\nyjlkg mjorab"
},
{
"input": "q s\n10\nq b\nb j\ns g\nj f\nf m\ng c\nc a\nm d\nd z\nz o",
"output": "q s\nb s\nj s\nj g\nf g\nm g\nm c\nm a\nd a\nz a\no a"
},
{
"input": "iii iiiiii\n7\niii iiiiiiiiii\niiiiiiiiii iiii\niiii i\niiiiii iiiiiiii\niiiiiiii iiiiiiiii\ni iiiii\niiiii ii",
"output": "iii iiiiii\niiiiiiiiii iiiiii\niiii iiiiii\ni iiiiii\ni iiiiiiii\ni iiiiiiiii\niiiii iiiiiiiii\nii iiiiiiiii"
},
{
"input": "bwyplnjn zkms\n26\nzkms nzmcsytxh\nnzmcsytxh yujsb\nbwyplnjn gtbzhudpb\ngtbzhudpb hpk\nyujsb xvy\nhpk wrwnfokml\nwrwnfokml ndouuikw\nndouuikw ucgrja\nucgrja tgfmpldz\nxvy nycrfphn\nnycrfphn quvs\nquvs htdy\nhtdy k\ntgfmpldz xtdpkxm\nxtdpkxm suwqxs\nk fv\nsuwqxs qckllwy\nqckllwy diun\nfv lefa\nlefa gdoqjysx\ndiun dhpz\ngdoqjysx bdmqdyt\ndhpz dgz\ndgz v\nbdmqdyt aswy\naswy ydkayhlrnm",
"output": "bwyplnjn zkms\nbwyplnjn nzmcsytxh\nbwyplnjn yujsb\ngtbzhudpb yujsb\nhpk yujsb\nhpk xvy\nwrwnfokml xvy\nndouuikw xvy\nucgrja xvy\ntgfmpldz xvy\ntgfmpldz nycrfphn\ntgfmpldz quvs\ntgfmpldz htdy\ntgfmpldz k\nxtdpkxm k\nsuwqxs k\nsuwqxs fv\nqckllwy fv\ndiun fv\ndiun lefa\ndiun gdoqjysx\ndhpz gdoqjysx\ndhpz bdmqdyt\ndgz bdmqdyt\nv bdmqdyt\nv aswy\nv ydkayhlrnm"
},
{
"input": "wxz hbeqwqp\n7\nhbeqwqp cpieghnszh\ncpieghnszh tlqrpd\ntlqrpd ttwrtio\nttwrtio xapvds\nxapvds zk\nwxz yryk\nzk b",
"output": "wxz hbeqwqp\nwxz cpieghnszh\nwxz tlqrpd\nwxz ttwrtio\nwxz xapvds\nwxz zk\nyryk zk\nyryk b"
},
{
"input": "wced gnsgv\n23\ngnsgv japawpaf\njapawpaf nnvpeu\nnnvpeu a\na ddupputljq\nddupputljq qyhnvbh\nqyhnvbh pqwijl\nwced khuvs\nkhuvs bjkh\npqwijl ysacmboc\nbjkh srf\nsrf jknoz\njknoz hodf\nysacmboc xqtkoyh\nhodf rfp\nxqtkoyh bivgnwqvoe\nbivgnwqvoe nknf\nnknf wuig\nrfp e\ne bqqknq\nwuig sznhhhu\nbqqknq dhrtdld\ndhrtdld n\nsznhhhu bguylf",
"output": "wced gnsgv\nwced japawpaf\nwced nnvpeu\nwced a\nwced ddupputljq\nwced qyhnvbh\nwced pqwijl\nkhuvs pqwijl\nbjkh pqwijl\nbjkh ysacmboc\nsrf ysacmboc\njknoz ysacmboc\nhodf ysacmboc\nhodf xqtkoyh\nrfp xqtkoyh\nrfp bivgnwqvoe\nrfp nknf\nrfp wuig\ne wuig\nbqqknq wuig\nbqqknq sznhhhu\ndhrtdld sznhhhu\nn sznhhhu\nn bguylf"
},
{
"input": "qqqqqqqqqq qqqqqqqq\n3\nqqqqqqqq qqqqqqqqq\nqqqqqqqqq qqqqq\nqqqqq q",
"output": "qqqqqqqqqq qqqqqqqq\nqqqqqqqqqq qqqqqqqqq\nqqqqqqqqqq qqqqq\nqqqqqqqqqq q"
},
{
"input": "wwwww w\n8\nwwwww wwwwwwww\nwwwwwwww wwwwwwwww\nwwwwwwwww wwwwwwwwww\nw www\nwwwwwwwwww wwww\nwwww ww\nwww wwwwww\nwwwwww wwwwwww",
"output": "wwwww w\nwwwwwwww w\nwwwwwwwww w\nwwwwwwwwww w\nwwwwwwwwww www\nwwww www\nww www\nww wwwwww\nww wwwwwww"
},
{
"input": "k d\n17\nk l\nd v\nv z\nl r\nz i\nr s\ns p\np w\nw j\nj h\ni c\nh m\nm q\nc o\no g\nq x\nx n",
"output": "k d\nl d\nl v\nl z\nr z\nr i\ns i\np i\nw i\nj i\nh i\nh c\nm c\nq c\nq o\nq g\nx g\nn g"
}
] | 1,593,521,808 | 2,147,483,647 | PyPy 3 | OK | TESTS | 57 | 202 | 3,276,800 | n,m= input().split()
print(n,m)
num = int(input())
for i in range(num):
a,b=input().split()
if(a==n):
print(b,m)
n=b
else:
print(b,n)
m=b
| Title: A Serial Killer
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Our beloved detective, Sherlock is currently trying to catch a serial killer who kills a person each day. Using his powers of deduction, he came to know that the killer has a strategy for selecting his next victim.
The killer starts with two potential victims on his first day, selects one of these two, kills selected victim and replaces him with a new person. He repeats this procedure each day. This way, each day he has two potential victims to choose from. Sherlock knows the initial two potential victims. Also, he knows the murder that happened on a particular day and the new person who replaced this victim.
You need to help him get all the pairs of potential victims at each day so that Sherlock can observe some pattern.
Input Specification:
First line of input contains two names (length of each of them doesn't exceed 10), the two initials potential victims. Next line contains integer *n* (1<=≤<=*n*<=≤<=1000), the number of days.
Next *n* lines contains two names (length of each of them doesn't exceed 10), first being the person murdered on this day and the second being the one who replaced that person.
The input format is consistent, that is, a person murdered is guaranteed to be from the two potential victims at that time. Also, all the names are guaranteed to be distinct and consists of lowercase English letters.
Output Specification:
Output *n*<=+<=1 lines, the *i*-th line should contain the two persons from which the killer selects for the *i*-th murder. The (*n*<=+<=1)-th line should contain the two persons from which the next victim is selected. In each line, the two names can be printed in any order.
Demo Input:
['ross rachel\n4\nross joey\nrachel phoebe\nphoebe monica\nmonica chandler\n', 'icm codeforces\n1\ncodeforces technex\n']
Demo Output:
['ross rachel\njoey rachel\njoey phoebe\njoey monica\njoey chandler\n', 'icm codeforces\nicm technex\n']
Note:
In first example, the killer starts with ross and rachel.
- After day 1, ross is killed and joey appears. - After day 2, rachel is killed and phoebe appears. - After day 3, phoebe is killed and monica appears. - After day 4, monica is killed and chandler appears. | ```python
n,m= input().split()
print(n,m)
num = int(input())
for i in range(num):
a,b=input().split()
if(a==n):
print(b,m)
n=b
else:
print(b,n)
m=b
``` | 3 |
|
785 | A | Anton and Polyhedrons | PROGRAMMING | 800 | [
"implementation",
"strings"
] | null | null | Anton's favourite geometric figures are regular polyhedrons. Note that there are five kinds of regular polyhedrons:
- Tetrahedron. Tetrahedron has 4 triangular faces. - Cube. Cube has 6 square faces. - Octahedron. Octahedron has 8 triangular faces. - Dodecahedron. Dodecahedron has 12 pentagonal faces. - Icosahedron. Icosahedron has 20 triangular faces.
All five kinds of polyhedrons are shown on the picture below:
Anton has a collection of *n* polyhedrons. One day he decided to know, how many faces his polyhedrons have in total. Help Anton and find this number! | The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of polyhedrons in Anton's collection.
Each of the following *n* lines of the input contains a string *s**i* — the name of the *i*-th polyhedron in Anton's collection. The string can look like this:
- "Tetrahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a tetrahedron. - "Cube" (without quotes), if the *i*-th polyhedron in Anton's collection is a cube. - "Octahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an octahedron. - "Dodecahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a dodecahedron. - "Icosahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an icosahedron. | Output one number — the total number of faces in all the polyhedrons in Anton's collection. | [
"4\nIcosahedron\nCube\nTetrahedron\nDodecahedron\n",
"3\nDodecahedron\nOctahedron\nOctahedron\n"
] | [
"42\n",
"28\n"
] | In the first sample Anton has one icosahedron, one cube, one tetrahedron and one dodecahedron. Icosahedron has 20 faces, cube has 6 faces, tetrahedron has 4 faces and dodecahedron has 12 faces. In total, they have 20 + 6 + 4 + 12 = 42 faces. | 500 | [
{
"input": "4\nIcosahedron\nCube\nTetrahedron\nDodecahedron",
"output": "42"
},
{
"input": "3\nDodecahedron\nOctahedron\nOctahedron",
"output": "28"
},
{
"input": "25\nIcosahedron\nOctahedron\nTetrahedron\nDodecahedron\nCube\nIcosahedron\nOctahedron\nCube\nTetrahedron\nIcosahedron\nIcosahedron\nTetrahedron\nOctahedron\nDodecahedron\nIcosahedron\nOctahedron\nIcosahedron\nTetrahedron\nDodecahedron\nTetrahedron\nOctahedron\nCube\nCube\nDodecahedron\nTetrahedron",
"output": "256"
},
{
"input": "1\nTetrahedron",
"output": "4"
},
{
"input": "1\nCube",
"output": "6"
},
{
"input": "1\nOctahedron",
"output": "8"
},
{
"input": "1\nDodecahedron",
"output": "12"
},
{
"input": "1\nIcosahedron",
"output": "20"
},
{
"input": "28\nOctahedron\nDodecahedron\nOctahedron\nOctahedron\nDodecahedron\nIcosahedron\nIcosahedron\nDodecahedron\nDodecahedron\nDodecahedron\nCube\nDodecahedron\nCube\nTetrahedron\nCube\nCube\nTetrahedron\nDodecahedron\nDodecahedron\nDodecahedron\nIcosahedron\nIcosahedron\nDodecahedron\nIcosahedron\nDodecahedron\nDodecahedron\nIcosahedron\nIcosahedron",
"output": "340"
}
] | 1,679,367,714 | 2,147,483,647 | Python 3 | OK | TESTS | 30 | 265 | 0 | s = {"Tetrahedron": 4,
"Cube": 6,
"Octahedron": 8,
"Dodecahedron": 12,
"Icosahedron": 20}
t = int(input())
add = 0
for i in range(t):
add += s[input()]
print(add)
| Title: Anton and Polyhedrons
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Anton's favourite geometric figures are regular polyhedrons. Note that there are five kinds of regular polyhedrons:
- Tetrahedron. Tetrahedron has 4 triangular faces. - Cube. Cube has 6 square faces. - Octahedron. Octahedron has 8 triangular faces. - Dodecahedron. Dodecahedron has 12 pentagonal faces. - Icosahedron. Icosahedron has 20 triangular faces.
All five kinds of polyhedrons are shown on the picture below:
Anton has a collection of *n* polyhedrons. One day he decided to know, how many faces his polyhedrons have in total. Help Anton and find this number!
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of polyhedrons in Anton's collection.
Each of the following *n* lines of the input contains a string *s**i* — the name of the *i*-th polyhedron in Anton's collection. The string can look like this:
- "Tetrahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a tetrahedron. - "Cube" (without quotes), if the *i*-th polyhedron in Anton's collection is a cube. - "Octahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an octahedron. - "Dodecahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is a dodecahedron. - "Icosahedron" (without quotes), if the *i*-th polyhedron in Anton's collection is an icosahedron.
Output Specification:
Output one number — the total number of faces in all the polyhedrons in Anton's collection.
Demo Input:
['4\nIcosahedron\nCube\nTetrahedron\nDodecahedron\n', '3\nDodecahedron\nOctahedron\nOctahedron\n']
Demo Output:
['42\n', '28\n']
Note:
In the first sample Anton has one icosahedron, one cube, one tetrahedron and one dodecahedron. Icosahedron has 20 faces, cube has 6 faces, tetrahedron has 4 faces and dodecahedron has 12 faces. In total, they have 20 + 6 + 4 + 12 = 42 faces. | ```python
s = {"Tetrahedron": 4,
"Cube": 6,
"Octahedron": 8,
"Dodecahedron": 12,
"Icosahedron": 20}
t = int(input())
add = 0
for i in range(t):
add += s[input()]
print(add)
``` | 3 |
|
849 | B | Tell Your World | PROGRAMMING | 1,600 | [
"brute force",
"geometry"
] | null | null | Connect the countless points with lines, till we reach the faraway yonder.
There are *n* points on a coordinate plane, the *i*-th of which being (*i*,<=*y**i*).
Determine whether it's possible to draw two parallel and non-overlapping lines, such that every point in the set lies on exactly one of them, and each of them passes through at least one point in the set. | The first line of input contains a positive integer *n* (3<=≤<=*n*<=≤<=1<=000) — the number of points.
The second line contains *n* space-separated integers *y*1,<=*y*2,<=...,<=*y**n* (<=-<=109<=≤<=*y**i*<=≤<=109) — the vertical coordinates of each point. | Output "Yes" (without quotes) if it's possible to fulfill the requirements, and "No" otherwise.
You can print each letter in any case (upper or lower). | [
"5\n7 5 8 6 9\n",
"5\n-1 -2 0 0 -5\n",
"5\n5 4 3 2 1\n",
"5\n1000000000 0 0 0 0\n"
] | [
"Yes\n",
"No\n",
"No\n",
"Yes\n"
] | In the first example, there are five points: (1, 7), (2, 5), (3, 8), (4, 6) and (5, 9). It's possible to draw a line that passes through points 1, 3, 5, and another one that passes through points 2, 4 and is parallel to the first one.
In the second example, while it's possible to draw two lines that cover all points, they cannot be made parallel.
In the third example, it's impossible to satisfy both requirements at the same time. | 1,000 | [
{
"input": "5\n7 5 8 6 9",
"output": "Yes"
},
{
"input": "5\n-1 -2 0 0 -5",
"output": "No"
},
{
"input": "5\n5 4 3 2 1",
"output": "No"
},
{
"input": "5\n1000000000 0 0 0 0",
"output": "Yes"
},
{
"input": "5\n1000000000 1 0 -999999999 -1000000000",
"output": "Yes"
},
{
"input": "3\n998 244 353",
"output": "Yes"
},
{
"input": "3\n-1000000000 0 1000000000",
"output": "No"
},
{
"input": "5\n-1 -1 -1 -1 1",
"output": "Yes"
},
{
"input": "4\n-9763 530 3595 6660",
"output": "Yes"
},
{
"input": "4\n-253090305 36298498 374072642 711846786",
"output": "Yes"
},
{
"input": "5\n-186772848 -235864239 -191561068 -193955178 -243046569",
"output": "Yes"
},
{
"input": "5\n-954618456 -522919664 -248330428 -130850748 300848044",
"output": "Yes"
},
{
"input": "10\n4846 6705 2530 5757 5283 -944 -2102 -3260 -4418 2913",
"output": "No"
},
{
"input": "10\n-6568 -5920 -5272 -4624 -2435 -635 -2680 -2032 -1384 6565",
"output": "No"
},
{
"input": "20\n319410377 286827025 254243673 221660321 189076969 156493617 123910265 91326913 58743561 26160209 -6423143 -39006495 -71589847 -104173199 -136756551 -169339903 -201923255 -234506607 -267089959 -299673311",
"output": "No"
},
{
"input": "20\n-975467170 758268840 -975467171 758268839 -975467172 758268838 -975467173 758268837 -975467174 758268836 -975467175 758268835 -975467176 758268834 -975467177 758268833 -975467178 758268832 -975467179 758268831",
"output": "Yes"
},
{
"input": "4\n1 0 3 0",
"output": "No"
},
{
"input": "4\n100 2 3 4",
"output": "Yes"
},
{
"input": "5\n7 5 8 6 3",
"output": "No"
},
{
"input": "3\n1000000000 1000000000 -1000000000",
"output": "Yes"
},
{
"input": "4\n1 0 1 4",
"output": "Yes"
},
{
"input": "7\n1 2 -1 0 1 6 7",
"output": "Yes"
},
{
"input": "4\n0 0 4 0",
"output": "Yes"
},
{
"input": "7\n0 0 2 3 4 5 5",
"output": "Yes"
},
{
"input": "5\n7 5 8 6 8",
"output": "No"
},
{
"input": "5\n1 2 9 4 5",
"output": "Yes"
},
{
"input": "8\n1 12 3 14 5 16 7 8",
"output": "Yes"
},
{
"input": "5\n1 6 7 4 9",
"output": "Yes"
},
{
"input": "5\n2 1 0 1 2",
"output": "No"
},
{
"input": "4\n0 0 1 3",
"output": "Yes"
},
{
"input": "4\n100 50 50 10000000",
"output": "No"
},
{
"input": "5\n1 2 3 3 3",
"output": "No"
},
{
"input": "5\n1 2 6 10 17",
"output": "Yes"
},
{
"input": "4\n1 3 4 4",
"output": "Yes"
},
{
"input": "4\n100 50 50 1000000",
"output": "No"
},
{
"input": "6\n1 2 4 5 7 9",
"output": "No"
},
{
"input": "6\n0 0 1 2 3 4",
"output": "Yes"
},
{
"input": "5\n7 5 9 10 8",
"output": "Yes"
},
{
"input": "7\n1 2 2 1 2 2 1",
"output": "Yes"
},
{
"input": "4\n2 2 4 5",
"output": "Yes"
},
{
"input": "6\n1 2 1 3 4 5",
"output": "No"
},
{
"input": "4\n1 3 3 6",
"output": "No"
},
{
"input": "5\n1 2 -3 4 -1",
"output": "Yes"
}
] | 1,553,843,149 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 93 | 0 | n=int(input())
l=[int(i) for i in input().split()]
diff=[l[i]-l[i-1] for i in range(1,n)]
if len(set(diff))<=2:
print('Yes')
else:
print('No') | Title: Tell Your World
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Connect the countless points with lines, till we reach the faraway yonder.
There are *n* points on a coordinate plane, the *i*-th of which being (*i*,<=*y**i*).
Determine whether it's possible to draw two parallel and non-overlapping lines, such that every point in the set lies on exactly one of them, and each of them passes through at least one point in the set.
Input Specification:
The first line of input contains a positive integer *n* (3<=≤<=*n*<=≤<=1<=000) — the number of points.
The second line contains *n* space-separated integers *y*1,<=*y*2,<=...,<=*y**n* (<=-<=109<=≤<=*y**i*<=≤<=109) — the vertical coordinates of each point.
Output Specification:
Output "Yes" (without quotes) if it's possible to fulfill the requirements, and "No" otherwise.
You can print each letter in any case (upper or lower).
Demo Input:
['5\n7 5 8 6 9\n', '5\n-1 -2 0 0 -5\n', '5\n5 4 3 2 1\n', '5\n1000000000 0 0 0 0\n']
Demo Output:
['Yes\n', 'No\n', 'No\n', 'Yes\n']
Note:
In the first example, there are five points: (1, 7), (2, 5), (3, 8), (4, 6) and (5, 9). It's possible to draw a line that passes through points 1, 3, 5, and another one that passes through points 2, 4 and is parallel to the first one.
In the second example, while it's possible to draw two lines that cover all points, they cannot be made parallel.
In the third example, it's impossible to satisfy both requirements at the same time. | ```python
n=int(input())
l=[int(i) for i in input().split()]
diff=[l[i]-l[i-1] for i in range(1,n)]
if len(set(diff))<=2:
print('Yes')
else:
print('No')
``` | 0 |
|
574 | B | Bear and Three Musketeers | PROGRAMMING | 1,500 | [
"brute force",
"dfs and similar",
"graphs",
"hashing"
] | null | null | Do you know a story about the three musketeers? Anyway, you will learn about its origins now.
Richelimakieu is a cardinal in the city of Bearis. He is tired of dealing with crime by himself. He needs three brave warriors to help him to fight against bad guys.
There are *n* warriors. Richelimakieu wants to choose three of them to become musketeers but it's not that easy. The most important condition is that musketeers must know each other to cooperate efficiently. And they shouldn't be too well known because they could be betrayed by old friends. For each musketeer his recognition is the number of warriors he knows, excluding other two musketeers.
Help Richelimakieu! Find if it is possible to choose three musketeers knowing each other, and what is minimum possible sum of their recognitions. | The first line contains two space-separated integers, *n* and *m* (3<=≤<=*n*<=≤<=4000, 0<=≤<=*m*<=≤<=4000) — respectively number of warriors and number of pairs of warriors knowing each other.
*i*-th of the following *m* lines contains two space-separated integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*, *a**i*<=≠<=*b**i*). Warriors *a**i* and *b**i* know each other. Each pair of warriors will be listed at most once. | If Richelimakieu can choose three musketeers, print the minimum possible sum of their recognitions. Otherwise, print "-1" (without the quotes). | [
"5 6\n1 2\n1 3\n2 3\n2 4\n3 4\n4 5\n",
"7 4\n2 1\n3 6\n5 1\n1 7\n"
] | [
"2\n",
"-1\n"
] | In the first sample Richelimakieu should choose a triple 1, 2, 3. The first musketeer doesn't know anyone except other two musketeers so his recognition is 0. The second musketeer has recognition 1 because he knows warrior number 4. The third musketeer also has recognition 1 because he knows warrior 4. Sum of recognitions is 0 + 1 + 1 = 2.
The other possible triple is 2, 3, 4 but it has greater sum of recognitions, equal to 1 + 1 + 1 = 3.
In the second sample there is no triple of warriors knowing each other. | 1,000 | [
{
"input": "5 6\n1 2\n1 3\n2 3\n2 4\n3 4\n4 5",
"output": "2"
},
{
"input": "7 4\n2 1\n3 6\n5 1\n1 7",
"output": "-1"
},
{
"input": "5 0",
"output": "-1"
},
{
"input": "7 14\n3 6\n2 3\n5 2\n5 6\n7 5\n7 4\n6 2\n3 5\n7 1\n4 1\n6 1\n7 6\n6 4\n5 4",
"output": "5"
},
{
"input": "15 15\n4 15\n12 1\n15 6\n11 6\n15 7\n6 8\n15 10\n6 12\n12 8\n15 8\n15 3\n11 9\n7 3\n6 4\n12 11",
"output": "4"
},
{
"input": "12 66\n9 12\n1 4\n8 4\n5 3\n10 5\n12 2\n3 2\n2 7\n1 7\n3 7\n6 2\n4 2\n6 10\n8 10\n4 6\n8 5\n12 6\n11 9\n7 12\n5 4\n11 7\n9 4\n10 4\n6 3\n1 6\n9 7\n3 8\n6 11\n10 9\n3 11\n11 1\n5 12\n8 2\n2 1\n3 1\n12 4\n3 9\n10 12\n8 11\n7 10\n11 5\n9 5\n8 7\n11 4\n8 1\n2 11\n5 1\n3 4\n8 12\n9 2\n10 11\n9 1\n5 7\n10 3\n11 12\n7 4\n2 10\n12 3\n6 8\n7 6\n2 5\n1 10\n12 1\n9 6\n8 9\n6 5",
"output": "27"
},
{
"input": "3 0",
"output": "-1"
},
{
"input": "3 2\n2 3\n2 1",
"output": "-1"
},
{
"input": "3 3\n3 1\n3 2\n2 1",
"output": "0"
},
{
"input": "4 6\n3 4\n1 3\n4 1\n3 2\n2 1\n4 2",
"output": "3"
},
{
"input": "8 10\n1 5\n4 1\n1 2\n2 8\n2 7\n6 3\n5 8\n3 5\n7 8\n1 6",
"output": "2"
},
{
"input": "15 17\n1 3\n7 10\n7 9\n8 13\n6 15\n8 2\n13 6\n10 5\n15 3\n4 15\n4 6\n5 11\n13 9\n12 2\n11 14\n4 12\n14 1",
"output": "3"
},
{
"input": "25 10\n19 11\n19 13\n13 11\n13 22\n19 23\n19 20\n13 17\n19 14\n13 15\n19 4",
"output": "7"
},
{
"input": "987 50\n221 959\n221 553\n959 695\n553 959\n819 437\n371 295\n695 553\n959 347\n595 699\n652 628\n553 347\n868 589\n695 221\n282 714\n351 703\n104 665\n755 436\n556 511\n695 347\n221 347\n243 874\n695 847\n863 501\n583 145\n786 221\n38 286\n72 397\n808 658\n724 437\n911 548\n405 759\n681 316\n648 328\n327 199\n772 139\n932 609\n859 576\n915 507\n379 316\n381 348\n918 871\n261 450\n443 389\n549 246\n901 515\n930 923\n336 545\n179 225\n213 677\n458 204",
"output": "6"
},
{
"input": "4000 0",
"output": "-1"
}
] | 1,620,188,062 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 18 | 904 | 3,584,000 | import sys
input = sys.stdin.readline
n,m = map(int,input().split())
adj=[[] for j in range(n+1)]
for i in range(m):
a,b = map(int, input().split())
adj[a].append(b)
adj[b].append(a)
ans=9999
for i in range(1,n+1):
f=[i]
for j in range(1,n+1):
if j!=i:
if i in adj[j]:
f.append(j)
for k in range(1,n+1):
if k not in f:
if k in adj[f[0]]:
if k in adj[f[1]]:
aa=len(adj[f[0]])
bb=len(adj[f[1]])
cc=len(adj[k])
ans= min( ans,aa+bb+cc-6 )
if ans==9999:
print(-1)
else:
print(ans)
| Title: Bear and Three Musketeers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Do you know a story about the three musketeers? Anyway, you will learn about its origins now.
Richelimakieu is a cardinal in the city of Bearis. He is tired of dealing with crime by himself. He needs three brave warriors to help him to fight against bad guys.
There are *n* warriors. Richelimakieu wants to choose three of them to become musketeers but it's not that easy. The most important condition is that musketeers must know each other to cooperate efficiently. And they shouldn't be too well known because they could be betrayed by old friends. For each musketeer his recognition is the number of warriors he knows, excluding other two musketeers.
Help Richelimakieu! Find if it is possible to choose three musketeers knowing each other, and what is minimum possible sum of their recognitions.
Input Specification:
The first line contains two space-separated integers, *n* and *m* (3<=≤<=*n*<=≤<=4000, 0<=≤<=*m*<=≤<=4000) — respectively number of warriors and number of pairs of warriors knowing each other.
*i*-th of the following *m* lines contains two space-separated integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*, *a**i*<=≠<=*b**i*). Warriors *a**i* and *b**i* know each other. Each pair of warriors will be listed at most once.
Output Specification:
If Richelimakieu can choose three musketeers, print the minimum possible sum of their recognitions. Otherwise, print "-1" (without the quotes).
Demo Input:
['5 6\n1 2\n1 3\n2 3\n2 4\n3 4\n4 5\n', '7 4\n2 1\n3 6\n5 1\n1 7\n']
Demo Output:
['2\n', '-1\n']
Note:
In the first sample Richelimakieu should choose a triple 1, 2, 3. The first musketeer doesn't know anyone except other two musketeers so his recognition is 0. The second musketeer has recognition 1 because he knows warrior number 4. The third musketeer also has recognition 1 because he knows warrior 4. Sum of recognitions is 0 + 1 + 1 = 2.
The other possible triple is 2, 3, 4 but it has greater sum of recognitions, equal to 1 + 1 + 1 = 3.
In the second sample there is no triple of warriors knowing each other. | ```python
import sys
input = sys.stdin.readline
n,m = map(int,input().split())
adj=[[] for j in range(n+1)]
for i in range(m):
a,b = map(int, input().split())
adj[a].append(b)
adj[b].append(a)
ans=9999
for i in range(1,n+1):
f=[i]
for j in range(1,n+1):
if j!=i:
if i in adj[j]:
f.append(j)
for k in range(1,n+1):
if k not in f:
if k in adj[f[0]]:
if k in adj[f[1]]:
aa=len(adj[f[0]])
bb=len(adj[f[1]])
cc=len(adj[k])
ans= min( ans,aa+bb+cc-6 )
if ans==9999:
print(-1)
else:
print(ans)
``` | 0 |
|
227 | A | Where do I Turn? | PROGRAMMING | 1,300 | [
"geometry"
] | null | null | Trouble came from the overseas lands: a three-headed dragon Gorynych arrived. The dragon settled at point *C* and began to terrorize the residents of the surrounding villages.
A brave hero decided to put an end to the dragon. He moved from point *A* to fight with Gorynych. The hero rode from point *A* along a straight road and met point *B* on his way. The hero knows that in this land for every pair of roads it is true that they are either parallel to each other, or lie on a straight line, or are perpendicular to each other. He also knows well that points *B* and *C* are connected by a road. So the hero must either turn 90 degrees to the left or continue riding straight ahead or turn 90 degrees to the right. But he forgot where the point *C* is located.
Fortunately, a Brave Falcon flew right by. It can see all three points from the sky. The hero asked him what way to go to get to the dragon's lair.
If you have not got it, you are the falcon. Help the hero and tell him how to get him to point *C*: turn left, go straight or turn right.
At this moment the hero is believed to stand at point *B*, turning his back to point *A*. | The first input line contains two space-separated integers *x**a*,<=*y**a* (|*x**a*|,<=|*y**a*|<=≤<=109) — the coordinates of point *A*. The second line contains the coordinates of point *B* in the same form, the third line contains the coordinates of point *C*.
It is guaranteed that all points are pairwise different. It is also guaranteed that either point *B* lies on segment *AC*, or angle *ABC* is right. | Print a single line. If a hero must turn left, print "LEFT" (without the quotes); If he must go straight ahead, print "TOWARDS" (without the quotes); if he should turn right, print "RIGHT" (without the quotes). | [
"0 0\n0 1\n1 1\n",
"-1 -1\n-3 -3\n-4 -4\n",
"-4 -6\n-3 -7\n-2 -6\n"
] | [
"RIGHT\n",
"TOWARDS\n",
"LEFT\n"
] | The picture to the first sample:
The red color shows points A, B and C. The blue arrow shows the hero's direction. The green color shows the hero's trajectory.
The picture to the second sample: | 500 | [
{
"input": "0 0\n0 1\n1 1",
"output": "RIGHT"
},
{
"input": "-1 -1\n-3 -3\n-4 -4",
"output": "TOWARDS"
},
{
"input": "-4 -6\n-3 -7\n-2 -6",
"output": "LEFT"
},
{
"input": "-44 57\n-118 -41\n-216 33",
"output": "RIGHT"
},
{
"input": "39 100\n90 85\n105 136",
"output": "LEFT"
},
{
"input": "71 43\n96 -15\n171 -189",
"output": "TOWARDS"
},
{
"input": "-22 -84\n-117 8\n-25 103",
"output": "RIGHT"
},
{
"input": "28 -81\n49 -85\n45 -106",
"output": "RIGHT"
},
{
"input": "-20 -60\n-39 -45\n-24 -26",
"output": "RIGHT"
},
{
"input": "-61 -24\n-61 35\n-120 35",
"output": "LEFT"
},
{
"input": "-19 27\n-115 -63\n-25 -159",
"output": "LEFT"
},
{
"input": "53 69\n147 114\n102 208",
"output": "LEFT"
},
{
"input": "22 -38\n22 -128\n22 -398",
"output": "TOWARDS"
},
{
"input": "47 16\n-13 -52\n-253 -324",
"output": "TOWARDS"
},
{
"input": "71 -22\n10 -1\n-417 146",
"output": "TOWARDS"
},
{
"input": "-783785 244379\n-827111 1135071\n63581 1178397",
"output": "RIGHT"
},
{
"input": "3609 -639705\n294730 -1024276\n-89841 -1315397",
"output": "RIGHT"
},
{
"input": "47715 -171800\n-228153 -358383\n-414736 -82515",
"output": "RIGHT"
},
{
"input": "-702371 875896\n-1445450 1767452\n-2337006 1024373",
"output": "LEFT"
},
{
"input": "-508160 -332418\n-1151137 415692\n-1899247 -227285",
"output": "LEFT"
},
{
"input": "-756864 833019\n-105276 568688\n159055 1220276",
"output": "LEFT"
},
{
"input": "635167 -889045\n1429362 -1770135\n2223557 -2651225",
"output": "TOWARDS"
},
{
"input": "-897142 527212\n-313890 206605\n2019118 -1075823",
"output": "TOWARDS"
},
{
"input": "8662 -907734\n-73417 -1195869\n-401733 -2348409",
"output": "TOWARDS"
},
{
"input": "-752889181 -922273353\n-495897323 -117405233\n308970797 -374397091",
"output": "RIGHT"
},
{
"input": "-143491154 -462477108\n173292223 111677574\n747446905 -205105803",
"output": "RIGHT"
},
{
"input": "419299232 564945785\n960228923 -229158901\n166124237 -770088592",
"output": "RIGHT"
},
{
"input": "85768877 -347290108\n332919696 -655546541\n641176129 -408395722",
"output": "LEFT"
},
{
"input": "708149426 502573762\n-210552252 335164034\n-43142524 -583537644",
"output": "LEFT"
},
{
"input": "640934661 -321662897\n-332613133 326172546\n-980448576 -647375248",
"output": "LEFT"
},
{
"input": "-951852504 776750379\n-698326409 275687363\n-191274219 -726438669",
"output": "TOWARDS"
},
{
"input": "507851078 -147339692\n440808462 -4699564\n373765846 137940564",
"output": "TOWARDS"
},
{
"input": "579796456 -149651968\n516495557 -133472697\n-369717029 93037097",
"output": "TOWARDS"
},
{
"input": "0 -1800000\n0 0\n10000000 0",
"output": "RIGHT"
},
{
"input": "0 994599799\n0 0\n-999999928 0",
"output": "RIGHT"
},
{
"input": "-1000000000 0\n0 0\n0 1000000000",
"output": "LEFT"
},
{
"input": "1000000000 1000000000\n-1000000000 1000000000\n-1000000000 -1000000000",
"output": "LEFT"
},
{
"input": "0 0\n1 0\n1 1",
"output": "LEFT"
},
{
"input": "0 0\n0 1000000000\n1000000000 1000000000",
"output": "RIGHT"
},
{
"input": "998000000 999000000\n999000000 1000000000\n1000000000 999000000",
"output": "RIGHT"
},
{
"input": "0 0\n1000000000 0\n1000000000 1000000000",
"output": "LEFT"
},
{
"input": "0 0\n1111111 1111111\n2222222 0",
"output": "RIGHT"
},
{
"input": "0 0\n100000007 0\n100000007 -999999999",
"output": "RIGHT"
},
{
"input": "-1000000000 1000000000\n-1000000000 -1000000000\n1000000000 -1000000000",
"output": "LEFT"
},
{
"input": "0 1000000000\n0 -99999999\n-99999999 -99999999",
"output": "RIGHT"
},
{
"input": "1000000000 1000000000\n1000000000 0\n0 0",
"output": "RIGHT"
},
{
"input": "0 0\n100000000 100000000\n1000000000 1000000000",
"output": "TOWARDS"
},
{
"input": "0 -1000000000\n0 0\n1000000000 0",
"output": "RIGHT"
}
] | 1,630,951,047 | 2,147,483,647 | Python 3 | OK | TESTS | 48 | 124 | 6,963,200 | xa,ya = input().split()
xa = int(xa)
ya = int(ya)
xb,yb = input().split()
xb = int(xb)
yb = int(yb)
xc,yc = input().split()
xc = int(xc)
yc = int(yc)
vab_x = xb-xa
vab_y = yb-ya
vbc_x = xc - xb
vbc_y = yc - yb
produto_vetorial = (vab_x * vbc_y) - (vab_y * vbc_x)
if(produto_vetorial == 0):
print("TOWARDS")
elif(produto_vetorial < 0):
print("RIGHT")
else:
print("LEFT")
| Title: Where do I Turn?
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Trouble came from the overseas lands: a three-headed dragon Gorynych arrived. The dragon settled at point *C* and began to terrorize the residents of the surrounding villages.
A brave hero decided to put an end to the dragon. He moved from point *A* to fight with Gorynych. The hero rode from point *A* along a straight road and met point *B* on his way. The hero knows that in this land for every pair of roads it is true that they are either parallel to each other, or lie on a straight line, or are perpendicular to each other. He also knows well that points *B* and *C* are connected by a road. So the hero must either turn 90 degrees to the left or continue riding straight ahead or turn 90 degrees to the right. But he forgot where the point *C* is located.
Fortunately, a Brave Falcon flew right by. It can see all three points from the sky. The hero asked him what way to go to get to the dragon's lair.
If you have not got it, you are the falcon. Help the hero and tell him how to get him to point *C*: turn left, go straight or turn right.
At this moment the hero is believed to stand at point *B*, turning his back to point *A*.
Input Specification:
The first input line contains two space-separated integers *x**a*,<=*y**a* (|*x**a*|,<=|*y**a*|<=≤<=109) — the coordinates of point *A*. The second line contains the coordinates of point *B* in the same form, the third line contains the coordinates of point *C*.
It is guaranteed that all points are pairwise different. It is also guaranteed that either point *B* lies on segment *AC*, or angle *ABC* is right.
Output Specification:
Print a single line. If a hero must turn left, print "LEFT" (without the quotes); If he must go straight ahead, print "TOWARDS" (without the quotes); if he should turn right, print "RIGHT" (without the quotes).
Demo Input:
['0 0\n0 1\n1 1\n', '-1 -1\n-3 -3\n-4 -4\n', '-4 -6\n-3 -7\n-2 -6\n']
Demo Output:
['RIGHT\n', 'TOWARDS\n', 'LEFT\n']
Note:
The picture to the first sample:
The red color shows points A, B and C. The blue arrow shows the hero's direction. The green color shows the hero's trajectory.
The picture to the second sample: | ```python
xa,ya = input().split()
xa = int(xa)
ya = int(ya)
xb,yb = input().split()
xb = int(xb)
yb = int(yb)
xc,yc = input().split()
xc = int(xc)
yc = int(yc)
vab_x = xb-xa
vab_y = yb-ya
vbc_x = xc - xb
vbc_y = yc - yb
produto_vetorial = (vab_x * vbc_y) - (vab_y * vbc_x)
if(produto_vetorial == 0):
print("TOWARDS")
elif(produto_vetorial < 0):
print("RIGHT")
else:
print("LEFT")
``` | 3 |
|
220 | A | Little Elephant and Problem | PROGRAMMING | 1,300 | [
"implementation",
"sortings"
] | null | null | The Little Elephant has got a problem — somebody has been touching his sorted by non-decreasing array *a* of length *n* and possibly swapped some elements of the array.
The Little Elephant doesn't want to call the police until he understands if he could have accidentally changed the array himself. He thinks that he could have accidentally changed array *a*, only if array *a* can be sorted in no more than one operation of swapping elements (not necessarily adjacent). That is, the Little Elephant could have accidentally swapped some two elements.
Help the Little Elephant, determine if he could have accidentally changed the array *a*, sorted by non-decreasing, himself. | The first line contains a single integer *n* (2<=≤<=*n*<=≤<=105) — the size of array *a*. The next line contains *n* positive integers, separated by single spaces and not exceeding 109, — array *a*.
Note that the elements of the array are not necessarily distinct numbers. | In a single line print "YES" (without the quotes) if the Little Elephant could have accidentally changed the array himself, and "NO" (without the quotes) otherwise. | [
"2\n1 2\n",
"3\n3 2 1\n",
"4\n4 3 2 1\n"
] | [
"YES\n",
"YES\n",
"NO\n"
] | In the first sample the array has already been sorted, so to sort it, we need 0 swap operations, that is not more than 1. Thus, the answer is "YES".
In the second sample we can sort the array if we swap elements 1 and 3, so we need 1 swap operation to sort the array. Thus, the answer is "YES".
In the third sample we can't sort the array in more than one swap operation, so the answer is "NO". | 500 | [
{
"input": "2\n1 2",
"output": "YES"
},
{
"input": "3\n3 2 1",
"output": "YES"
},
{
"input": "4\n4 3 2 1",
"output": "NO"
},
{
"input": "3\n1 3 2",
"output": "YES"
},
{
"input": "2\n2 1",
"output": "YES"
},
{
"input": "9\n7 7 8 8 10 10 10 10 1000000000",
"output": "YES"
},
{
"input": "10\n1 2 9 4 5 6 7 8 3 10",
"output": "YES"
},
{
"input": "4\n2 2 2 1",
"output": "YES"
},
{
"input": "10\n1 2 4 4 4 5 5 7 7 10",
"output": "YES"
},
{
"input": "10\n4 5 11 12 13 14 16 16 16 18",
"output": "YES"
},
{
"input": "20\n38205814 119727790 127848638 189351562 742927936 284688399 318826601 326499046 387938139 395996609 494453625 551393005 561264192 573569187 600766727 606718722 730549586 261502770 751513115 943272321",
"output": "YES"
},
{
"input": "47\n6 277 329 393 410 432 434 505 529 545 650 896 949 1053 1543 1554 1599 1648 1927 1976 1998 2141 2248 2384 2542 2638 2995 3155 3216 3355 3409 3597 3851 3940 4169 4176 4378 4378 4425 4490 4627 4986 5025 5033 5374 5453 5644",
"output": "YES"
},
{
"input": "50\n6 7 8 4 10 3 2 7 1 3 10 3 4 7 2 3 7 4 10 6 8 10 9 6 5 10 9 6 1 8 9 4 3 7 3 10 5 3 10 1 6 10 6 7 10 7 1 5 9 5",
"output": "NO"
},
{
"input": "100\n3 7 7 8 15 25 26 31 37 41 43 43 46 64 65 82 94 102 102 103 107 124 125 131 140 145 146 150 151 160 160 161 162 165 169 175 182 191 201 211 214 216 218 304 224 229 236 241 244 249 252 269 270 271 273 289 285 295 222 307 312 317 319 319 320 321 325 330 340 341 345 347 354 356 366 366 375 376 380 383 386 398 401 407 414 417 423 426 431 438 440 444 446 454 457 458 458 466 466 472",
"output": "NO"
},
{
"input": "128\n1 2 4 6 8 17 20 20 23 33 43 49 49 49 52 73 74 75 82 84 85 87 90 91 102 103 104 105 111 111 401 142 142 152 155 160 175 176 178 181 183 184 187 188 191 193 326 202 202 214 224 225 236 239 240 243 246 247 249 249 257 257 261 264 265 271 277 281 284 284 286 289 290 296 297 303 305 307 307 317 318 320 322 200 332 342 393 349 350 350 369 375 381 381 385 385 387 393 347 397 398 115 402 407 407 408 410 411 411 416 423 426 429 429 430 440 447 449 463 464 466 471 473 480 480 483 497 503",
"output": "NO"
},
{
"input": "4\n5 12 12 6",
"output": "YES"
},
{
"input": "5\n1 3 3 3 2",
"output": "YES"
},
{
"input": "4\n2 1 1 1",
"output": "YES"
},
{
"input": "2\n1 1",
"output": "YES"
},
{
"input": "4\n1000000000 1 1000000000 1",
"output": "YES"
},
{
"input": "11\n2 2 2 2 2 2 2 2 2 2 1",
"output": "YES"
},
{
"input": "6\n1 2 3 4 5 3",
"output": "NO"
},
{
"input": "9\n3 3 3 2 2 2 1 1 1",
"output": "NO"
},
{
"input": "4\n4 1 2 3",
"output": "NO"
},
{
"input": "6\n3 4 5 6 7 2",
"output": "NO"
},
{
"input": "4\n4 2 1 3",
"output": "NO"
},
{
"input": "4\n3 3 2 2",
"output": "NO"
},
{
"input": "4\n3 2 1 1",
"output": "NO"
},
{
"input": "4\n4 5 1 1",
"output": "NO"
},
{
"input": "6\n1 6 2 4 3 5",
"output": "NO"
},
{
"input": "5\n1 4 5 2 3",
"output": "NO"
},
{
"input": "4\n2 2 1 1",
"output": "NO"
},
{
"input": "5\n1 4 3 2 1",
"output": "NO"
},
{
"input": "5\n1 4 2 2 3",
"output": "NO"
},
{
"input": "6\n1 2 3 1 2 3",
"output": "NO"
},
{
"input": "3\n3 1 2",
"output": "NO"
},
{
"input": "5\n5 1 2 3 4",
"output": "NO"
},
{
"input": "5\n3 3 3 2 2",
"output": "NO"
},
{
"input": "5\n100 5 6 10 7",
"output": "NO"
},
{
"input": "3\n2 3 1",
"output": "NO"
},
{
"input": "5\n4 4 1 1 1",
"output": "NO"
},
{
"input": "5\n1 2 5 3 4",
"output": "NO"
},
{
"input": "4\n3 4 1 2",
"output": "NO"
},
{
"input": "4\n2 4 1 5",
"output": "NO"
},
{
"input": "5\n1 3 3 2 2",
"output": "NO"
},
{
"input": "5\n1 5 4 4 4",
"output": "YES"
},
{
"input": "7\n3 2 1 2 3 5 4",
"output": "NO"
},
{
"input": "5\n1 1 3 2 2",
"output": "YES"
},
{
"input": "9\n1 8 7 7 7 7 7 8 3",
"output": "YES"
},
{
"input": "5\n1 3 2 3 3",
"output": "YES"
},
{
"input": "10\n4 4 4 4 10 4 4 4 4 4",
"output": "YES"
},
{
"input": "8\n3 6 6 6 6 6 4 9",
"output": "YES"
},
{
"input": "4\n4 4 3 3",
"output": "NO"
},
{
"input": "4\n3 2 2 4",
"output": "YES"
},
{
"input": "5\n2 2 1 3 3",
"output": "YES"
},
{
"input": "5\n1 2 7 3 5",
"output": "NO"
},
{
"input": "5\n2 3 4 5 1",
"output": "NO"
},
{
"input": "6\n1 4 3 6 2 5",
"output": "NO"
},
{
"input": "5\n3 3 1 5 4",
"output": "NO"
},
{
"input": "4\n1 2 1 2",
"output": "YES"
},
{
"input": "6\n4 5 3 4 2 6",
"output": "NO"
},
{
"input": "11\n1 2 3 4 5 1 2 3 4 5 1",
"output": "NO"
},
{
"input": "6\n6 1 2 3 4 5",
"output": "NO"
},
{
"input": "5\n4 1 1 1 1",
"output": "YES"
},
{
"input": "9\n1 2 3 5 4 6 7 8 9",
"output": "YES"
},
{
"input": "6\n6 1 2 3 4 2",
"output": "NO"
},
{
"input": "6\n2 2 2 2 3 2",
"output": "YES"
},
{
"input": "3\n2 1 1",
"output": "YES"
},
{
"input": "5\n1 2 1 1 2",
"output": "YES"
},
{
"input": "5\n1 2 2 1 2",
"output": "YES"
},
{
"input": "8\n5 5 5 5 5 5 1 1",
"output": "NO"
}
] | 1,682,313,650 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 5 | 46 | 0 | n=int(input())
l=list(map(int,input().split()))
if len(l)<=3:
print('YES')
else:
c=0
l1=sorted(l)
for i,j in zip(l,l1):
if i!=j:
c+=1
if c==2:
print('YES')
else:
print('NO') | Title: Little Elephant and Problem
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Little Elephant has got a problem — somebody has been touching his sorted by non-decreasing array *a* of length *n* and possibly swapped some elements of the array.
The Little Elephant doesn't want to call the police until he understands if he could have accidentally changed the array himself. He thinks that he could have accidentally changed array *a*, only if array *a* can be sorted in no more than one operation of swapping elements (not necessarily adjacent). That is, the Little Elephant could have accidentally swapped some two elements.
Help the Little Elephant, determine if he could have accidentally changed the array *a*, sorted by non-decreasing, himself.
Input Specification:
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=105) — the size of array *a*. The next line contains *n* positive integers, separated by single spaces and not exceeding 109, — array *a*.
Note that the elements of the array are not necessarily distinct numbers.
Output Specification:
In a single line print "YES" (without the quotes) if the Little Elephant could have accidentally changed the array himself, and "NO" (without the quotes) otherwise.
Demo Input:
['2\n1 2\n', '3\n3 2 1\n', '4\n4 3 2 1\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n']
Note:
In the first sample the array has already been sorted, so to sort it, we need 0 swap operations, that is not more than 1. Thus, the answer is "YES".
In the second sample we can sort the array if we swap elements 1 and 3, so we need 1 swap operation to sort the array. Thus, the answer is "YES".
In the third sample we can't sort the array in more than one swap operation, so the answer is "NO". | ```python
n=int(input())
l=list(map(int,input().split()))
if len(l)<=3:
print('YES')
else:
c=0
l1=sorted(l)
for i,j in zip(l,l1):
if i!=j:
c+=1
if c==2:
print('YES')
else:
print('NO')
``` | 0 |
|
682 | B | Alyona and Mex | PROGRAMMING | 1,200 | [
"sortings"
] | null | null | Someone gave Alyona an array containing *n* positive integers *a*1,<=*a*2,<=...,<=*a**n*. In one operation, Alyona can choose any element of the array and decrease it, i.e. replace with any positive integer that is smaller than the current one. Alyona can repeat this operation as many times as she wants. In particular, she may not apply any operation to the array at all.
Formally, after applying some operations Alyona will get an array of *n* positive integers *b*1,<=*b*2,<=...,<=*b**n* such that 1<=≤<=*b**i*<=≤<=*a**i* for every 1<=≤<=*i*<=≤<=*n*. Your task is to determine the maximum possible value of mex of this array.
Mex of an array in this problem is the minimum positive integer that doesn't appear in this array. For example, mex of the array containing 1, 3 and 4 is equal to 2, while mex of the array containing 2, 3 and 2 is equal to 1. | The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of elements in the Alyona's array.
The second line of the input contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the elements of the array. | Print one positive integer — the maximum possible value of mex of the array after Alyona applies some (possibly none) operations. | [
"5\n1 3 3 3 6\n",
"2\n2 1\n"
] | [
"5\n",
"3\n"
] | In the first sample case if one will decrease the second element value to 2 and the fifth element value to 4 then the mex value of resulting array 1 2 3 3 4 will be equal to 5.
To reach the answer to the second sample case one must not decrease any of the array elements. | 1,000 | [
{
"input": "5\n1 3 3 3 6",
"output": "5"
},
{
"input": "2\n2 1",
"output": "3"
},
{
"input": "1\n1",
"output": "2"
},
{
"input": "1\n1000000000",
"output": "2"
},
{
"input": "1\n2",
"output": "2"
},
{
"input": "2\n1 1",
"output": "2"
},
{
"input": "2\n1 3",
"output": "3"
},
{
"input": "2\n2 2",
"output": "3"
},
{
"input": "2\n2 3",
"output": "3"
},
{
"input": "2\n3 3",
"output": "3"
},
{
"input": "3\n1 1 1",
"output": "2"
},
{
"input": "3\n2 1 1",
"output": "3"
},
{
"input": "3\n3 1 1",
"output": "3"
},
{
"input": "3\n1 1 4",
"output": "3"
},
{
"input": "3\n2 1 2",
"output": "3"
},
{
"input": "3\n3 2 1",
"output": "4"
},
{
"input": "3\n2 4 1",
"output": "4"
},
{
"input": "3\n3 3 1",
"output": "4"
},
{
"input": "3\n1 3 4",
"output": "4"
},
{
"input": "3\n4 1 4",
"output": "4"
},
{
"input": "3\n2 2 2",
"output": "3"
},
{
"input": "3\n3 2 2",
"output": "4"
},
{
"input": "3\n4 2 2",
"output": "4"
},
{
"input": "3\n2 3 3",
"output": "4"
},
{
"input": "3\n4 2 3",
"output": "4"
},
{
"input": "3\n4 4 2",
"output": "4"
},
{
"input": "3\n3 3 3",
"output": "4"
},
{
"input": "3\n4 3 3",
"output": "4"
},
{
"input": "3\n4 3 4",
"output": "4"
},
{
"input": "3\n4 4 4",
"output": "4"
},
{
"input": "4\n1 1 1 1",
"output": "2"
},
{
"input": "4\n1 1 2 1",
"output": "3"
},
{
"input": "4\n1 1 3 1",
"output": "3"
},
{
"input": "4\n1 4 1 1",
"output": "3"
},
{
"input": "4\n1 2 1 2",
"output": "3"
},
{
"input": "4\n1 3 2 1",
"output": "4"
},
{
"input": "4\n2 1 4 1",
"output": "4"
},
{
"input": "4\n3 3 1 1",
"output": "4"
},
{
"input": "4\n1 3 4 1",
"output": "4"
},
{
"input": "4\n1 1 4 4",
"output": "4"
},
{
"input": "4\n2 2 2 1",
"output": "3"
},
{
"input": "4\n1 2 2 3",
"output": "4"
},
{
"input": "4\n2 4 1 2",
"output": "4"
},
{
"input": "4\n3 3 1 2",
"output": "4"
},
{
"input": "4\n2 3 4 1",
"output": "5"
},
{
"input": "4\n1 4 2 4",
"output": "5"
},
{
"input": "4\n3 1 3 3",
"output": "4"
},
{
"input": "4\n3 4 3 1",
"output": "5"
},
{
"input": "4\n1 4 4 3",
"output": "5"
},
{
"input": "4\n4 1 4 4",
"output": "5"
},
{
"input": "4\n2 2 2 2",
"output": "3"
},
{
"input": "4\n2 2 3 2",
"output": "4"
},
{
"input": "4\n2 2 2 4",
"output": "4"
},
{
"input": "4\n2 2 3 3",
"output": "4"
},
{
"input": "4\n2 2 3 4",
"output": "5"
},
{
"input": "4\n2 4 4 2",
"output": "5"
},
{
"input": "4\n2 3 3 3",
"output": "4"
},
{
"input": "4\n2 4 3 3",
"output": "5"
},
{
"input": "4\n4 4 2 3",
"output": "5"
},
{
"input": "4\n4 4 4 2",
"output": "5"
},
{
"input": "4\n3 3 3 3",
"output": "4"
},
{
"input": "4\n3 3 3 4",
"output": "5"
},
{
"input": "4\n4 3 3 4",
"output": "5"
},
{
"input": "4\n4 4 3 4",
"output": "5"
},
{
"input": "4\n4 4 4 4",
"output": "5"
},
{
"input": "11\n1 1 1 1 1 1 1 1 1 3 3",
"output": "4"
},
{
"input": "20\n1 1 1 1 1 1 1 1 1 1 8 8 8 8 8 8 8 8 8 8",
"output": "9"
},
{
"input": "4\n2 2 2 3",
"output": "4"
},
{
"input": "3\n1 1 2",
"output": "3"
},
{
"input": "15\n1 2 2 20 23 25 28 60 66 71 76 77 79 99 100",
"output": "15"
},
{
"input": "7\n1 2 2 2 5 5 1",
"output": "5"
},
{
"input": "4\n1 1 1 2",
"output": "3"
},
{
"input": "5\n1 1 1 1 10000",
"output": "3"
},
{
"input": "5\n1 1 1 1 2",
"output": "3"
},
{
"input": "7\n1 3 3 3 3 3 6",
"output": "5"
},
{
"input": "4\n1 1 1 3",
"output": "3"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1 100",
"output": "3"
},
{
"input": "4\n1 1 2 2",
"output": "3"
},
{
"input": "5\n1 1 1 3 4",
"output": "4"
},
{
"input": "8\n1 1 1 1 2 2 3 40",
"output": "5"
},
{
"input": "5\n1 1 1 1 1",
"output": "2"
},
{
"input": "7\n1 2 2 2 2 2 4",
"output": "4"
},
{
"input": "10\n1 1 1 10000000 10000000 10000000 10000000 10000000 10000000 10000000",
"output": "9"
},
{
"input": "10\n1 1 1 1 1 1 1 1 2 3",
"output": "4"
},
{
"input": "4\n8 8 8 8",
"output": "5"
},
{
"input": "5\n5 6 6 6 7",
"output": "6"
}
] | 1,559,129,705 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 1 | 93 | 0 | n = int(input())
a = list(map(int , input().split()))
a.sort()
c = 1
for i in range(n):
if c < n:
c+=1
print(c) | Title: Alyona and Mex
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Someone gave Alyona an array containing *n* positive integers *a*1,<=*a*2,<=...,<=*a**n*. In one operation, Alyona can choose any element of the array and decrease it, i.e. replace with any positive integer that is smaller than the current one. Alyona can repeat this operation as many times as she wants. In particular, she may not apply any operation to the array at all.
Formally, after applying some operations Alyona will get an array of *n* positive integers *b*1,<=*b*2,<=...,<=*b**n* such that 1<=≤<=*b**i*<=≤<=*a**i* for every 1<=≤<=*i*<=≤<=*n*. Your task is to determine the maximum possible value of mex of this array.
Mex of an array in this problem is the minimum positive integer that doesn't appear in this array. For example, mex of the array containing 1, 3 and 4 is equal to 2, while mex of the array containing 2, 3 and 2 is equal to 1.
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of elements in the Alyona's array.
The second line of the input contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the elements of the array.
Output Specification:
Print one positive integer — the maximum possible value of mex of the array after Alyona applies some (possibly none) operations.
Demo Input:
['5\n1 3 3 3 6\n', '2\n2 1\n']
Demo Output:
['5\n', '3\n']
Note:
In the first sample case if one will decrease the second element value to 2 and the fifth element value to 4 then the mex value of resulting array 1 2 3 3 4 will be equal to 5.
To reach the answer to the second sample case one must not decrease any of the array elements. | ```python
n = int(input())
a = list(map(int , input().split()))
a.sort()
c = 1
for i in range(n):
if c < n:
c+=1
print(c)
``` | 0 |
|
884 | A | Book Reading | PROGRAMMING | 800 | [
"implementation"
] | null | null | Recently Luba bought a very interesting book. She knows that it will take *t* seconds to read the book. Luba wants to finish reading as fast as she can.
But she has some work to do in each of *n* next days. The number of seconds that Luba has to spend working during *i*-th day is *a**i*. If some free time remains, she can spend it on reading.
Help Luba to determine the minimum number of day when she finishes reading.
It is guaranteed that the answer doesn't exceed *n*.
Remember that there are 86400 seconds in a day. | The first line contains two integers *n* and *t* (1<=≤<=*n*<=≤<=100, 1<=≤<=*t*<=≤<=106) — the number of days and the time required to read the book.
The second line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=86400) — the time Luba has to spend on her work during *i*-th day. | Print the minimum day Luba can finish reading the book.
It is guaranteed that answer doesn't exceed *n*. | [
"2 2\n86400 86398\n",
"2 86400\n0 86400\n"
] | [
"2\n",
"1\n"
] | none | 0 | [
{
"input": "2 2\n86400 86398",
"output": "2"
},
{
"input": "2 86400\n0 86400",
"output": "1"
},
{
"input": "2 86400\n1 86399",
"output": "2"
},
{
"input": "100 1000000\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "12"
},
{
"input": "1 1\n86399",
"output": "1"
},
{
"input": "6 1200\n86400 86400 86000 86000 86000 86400",
"output": "5"
},
{
"input": "6 1200\n86400 86400 86000 86000 86001 86399",
"output": "6"
},
{
"input": "4 172799\n1 1 86400 0",
"output": "4"
},
{
"input": "4 172799\n0 86400 86399 0",
"output": "4"
},
{
"input": "6 1\n1 1 86400 1 86399 1",
"output": "1"
},
{
"input": "4 1\n86400 86399 86400 86400",
"output": "2"
},
{
"input": "4 1\n86400 86400 0 86400",
"output": "3"
}
] | 1,509,113,739 | 639 | Python 3 | OK | TESTS | 16 | 61 | 0 | a=input().split(' ')
n=int(a[0])
t=int(a[1])
a=input().split(' ')
a=[int(i) for i in a]
for i in range(n):
if t<=0:
print(i)
break
t=t-(86400-a[i])
else:
print(n)
| Title: Book Reading
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently Luba bought a very interesting book. She knows that it will take *t* seconds to read the book. Luba wants to finish reading as fast as she can.
But she has some work to do in each of *n* next days. The number of seconds that Luba has to spend working during *i*-th day is *a**i*. If some free time remains, she can spend it on reading.
Help Luba to determine the minimum number of day when she finishes reading.
It is guaranteed that the answer doesn't exceed *n*.
Remember that there are 86400 seconds in a day.
Input Specification:
The first line contains two integers *n* and *t* (1<=≤<=*n*<=≤<=100, 1<=≤<=*t*<=≤<=106) — the number of days and the time required to read the book.
The second line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=86400) — the time Luba has to spend on her work during *i*-th day.
Output Specification:
Print the minimum day Luba can finish reading the book.
It is guaranteed that answer doesn't exceed *n*.
Demo Input:
['2 2\n86400 86398\n', '2 86400\n0 86400\n']
Demo Output:
['2\n', '1\n']
Note:
none | ```python
a=input().split(' ')
n=int(a[0])
t=int(a[1])
a=input().split(' ')
a=[int(i) for i in a]
for i in range(n):
if t<=0:
print(i)
break
t=t-(86400-a[i])
else:
print(n)
``` | 3 |
|
855 | A | Tom Riddle's Diary | PROGRAMMING | 800 | [
"brute force",
"implementation",
"strings"
] | null | null | Harry Potter is on a mission to destroy You-Know-Who's Horcruxes. The first Horcrux that he encountered in the Chamber of Secrets is Tom Riddle's diary. The diary was with Ginny and it forced her to open the Chamber of Secrets. Harry wants to know the different people who had ever possessed the diary to make sure they are not under its influence.
He has names of *n* people who possessed the diary in order. You need to tell, for each person, if he/she possessed the diary at some point before or not.
Formally, for a name *s**i* in the *i*-th line, output "YES" (without quotes) if there exists an index *j* such that *s**i*<==<=*s**j* and *j*<=<<=*i*, otherwise, output "NO" (without quotes). | First line of input contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of names in the list.
Next *n* lines each contain a string *s**i*, consisting of lowercase English letters. The length of each string is between 1 and 100. | Output *n* lines each containing either "YES" or "NO" (without quotes), depending on whether this string was already present in the stream or not.
You can print each letter in any case (upper or lower). | [
"6\ntom\nlucius\nginny\nharry\nginny\nharry\n",
"3\na\na\na\n"
] | [
"NO\nNO\nNO\nNO\nYES\nYES\n",
"NO\nYES\nYES\n"
] | In test case 1, for *i* = 5 there exists *j* = 3 such that *s*<sub class="lower-index">*i*</sub> = *s*<sub class="lower-index">*j*</sub> and *j* < *i*, which means that answer for *i* = 5 is "YES". | 500 | [
{
"input": "6\ntom\nlucius\nginny\nharry\nginny\nharry",
"output": "NO\nNO\nNO\nNO\nYES\nYES"
},
{
"input": "3\na\na\na",
"output": "NO\nYES\nYES"
},
{
"input": "1\nzn",
"output": "NO"
},
{
"input": "9\nliyzmbjwnzryjokufuxcqtzwworjeoxkbaqrujrhdidqdvwdfzilwszgnzglnnbogaclckfnbqovtziuhwvyrqwmskx\nliyzmbjwnzryjokufuxcqtzwworjeoxkbaqrujrhdidqdvwdfzilwszgnzglnnbogaclckfnbqovtziuhwvyrqwmskx\nliyzmbjwnzryjokufuxcqtzwworjeoxkbaqrujrhdidqdvwdfzilwszgnzglnnbogaclckfnbqovtziuhwvyrqwmskx\nhrtm\nssjqvixduertmotgagizamvfucfwtxqnhuowbqbzctgznivehelpcyigwrbbdsxnewfqvcf\nhyrtxvozpbveexfkgalmguozzakitjiwsduqxonb\nwcyxteiwtcyuztaguilqpbiwcwjaiq\nwcyxteiwtcyuztaguilqpbiwcwjaiq\nbdbivqzvhggth",
"output": "NO\nYES\nYES\nNO\nNO\nNO\nNO\nYES\nNO"
},
{
"input": "10\nkkiubdktydpdcbbttwpfdplhhjhrpqmpg\nkkiubdktydpdcbbttwpfdplhhjhrpqmpg\nmvutw\nqooeqoxzxwetlpecqiwgdbogiqqulttysyohwhzxzphvsfmnplizxoebzcvvfyppqbhxjksuzepuezqqzxlfmdanoeaoqmor\nmvutw\nvchawxjoreboqzuklifv\nvchawxjoreboqzuklifv\nnivijte\nrflybruq\nvchawxjoreboqzuklifv",
"output": "NO\nYES\nNO\nNO\nYES\nNO\nYES\nNO\nNO\nYES"
},
{
"input": "1\nz",
"output": "NO"
},
{
"input": "9\nl\ny\nm\nj\nn\nr\nj\nk\nf",
"output": "NO\nNO\nNO\nNO\nNO\nNO\nYES\nNO\nNO"
},
{
"input": "14\nw\na\nh\np\nk\nw\ny\nv\ns\nf\nx\nd\nk\nr",
"output": "NO\nNO\nNO\nNO\nNO\nYES\nNO\nNO\nNO\nNO\nNO\nNO\nYES\nNO"
},
{
"input": "25\np\nk\nu\nl\nf\nt\nc\ns\nq\nd\nb\nq\no\ni\ni\nd\ni\nw\nn\ng\nw\nt\na\ne\ni",
"output": "NO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nYES\nNO\nNO\nYES\nYES\nYES\nNO\nNO\nNO\nYES\nYES\nNO\nNO\nYES"
},
{
"input": "20\nd\nh\ng\no\np\ne\nt\nj\nv\ni\nt\nh\ns\ni\nw\nf\nx\na\nl\ni",
"output": "NO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nNO\nYES\nYES\nNO\nYES\nNO\nNO\nNO\nNO\nNO\nYES"
},
{
"input": "3\nbbbbbbb\nbbbbbbbbb\nbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "NO\nNO\nNO"
},
{
"input": "2\nab\nba",
"output": "NO\nNO"
},
{
"input": "6\ntom\nlucius\nginnys\nharpy\nginny\nharry",
"output": "NO\nNO\nNO\nNO\nNO\nNO"
},
{
"input": "2\nabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcde\nabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcdeabcde",
"output": "NO\nYES"
},
{
"input": "42\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na",
"output": "NO\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES\nYES"
}
] | 1,692,610,152 | 2,147,483,647 | Python 3 | OK | TESTS | 55 | 46 | 0 | #all those moments will be lost in time , like tears in rain "D
a=[]
n=int(input())
for _ in range(n):
b=input()
if b in a:
print('YES')
else:
print('NO')
a.append(b); | Title: Tom Riddle's Diary
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Harry Potter is on a mission to destroy You-Know-Who's Horcruxes. The first Horcrux that he encountered in the Chamber of Secrets is Tom Riddle's diary. The diary was with Ginny and it forced her to open the Chamber of Secrets. Harry wants to know the different people who had ever possessed the diary to make sure they are not under its influence.
He has names of *n* people who possessed the diary in order. You need to tell, for each person, if he/she possessed the diary at some point before or not.
Formally, for a name *s**i* in the *i*-th line, output "YES" (without quotes) if there exists an index *j* such that *s**i*<==<=*s**j* and *j*<=<<=*i*, otherwise, output "NO" (without quotes).
Input Specification:
First line of input contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of names in the list.
Next *n* lines each contain a string *s**i*, consisting of lowercase English letters. The length of each string is between 1 and 100.
Output Specification:
Output *n* lines each containing either "YES" or "NO" (without quotes), depending on whether this string was already present in the stream or not.
You can print each letter in any case (upper or lower).
Demo Input:
['6\ntom\nlucius\nginny\nharry\nginny\nharry\n', '3\na\na\na\n']
Demo Output:
['NO\nNO\nNO\nNO\nYES\nYES\n', 'NO\nYES\nYES\n']
Note:
In test case 1, for *i* = 5 there exists *j* = 3 such that *s*<sub class="lower-index">*i*</sub> = *s*<sub class="lower-index">*j*</sub> and *j* < *i*, which means that answer for *i* = 5 is "YES". | ```python
#all those moments will be lost in time , like tears in rain "D
a=[]
n=int(input())
for _ in range(n):
b=input()
if b in a:
print('YES')
else:
print('NO')
a.append(b);
``` | 3 |
|
967 | B | Watering System | PROGRAMMING | 1,000 | [
"math",
"sortings"
] | null | null | Arkady wants to water his only flower. Unfortunately, he has a very poor watering system that was designed for $n$ flowers and so it looks like a pipe with $n$ holes. Arkady can only use the water that flows from the first hole.
Arkady can block some of the holes, and then pour $A$ liters of water into the pipe. After that, the water will flow out from the non-blocked holes proportionally to their sizes $s_1, s_2, \ldots, s_n$. In other words, if the sum of sizes of non-blocked holes is $S$, and the $i$-th hole is not blocked, $\frac{s_i \cdot A}{S}$ liters of water will flow out of it.
What is the minimum number of holes Arkady should block to make at least $B$ liters of water flow out of the first hole? | The first line contains three integers $n$, $A$, $B$ ($1 \le n \le 100\,000$, $1 \le B \le A \le 10^4$) — the number of holes, the volume of water Arkady will pour into the system, and the volume he wants to get out of the first hole.
The second line contains $n$ integers $s_1, s_2, \ldots, s_n$ ($1 \le s_i \le 10^4$) — the sizes of the holes. | Print a single integer — the number of holes Arkady should block. | [
"4 10 3\n2 2 2 2\n",
"4 80 20\n3 2 1 4\n",
"5 10 10\n1000 1 1 1 1\n"
] | [
"1\n",
"0\n",
"4\n"
] | In the first example Arkady should block at least one hole. After that, $\frac{10 \cdot 2}{6} \approx 3.333$ liters of water will flow out of the first hole, and that suits Arkady.
In the second example even without blocking any hole, $\frac{80 \cdot 3}{10} = 24$ liters will flow out of the first hole, that is not less than $20$.
In the third example Arkady has to block all holes except the first to make all water flow out of the first hole. | 1,000 | [
{
"input": "4 10 3\n2 2 2 2",
"output": "1"
},
{
"input": "4 80 20\n3 2 1 4",
"output": "0"
},
{
"input": "5 10 10\n1000 1 1 1 1",
"output": "4"
},
{
"input": "10 300 100\n20 1 3 10 8 5 3 6 4 3",
"output": "1"
},
{
"input": "10 300 100\n20 25 68 40 60 37 44 85 23 96",
"output": "8"
},
{
"input": "1 1 1\n1",
"output": "0"
},
{
"input": "1 2 1\n1",
"output": "0"
},
{
"input": "2 2 2\n1 10000",
"output": "1"
},
{
"input": "2 10000 1\n1 9999",
"output": "0"
}
] | 1,618,250,609 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 8 | 1,000 | 6,348,800 | n,a,b=map(int,input().split())
l=list(map(int,input().split()))
l1=l[1:]
l1.sort()
while (a*l[0])/(sum(l1)+l[0])<b :
l1.pop()
print(n-len(l1)-1) | Title: Watering System
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Arkady wants to water his only flower. Unfortunately, he has a very poor watering system that was designed for $n$ flowers and so it looks like a pipe with $n$ holes. Arkady can only use the water that flows from the first hole.
Arkady can block some of the holes, and then pour $A$ liters of water into the pipe. After that, the water will flow out from the non-blocked holes proportionally to their sizes $s_1, s_2, \ldots, s_n$. In other words, if the sum of sizes of non-blocked holes is $S$, and the $i$-th hole is not blocked, $\frac{s_i \cdot A}{S}$ liters of water will flow out of it.
What is the minimum number of holes Arkady should block to make at least $B$ liters of water flow out of the first hole?
Input Specification:
The first line contains three integers $n$, $A$, $B$ ($1 \le n \le 100\,000$, $1 \le B \le A \le 10^4$) — the number of holes, the volume of water Arkady will pour into the system, and the volume he wants to get out of the first hole.
The second line contains $n$ integers $s_1, s_2, \ldots, s_n$ ($1 \le s_i \le 10^4$) — the sizes of the holes.
Output Specification:
Print a single integer — the number of holes Arkady should block.
Demo Input:
['4 10 3\n2 2 2 2\n', '4 80 20\n3 2 1 4\n', '5 10 10\n1000 1 1 1 1\n']
Demo Output:
['1\n', '0\n', '4\n']
Note:
In the first example Arkady should block at least one hole. After that, $\frac{10 \cdot 2}{6} \approx 3.333$ liters of water will flow out of the first hole, and that suits Arkady.
In the second example even without blocking any hole, $\frac{80 \cdot 3}{10} = 24$ liters will flow out of the first hole, that is not less than $20$.
In the third example Arkady has to block all holes except the first to make all water flow out of the first hole. | ```python
n,a,b=map(int,input().split())
l=list(map(int,input().split()))
l1=l[1:]
l1.sort()
while (a*l[0])/(sum(l1)+l[0])<b :
l1.pop()
print(n-len(l1)-1)
``` | 0 |
|
0 | none | none | none | 0 | [
"none"
] | null | null | On the way to school, Karen became fixated on the puzzle game on her phone!
The game is played as follows. In each level, you have a grid with *n* rows and *m* columns. Each cell originally contains the number 0.
One move consists of choosing one row or column, and adding 1 to all of the cells in that row or column.
To win the level, after all the moves, the number in the cell at the *i*-th row and *j*-th column should be equal to *g**i*,<=*j*.
Karen is stuck on one level, and wants to know a way to beat this level using the minimum number of moves. Please, help her with this task! | The first line of input contains two integers, *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100), the number of rows and the number of columns in the grid, respectively.
The next *n* lines each contain *m* integers. In particular, the *j*-th integer in the *i*-th of these rows contains *g**i*,<=*j* (0<=≤<=*g**i*,<=*j*<=≤<=500). | If there is an error and it is actually not possible to beat the level, output a single integer -1.
Otherwise, on the first line, output a single integer *k*, the minimum number of moves necessary to beat the level.
The next *k* lines should each contain one of the following, describing the moves in the order they must be done:
- row *x*, (1<=≤<=*x*<=≤<=*n*) describing a move of the form "choose the *x*-th row". - col *x*, (1<=≤<=*x*<=≤<=*m*) describing a move of the form "choose the *x*-th column".
If there are multiple optimal solutions, output any one of them. | [
"3 5\n2 2 2 3 2\n0 0 0 1 0\n1 1 1 2 1\n",
"3 3\n0 0 0\n0 1 0\n0 0 0\n",
"3 3\n1 1 1\n1 1 1\n1 1 1\n"
] | [
"4\nrow 1\nrow 1\ncol 4\nrow 3\n",
"-1\n",
"3\nrow 1\nrow 2\nrow 3\n"
] | In the first test case, Karen has a grid with 3 rows and 5 columns. She can perform the following 4 moves to beat the level:
In the second test case, Karen has a grid with 3 rows and 3 columns. It is clear that it is impossible to beat the level; performing any move will create three 1s on the grid, but it is required to only have one 1 in the center.
In the third test case, Karen has a grid with 3 rows and 3 columns. She can perform the following 3 moves to beat the level:
Note that this is not the only solution; another solution, among others, is col 1, col 2, col 3. | 0 | [
{
"input": "3 5\n2 2 2 3 2\n0 0 0 1 0\n1 1 1 2 1",
"output": "4\nrow 1\nrow 1\ncol 4\nrow 3"
},
{
"input": "3 3\n0 0 0\n0 1 0\n0 0 0",
"output": "-1"
},
{
"input": "3 3\n1 1 1\n1 1 1\n1 1 1",
"output": "3\nrow 1\nrow 2\nrow 3"
},
{
"input": "3 5\n2 4 2 2 3\n0 2 0 0 1\n1 3 1 1 2",
"output": "6\nrow 1\nrow 1\ncol 2\ncol 2\ncol 5\nrow 3"
},
{
"input": "3 5\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1",
"output": "-1"
},
{
"input": "9 10\n14 5 6 4 8 9 4 14 14 13\n13 4 5 3 7 8 3 13 13 12\n16 7 8 6 10 11 6 16 16 15\n10 1 2 0 4 5 0 10 10 9\n11 2 3 1 5 6 1 11 11 10\n10 1 2 0 4 5 0 10 10 9\n12 3 4 2 6 7 2 12 12 11\n13 4 5 3 7 8 3 13 13 12\n13 4 5 3 7 8 3 13 13 12",
"output": "73\nrow 1\nrow 1\nrow 1\nrow 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 2\ncol 3\ncol 3\ncol 5\ncol 5\ncol 5\ncol 5\ncol 6\ncol 6\ncol 6\ncol 6\ncol 6\ncol 8\ncol 8\ncol 8\ncol 8\ncol 8\ncol 8\ncol 8\ncol 8\ncol 8\ncol 8\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 10\ncol 10\ncol 10\ncol 10\ncol 10\ncol 10\ncol 10\ncol 10\ncol 10\nrow 2\nrow 2\nrow 2\nrow 3\nrow 3\nrow 3\nrow 3\nrow 3\nrow 3\nrow 5\nrow 7\nrow 7\nrow 8\nrow 8\nrow 8\nrow 9\nr..."
},
{
"input": "10 10\n30 30 30 33 30 33 30 33 30 33\n431 431 431 434 431 434 431 434 431 434\n19 19 19 22 19 22 19 22 19 22\n24 24 24 27 24 27 24 27 24 27\n5 5 5 8 5 8 5 8 5 8\n0 0 0 3 0 3 0 3 0 3\n0 0 0 3 0 3 0 3 0 3\n0 0 0 3 0 3 0 3 0 3\n0 0 0 3 0 3 0 3 0 3\n0 0 0 3 0 3 0 3 0 3",
"output": "521\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\ncol 4\ncol 4\ncol 4\ncol 6\ncol 6\ncol 6\ncol 8\ncol 8\ncol 8\ncol 10\ncol 10\ncol 10\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\n..."
},
{
"input": "1 1\n0",
"output": "0"
},
{
"input": "1 1\n500",
"output": "500\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nro..."
},
{
"input": "10 10\n1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1\n0 0 0 0 0 0 0 0 0 0\n1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1",
"output": "9\nrow 1\nrow 2\nrow 3\nrow 4\nrow 6\nrow 7\nrow 8\nrow 9\nrow 10"
},
{
"input": "10 10\n1 1 1 1 1 1 0 1 1 1\n1 1 1 1 1 1 0 1 1 1\n1 1 1 1 1 1 0 1 1 1\n1 1 1 1 1 1 0 1 1 1\n1 1 1 1 1 1 0 1 1 1\n1 1 1 1 1 1 0 1 1 1\n1 1 1 1 1 1 0 1 1 1\n1 1 1 1 1 1 0 1 1 1\n1 1 1 1 1 1 0 1 1 1\n1 1 1 1 1 1 0 1 1 1",
"output": "9\ncol 1\ncol 2\ncol 3\ncol 4\ncol 5\ncol 6\ncol 8\ncol 9\ncol 10"
},
{
"input": "10 11\n8 7 10 15 5 13 12 9 14 11 6\n6 5 8 13 3 11 10 7 12 9 4\n10 9 12 17 7 15 14 11 16 13 8\n9 8 11 16 6 14 13 10 15 12 7\n12 11 14 19 9 17 16 13 18 15 10\n14 13 16 21 11 19 18 15 20 17 12\n7 6 9 14 4 12 11 8 13 10 5\n5 4 7 12 2 10 9 6 11 8 3\n11 10 13 18 8 16 15 12 17 14 9\n13 12 15 20 10 18 17 14 19 16 11",
"output": "120\nrow 1\nrow 2\nrow 3\nrow 4\nrow 5\nrow 6\nrow 7\nrow 8\nrow 9\nrow 10\nrow 1\nrow 2\nrow 3\nrow 4\nrow 5\nrow 6\nrow 7\nrow 8\nrow 9\nrow 10\nrow 1\nrow 1\nrow 1\ncol 1\ncol 1\ncol 1\ncol 2\ncol 2\ncol 3\ncol 3\ncol 3\ncol 3\ncol 3\ncol 4\ncol 4\ncol 4\ncol 4\ncol 4\ncol 4\ncol 4\ncol 4\ncol 4\ncol 4\ncol 6\ncol 6\ncol 6\ncol 6\ncol 6\ncol 6\ncol 6\ncol 6\ncol 7\ncol 7\ncol 7\ncol 7\ncol 7\ncol 7\ncol 7\ncol 8\ncol 8\ncol 8\ncol 8\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 9\ncol 10\n..."
},
{
"input": "5 3\n2 2 2\n2 2 2\n2 2 2\n1 1 1\n2 2 2",
"output": "7\ncol 1\ncol 2\ncol 3\nrow 1\nrow 2\nrow 3\nrow 5"
},
{
"input": "3 5\n2 2 2 1 2\n2 2 2 1 2\n2 2 2 1 2",
"output": "7\nrow 1\nrow 2\nrow 3\ncol 1\ncol 2\ncol 3\ncol 5"
},
{
"input": "1 100\n396 314 350 362 287 349 266 289 297 305 235 226 256 385 302 304 253 192 298 238 360 366 163 340 247 395 318 260 252 281 178 188 252 379 212 187 354 232 225 159 290 335 387 234 383 215 356 182 323 280 195 209 263 215 322 262 334 157 189 214 195 386 220 209 177 193 368 174 270 329 388 237 260 343 230 173 254 371 327 266 193 178 161 209 335 310 323 323 353 172 368 307 329 234 363 264 334 266 305 209",
"output": "11960\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\n..."
},
{
"input": "100 1\n173\n164\n99\n114\n255\n223\n280\n235\n207\n190\n136\n204\n206\n282\n253\n335\n267\n184\n288\n299\n263\n243\n341\n111\n278\n111\n214\n133\n125\n245\n99\n144\n232\n203\n131\n204\n117\n315\n269\n206\n262\n125\n212\n95\n220\n243\n141\n163\n311\n171\n222\n266\n141\n314\n329\n138\n187\n342\n272\n181\n300\n261\n339\n110\n194\n187\n183\n129\n151\n187\n129\n185\n322\n167\n99\n340\n285\n99\n176\n175\n272\n126\n220\n164\n237\n214\n96\n162\n129\n141\n144\n135\n172\n191\n155\n333\n186\n324\n237\n318",
"output": "11282\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\n..."
},
{
"input": "1 100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "100 1\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0",
"output": "0"
},
{
"input": "1 100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "1\nrow 1"
},
{
"input": "100 1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1",
"output": "1\ncol 1"
},
{
"input": "1 100\n500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500 500",
"output": "500\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nro..."
},
{
"input": "100 1\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500\n500",
"output": "500\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\nco..."
},
{
"input": "2 1\n1\n1",
"output": "1\ncol 1"
},
{
"input": "4 3\n1 1 1\n1 1 1\n1 1 1\n1 1 1",
"output": "3\ncol 1\ncol 2\ncol 3"
},
{
"input": "2 1\n2\n2",
"output": "2\ncol 1\ncol 1"
},
{
"input": "3 2\n1 1\n1 1\n1 1",
"output": "2\ncol 1\ncol 2"
},
{
"input": "2 1\n1\n2",
"output": "2\ncol 1\nrow 2"
},
{
"input": "2 3\n1 1 1\n1 1 1",
"output": "2\nrow 1\nrow 2"
},
{
"input": "1 2\n1 1",
"output": "1\nrow 1"
},
{
"input": "5 1\n1\n1\n1\n1\n1",
"output": "1\ncol 1"
},
{
"input": "10 3\n101 201 301\n102 202 302\n103 203 303\n104 204 304\n105 205 305\n106 206 306\n107 207 307\n108 208 308\n109 209 309\n111 211 311",
"output": "649\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\nco..."
},
{
"input": "2 1\n10\n10",
"output": "10\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1"
},
{
"input": "4 3\n2 2 2\n2 2 2\n2 2 2\n2 2 2",
"output": "6\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3"
},
{
"input": "3 1\n1\n1\n1",
"output": "1\ncol 1"
},
{
"input": "8 2\n2 2\n2 2\n2 2\n2 2\n2 2\n2 2\n2 2\n2 2",
"output": "4\ncol 1\ncol 2\ncol 1\ncol 2"
},
{
"input": "1 2\n2 2",
"output": "2\nrow 1\nrow 1"
},
{
"input": "3 2\n2 3\n2 3\n2 3",
"output": "5\ncol 1\ncol 2\ncol 1\ncol 2\ncol 2"
},
{
"input": "2 1\n3\n3",
"output": "3\ncol 1\ncol 1\ncol 1"
},
{
"input": "6 2\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "2\ncol 1\ncol 2"
},
{
"input": "4 1\n1\n1\n1\n1",
"output": "1\ncol 1"
},
{
"input": "2 5\n1 1 1 1 1\n1 1 1 1 1",
"output": "2\nrow 1\nrow 2"
},
{
"input": "3 1\n500\n500\n500",
"output": "500\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\nco..."
},
{
"input": "5 2\n1 1\n2 2\n2 2\n2 2\n2 2",
"output": "6\ncol 1\ncol 2\nrow 2\nrow 3\nrow 4\nrow 5"
},
{
"input": "4 3\n3 3 3\n3 3 3\n3 3 3\n3 3 3",
"output": "9\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3"
},
{
"input": "5 2\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "2\ncol 1\ncol 2"
},
{
"input": "1 4\n1 1 1 1",
"output": "1\nrow 1"
},
{
"input": "3 1\n2\n3\n2",
"output": "3\ncol 1\ncol 1\nrow 2"
},
{
"input": "1 5\n1 1 1 1 1",
"output": "1\nrow 1"
},
{
"input": "2 4\n3 1 1 1\n3 1 1 1",
"output": "4\nrow 1\nrow 2\ncol 1\ncol 1"
},
{
"input": "3 3\n1 1 1\n0 1 0\n0 0 0",
"output": "-1"
},
{
"input": "3 2\n2 2\n1 1\n2 2",
"output": "4\ncol 1\ncol 2\nrow 1\nrow 3"
},
{
"input": "2 1\n9\n9",
"output": "9\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1"
},
{
"input": "1 7\n3 3 3 3 3 3 3",
"output": "3\nrow 1\nrow 1\nrow 1"
},
{
"input": "5 2\n3 3\n3 3\n3 3\n3 3\n3 3",
"output": "6\ncol 1\ncol 2\ncol 1\ncol 2\ncol 1\ncol 2"
},
{
"input": "10 11\n250 198 192 182 85 239 295 91 318 216 249\n290 238 232 222 125 279 335 131 358 256 289\n409 357 351 341 244 398 454 250 477 375 408\n362 310 304 294 197 351 407 203 430 328 361\n352 300 294 284 187 341 397 193 420 318 351\n409 357 351 341 244 398 454 250 477 375 408\n209 157 151 141 44 198 254 50 277 175 208\n313 261 255 245 148 302 358 154 381 279 312\n171 119 113 103 6 160 216 12 239 137 170\n275 223 217 207 110 264 320 116 343 241 274",
"output": "2770\nrow 1\nrow 2\nrow 3\nrow 4\nrow 5\nrow 6\nrow 7\nrow 8\nrow 9\nrow 10\nrow 1\nrow 2\nrow 3\nrow 4\nrow 5\nrow 6\nrow 7\nrow 8\nrow 9\nrow 10\nrow 1\nrow 2\nrow 3\nrow 4\nrow 5\nrow 6\nrow 7\nrow 8\nrow 9\nrow 10\nrow 1\nrow 2\nrow 3\nrow 4\nrow 5\nrow 6\nrow 7\nrow 8\nrow 9\nrow 10\nrow 1\nrow 2\nrow 3\nrow 4\nrow 5\nrow 6\nrow 7\nrow 8\nrow 9\nrow 10\nrow 1\nrow 2\nrow 3\nrow 4\nrow 5\nrow 6\nrow 7\nrow 8\nrow 9\nrow 10\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nro..."
},
{
"input": "7 1\n1\n1\n1\n1\n1\n1\n1",
"output": "1\ncol 1"
},
{
"input": "5 3\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1",
"output": "3\ncol 1\ncol 2\ncol 3"
},
{
"input": "5 3\n3 3 3\n3 3 3\n3 3 3\n3 3 3\n3 3 3",
"output": "9\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3"
},
{
"input": "2 1\n4\n5",
"output": "5\ncol 1\ncol 1\ncol 1\ncol 1\nrow 2"
},
{
"input": "4 2\n3 3\n3 3\n3 3\n3 3",
"output": "6\ncol 1\ncol 2\ncol 1\ncol 2\ncol 1\ncol 2"
},
{
"input": "6 3\n2 2 2\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1",
"output": "4\ncol 1\ncol 2\ncol 3\nrow 1"
},
{
"input": "5 1\n1\n2\n3\n4\n5",
"output": "11\ncol 1\nrow 2\nrow 3\nrow 3\nrow 4\nrow 4\nrow 4\nrow 5\nrow 5\nrow 5\nrow 5"
},
{
"input": "2 1\n1\n3",
"output": "3\ncol 1\nrow 2\nrow 2"
},
{
"input": "3 2\n1 500\n1 500\n1 500",
"output": "501\ncol 1\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\nco..."
},
{
"input": "10 1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1",
"output": "1\ncol 1"
},
{
"input": "6 2\n2 2\n2 2\n2 2\n2 2\n2 2\n2 2",
"output": "4\ncol 1\ncol 2\ncol 1\ncol 2"
},
{
"input": "3 5\n1 1 1 1 1\n1 1 1 1 1\n1 1 1 1 1",
"output": "3\nrow 1\nrow 2\nrow 3"
},
{
"input": "2 3\n2 1 2\n2 1 2",
"output": "4\nrow 1\nrow 2\ncol 1\ncol 3"
},
{
"input": "5 2\n2 2\n2 2\n2 2\n2 2\n2 2",
"output": "4\ncol 1\ncol 2\ncol 1\ncol 2"
},
{
"input": "1 2\n1 3",
"output": "3\nrow 1\ncol 2\ncol 2"
},
{
"input": "4 3\n2 2 2\n1 1 1\n1 1 1\n1 1 1",
"output": "4\ncol 1\ncol 2\ncol 3\nrow 1"
},
{
"input": "3 2\n1 1\n2 2\n3 3",
"output": "5\ncol 1\ncol 2\nrow 2\nrow 3\nrow 3"
},
{
"input": "4 2\n1 1\n1 1\n1 1\n1 1",
"output": "2\ncol 1\ncol 2"
},
{
"input": "3 4\n1 1 1 1\n1 1 1 1\n1 1 1 1",
"output": "3\nrow 1\nrow 2\nrow 3"
},
{
"input": "2 1\n2\n3",
"output": "3\ncol 1\ncol 1\nrow 2"
},
{
"input": "5 3\n2 2 2\n2 2 2\n2 2 2\n2 2 2\n2 2 2",
"output": "6\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3"
},
{
"input": "3 2\n1 0\n2 1\n2 1",
"output": "3\ncol 1\nrow 2\nrow 3"
},
{
"input": "3 2\n1 2\n2 3\n3 4",
"output": "6\ncol 1\ncol 2\ncol 2\nrow 2\nrow 3\nrow 3"
},
{
"input": "3 3\n1 1 1\n1 2 1\n1 1 1",
"output": "-1"
},
{
"input": "4 3\n2 1 1\n2 1 1\n2 1 1\n2 1 1",
"output": "4\ncol 1\ncol 2\ncol 3\ncol 1"
},
{
"input": "4 1\n3\n3\n3\n3",
"output": "3\ncol 1\ncol 1\ncol 1"
},
{
"input": "1 3\n2 3 2",
"output": "3\nrow 1\nrow 1\ncol 2"
},
{
"input": "1 2\n1 2",
"output": "2\nrow 1\ncol 2"
},
{
"input": "3 2\n2 2\n2 2\n2 2",
"output": "4\ncol 1\ncol 2\ncol 1\ncol 2"
},
{
"input": "1 3\n1 1 1",
"output": "1\nrow 1"
},
{
"input": "6 3\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1",
"output": "3\ncol 1\ncol 2\ncol 3"
},
{
"input": "3 1\n2\n2\n2",
"output": "2\ncol 1\ncol 1"
},
{
"input": "3 1\n3\n3\n3",
"output": "3\ncol 1\ncol 1\ncol 1"
},
{
"input": "3 2\n2 2\n1 1\n1 1",
"output": "3\ncol 1\ncol 2\nrow 1"
},
{
"input": "5 3\n1 1 2\n1 1 2\n1 1 2\n1 1 2\n1 1 2",
"output": "4\ncol 1\ncol 2\ncol 3\ncol 3"
},
{
"input": "1 2\n2 3",
"output": "3\nrow 1\nrow 1\ncol 2"
},
{
"input": "5 1\n2\n2\n2\n2\n2",
"output": "2\ncol 1\ncol 1"
},
{
"input": "3 2\n1 1\n2 2\n2 2",
"output": "4\ncol 1\ncol 2\nrow 2\nrow 3"
},
{
"input": "3 3\n1 1 1\n2 3 3\n4 4 4",
"output": "-1"
},
{
"input": "2 1\n5\n2",
"output": "5\ncol 1\ncol 1\nrow 1\nrow 1\nrow 1"
},
{
"input": "4 2\n2 2\n2 2\n2 2\n2 2",
"output": "4\ncol 1\ncol 2\ncol 1\ncol 2"
},
{
"input": "3 2\n5 10\n5 10\n5 10",
"output": "15\ncol 1\ncol 2\ncol 1\ncol 2\ncol 1\ncol 2\ncol 1\ncol 2\ncol 1\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2\ncol 2"
},
{
"input": "4 3\n3 4 3\n5 6 5\n3 4 3\n3 4 3",
"output": "12\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 1\ncol 2\ncol 3\ncol 2\nrow 2\nrow 2"
},
{
"input": "4 2\n1 1\n1 1\n1 1\n2 2",
"output": "3\ncol 1\ncol 2\nrow 4"
},
{
"input": "2 3\n1 1 1\n500 500 500",
"output": "501\nrow 1\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nrow 2\nro..."
},
{
"input": "4 1\n4\n4\n4\n4",
"output": "4\ncol 1\ncol 1\ncol 1\ncol 1"
},
{
"input": "3 2\n1 1\n1 1\n2 2",
"output": "3\ncol 1\ncol 2\nrow 3"
},
{
"input": "2 3\n2 2 2\n2 2 2",
"output": "4\nrow 1\nrow 2\nrow 1\nrow 2"
},
{
"input": "3 2\n3 3\n3 3\n3 3",
"output": "6\ncol 1\ncol 2\ncol 1\ncol 2\ncol 1\ncol 2"
},
{
"input": "2 3\n10 10 10\n5 5 5",
"output": "15\nrow 1\nrow 2\nrow 1\nrow 2\nrow 1\nrow 2\nrow 1\nrow 2\nrow 1\nrow 2\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1"
},
{
"input": "5 2\n1 2\n1 2\n1 2\n1 2\n1 2",
"output": "3\ncol 1\ncol 2\ncol 2"
},
{
"input": "1 2\n500 500",
"output": "500\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nrow 1\nro..."
},
{
"input": "2 1\n5\n5",
"output": "5\ncol 1\ncol 1\ncol 1\ncol 1\ncol 1"
}
] | 1,530,962,458 | 2,147,483,647 | Python 3 | OK | TESTS | 177 | 374 | 819,200 | n,m=map(int,input().split())
a=[];row=[];col=[]
for i in range(n):
a.append(list(map(int,input().split())))
if m>n:
for i in range(n):
row.append(min(a[i]))
for i in range(m):
col.append(a[0][i]-row[0])
else:
for i in range(m):
r=1000
for j in range(n):
r=min(r,a[j][i])
col.append(r)
for i in range(n):
row.append(a[i][0]-col[0])
for i in range(n):
for j in range(m):
if a[i][j]!=row[i]+col[j]:
exit(print(-1))
print(sum(row)+sum(col))
for i in range(n):
for j in range(row[i]):
print('row',i+1)
for i in range(m):
for j in range(col[i]):
print('col',i+1) | Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
On the way to school, Karen became fixated on the puzzle game on her phone!
The game is played as follows. In each level, you have a grid with *n* rows and *m* columns. Each cell originally contains the number 0.
One move consists of choosing one row or column, and adding 1 to all of the cells in that row or column.
To win the level, after all the moves, the number in the cell at the *i*-th row and *j*-th column should be equal to *g**i*,<=*j*.
Karen is stuck on one level, and wants to know a way to beat this level using the minimum number of moves. Please, help her with this task!
Input Specification:
The first line of input contains two integers, *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100), the number of rows and the number of columns in the grid, respectively.
The next *n* lines each contain *m* integers. In particular, the *j*-th integer in the *i*-th of these rows contains *g**i*,<=*j* (0<=≤<=*g**i*,<=*j*<=≤<=500).
Output Specification:
If there is an error and it is actually not possible to beat the level, output a single integer -1.
Otherwise, on the first line, output a single integer *k*, the minimum number of moves necessary to beat the level.
The next *k* lines should each contain one of the following, describing the moves in the order they must be done:
- row *x*, (1<=≤<=*x*<=≤<=*n*) describing a move of the form "choose the *x*-th row". - col *x*, (1<=≤<=*x*<=≤<=*m*) describing a move of the form "choose the *x*-th column".
If there are multiple optimal solutions, output any one of them.
Demo Input:
['3 5\n2 2 2 3 2\n0 0 0 1 0\n1 1 1 2 1\n', '3 3\n0 0 0\n0 1 0\n0 0 0\n', '3 3\n1 1 1\n1 1 1\n1 1 1\n']
Demo Output:
['4\nrow 1\nrow 1\ncol 4\nrow 3\n', '-1\n', '3\nrow 1\nrow 2\nrow 3\n']
Note:
In the first test case, Karen has a grid with 3 rows and 5 columns. She can perform the following 4 moves to beat the level:
In the second test case, Karen has a grid with 3 rows and 3 columns. It is clear that it is impossible to beat the level; performing any move will create three 1s on the grid, but it is required to only have one 1 in the center.
In the third test case, Karen has a grid with 3 rows and 3 columns. She can perform the following 3 moves to beat the level:
Note that this is not the only solution; another solution, among others, is col 1, col 2, col 3. | ```python
n,m=map(int,input().split())
a=[];row=[];col=[]
for i in range(n):
a.append(list(map(int,input().split())))
if m>n:
for i in range(n):
row.append(min(a[i]))
for i in range(m):
col.append(a[0][i]-row[0])
else:
for i in range(m):
r=1000
for j in range(n):
r=min(r,a[j][i])
col.append(r)
for i in range(n):
row.append(a[i][0]-col[0])
for i in range(n):
for j in range(m):
if a[i][j]!=row[i]+col[j]:
exit(print(-1))
print(sum(row)+sum(col))
for i in range(n):
for j in range(row[i]):
print('row',i+1)
for i in range(m):
for j in range(col[i]):
print('col',i+1)
``` | 3 |
|
69 | A | Young Physicist | PROGRAMMING | 1,000 | [
"implementation",
"math"
] | A. Young Physicist | 2 | 256 | A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces. | The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100). | Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not. | [
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] | [
"NO",
"YES"
] | none | 500 | [
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,673,238,311 | 431 | PyPy 3-64 | WRONG_ANSWER | TESTS | 0 | 62 | 0 | import sys
vector = [0, 0, 0]
counter = 0
for line in sys.stdin:
if not counter:
continue
nums = [int(i) for i in line.split(' ')]
for i in range(3):
vector[i] += nums[i]
counter += 1
if vector[0] == 0 and vector[1] == 0 and vector[2] == 0:
print('YES')
else:
print('NO')
| Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none | ```python
import sys
vector = [0, 0, 0]
counter = 0
for line in sys.stdin:
if not counter:
continue
nums = [int(i) for i in line.split(' ')]
for i in range(3):
vector[i] += nums[i]
counter += 1
if vector[0] == 0 and vector[1] == 0 and vector[2] == 0:
print('YES')
else:
print('NO')
``` | 0 |
805 | A | Fake NP | PROGRAMMING | 1,000 | [
"greedy",
"math"
] | null | null | Tavak and Seyyed are good friends. Seyyed is very funny and he told Tavak to solve the following problem instead of longest-path.
You are given *l* and *r*. For all integers from *l* to *r*, inclusive, we wrote down all of their integer divisors except 1. Find the integer that we wrote down the maximum number of times.
Solve the problem to show that it's not a NP problem. | The first line contains two integers *l* and *r* (2<=≤<=*l*<=≤<=*r*<=≤<=109). | Print single integer, the integer that appears maximum number of times in the divisors.
If there are multiple answers, print any of them. | [
"19 29\n",
"3 6\n"
] | [
"2\n",
"3\n"
] | Definition of a divisor: [https://www.mathsisfun.com/definitions/divisor-of-an-integer-.html](https://www.mathsisfun.com/definitions/divisor-of-an-integer-.html)
The first example: from 19 to 29 these numbers are divisible by 2: {20, 22, 24, 26, 28}.
The second example: from 3 to 6 these numbers are divisible by 3: {3, 6}. | 500 | [
{
"input": "19 29",
"output": "2"
},
{
"input": "3 6",
"output": "2"
},
{
"input": "39 91",
"output": "2"
},
{
"input": "76 134",
"output": "2"
},
{
"input": "93 95",
"output": "2"
},
{
"input": "17 35",
"output": "2"
},
{
"input": "94 95",
"output": "2"
},
{
"input": "51 52",
"output": "2"
},
{
"input": "47 52",
"output": "2"
},
{
"input": "38 98",
"output": "2"
},
{
"input": "30 37",
"output": "2"
},
{
"input": "56 92",
"output": "2"
},
{
"input": "900000000 1000000000",
"output": "2"
},
{
"input": "37622224 162971117",
"output": "2"
},
{
"input": "760632746 850720703",
"output": "2"
},
{
"input": "908580370 968054552",
"output": "2"
},
{
"input": "951594860 953554446",
"output": "2"
},
{
"input": "347877978 913527175",
"output": "2"
},
{
"input": "620769961 988145114",
"output": "2"
},
{
"input": "820844234 892579936",
"output": "2"
},
{
"input": "741254764 741254768",
"output": "2"
},
{
"input": "80270976 80270977",
"output": "2"
},
{
"input": "392602363 392602367",
"output": "2"
},
{
"input": "519002744 519002744",
"output": "519002744"
},
{
"input": "331900277 331900277",
"output": "331900277"
},
{
"input": "419873015 419873018",
"output": "2"
},
{
"input": "349533413 349533413",
"output": "349533413"
},
{
"input": "28829775 28829776",
"output": "2"
},
{
"input": "568814539 568814539",
"output": "568814539"
},
{
"input": "720270740 720270743",
"output": "2"
},
{
"input": "871232720 871232722",
"output": "2"
},
{
"input": "305693653 305693653",
"output": "305693653"
},
{
"input": "634097178 634097179",
"output": "2"
},
{
"input": "450868287 450868290",
"output": "2"
},
{
"input": "252662256 252662260",
"output": "2"
},
{
"input": "575062045 575062049",
"output": "2"
},
{
"input": "273072892 273072894",
"output": "2"
},
{
"input": "770439256 770439256",
"output": "770439256"
},
{
"input": "2 1000000000",
"output": "2"
},
{
"input": "6 8",
"output": "2"
},
{
"input": "2 879190747",
"output": "2"
},
{
"input": "5 5",
"output": "5"
},
{
"input": "999999937 999999937",
"output": "999999937"
},
{
"input": "3 3",
"output": "3"
},
{
"input": "5 100",
"output": "2"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 18",
"output": "2"
},
{
"input": "7 7",
"output": "7"
},
{
"input": "39916801 39916801",
"output": "39916801"
},
{
"input": "3 8",
"output": "2"
},
{
"input": "13 13",
"output": "13"
},
{
"input": "4 8",
"output": "2"
},
{
"input": "3 12",
"output": "2"
},
{
"input": "6 12",
"output": "2"
},
{
"input": "999999103 999999103",
"output": "999999103"
},
{
"input": "100000007 100000007",
"output": "100000007"
},
{
"input": "3 99",
"output": "2"
},
{
"input": "999999733 999999733",
"output": "999999733"
},
{
"input": "5 10",
"output": "2"
},
{
"input": "982451653 982451653",
"output": "982451653"
},
{
"input": "999900001 1000000000",
"output": "2"
},
{
"input": "999727999 999727999",
"output": "999727999"
},
{
"input": "2 999999999",
"output": "2"
},
{
"input": "242 244",
"output": "2"
},
{
"input": "3 10",
"output": "2"
},
{
"input": "15 27",
"output": "2"
},
{
"input": "998244353 998244353",
"output": "998244353"
},
{
"input": "5 15",
"output": "2"
},
{
"input": "999999797 999999797",
"output": "999999797"
},
{
"input": "2 3",
"output": "2"
},
{
"input": "999999929 999999929",
"output": "999999929"
},
{
"input": "3 111111",
"output": "2"
},
{
"input": "12 18",
"output": "2"
},
{
"input": "479001599 479001599",
"output": "479001599"
},
{
"input": "10000019 10000019",
"output": "10000019"
},
{
"input": "715827883 715827883",
"output": "715827883"
},
{
"input": "999992977 999992977",
"output": "999992977"
},
{
"input": "11 11",
"output": "11"
},
{
"input": "29 29",
"output": "29"
},
{
"input": "1000003 1000003",
"output": "1000003"
},
{
"input": "6 15",
"output": "2"
},
{
"input": "1200007 1200007",
"output": "1200007"
},
{
"input": "3 1000000000",
"output": "2"
},
{
"input": "990000023 990000023",
"output": "990000023"
},
{
"input": "1717 1717",
"output": "1717"
},
{
"input": "141650963 141650963",
"output": "141650963"
},
{
"input": "1002523 1002523",
"output": "1002523"
},
{
"input": "900000011 900000011",
"output": "900000011"
},
{
"input": "104729 104729",
"output": "104729"
},
{
"input": "4 12",
"output": "2"
},
{
"input": "100003 100003",
"output": "100003"
},
{
"input": "17 17",
"output": "17"
},
{
"input": "10 100",
"output": "2"
}
] | 1,597,955,869 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 24 | 109 | 0 | l,r=map(int,input().split())
x,y=(r//2)-(l//2),(r//3)-(l//3)
if x>=y:
print('2')
else:
print('3') | Title: Fake NP
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Tavak and Seyyed are good friends. Seyyed is very funny and he told Tavak to solve the following problem instead of longest-path.
You are given *l* and *r*. For all integers from *l* to *r*, inclusive, we wrote down all of their integer divisors except 1. Find the integer that we wrote down the maximum number of times.
Solve the problem to show that it's not a NP problem.
Input Specification:
The first line contains two integers *l* and *r* (2<=≤<=*l*<=≤<=*r*<=≤<=109).
Output Specification:
Print single integer, the integer that appears maximum number of times in the divisors.
If there are multiple answers, print any of them.
Demo Input:
['19 29\n', '3 6\n']
Demo Output:
['2\n', '3\n']
Note:
Definition of a divisor: [https://www.mathsisfun.com/definitions/divisor-of-an-integer-.html](https://www.mathsisfun.com/definitions/divisor-of-an-integer-.html)
The first example: from 19 to 29 these numbers are divisible by 2: {20, 22, 24, 26, 28}.
The second example: from 3 to 6 these numbers are divisible by 3: {3, 6}. | ```python
l,r=map(int,input().split())
x,y=(r//2)-(l//2),(r//3)-(l//3)
if x>=y:
print('2')
else:
print('3')
``` | 0 |
|
16 | C | Monitor | PROGRAMMING | 1,800 | [
"binary search",
"number theory"
] | C. Monitor | 0 | 64 | Reca company makes monitors, the most popular of their models is AB999 with the screen size *a*<=×<=*b* centimeters. Because of some production peculiarities a screen parameters are integer numbers. Recently the screen sides ratio *x*:<=*y* became popular with users. That's why the company wants to reduce monitor AB999 size so that its screen sides ratio becomes *x*:<=*y*, at the same time they want its total area to be maximal of all possible variants. Your task is to find the screen parameters of the reduced size model, or find out that such a reduction can't be performed. | The first line of the input contains 4 integers — *a*, *b*, *x* and *y* (1<=≤<=*a*,<=*b*,<=*x*,<=*y*<=≤<=2·109). | If the answer exists, output 2 positive integers — screen parameters of the reduced size model. Output 0 0 otherwise. | [
"800 600 4 3\n",
"1920 1200 16 9\n",
"1 1 1 2\n"
] | [
"800 600\n",
"1920 1080\n",
"0 0\n"
] | none | 0 | [
{
"input": "800 600 4 3",
"output": "800 600"
},
{
"input": "1920 1200 16 9",
"output": "1920 1080"
},
{
"input": "1 1 1 2",
"output": "0 0"
},
{
"input": "1002105126 227379125 179460772 1295256518",
"output": "0 0"
},
{
"input": "625166755 843062051 1463070160 1958300154",
"output": "0 0"
},
{
"input": "248228385 1458744978 824699604 1589655888",
"output": "206174901 397413972"
},
{
"input": "186329049 1221011622 90104472 1769702163",
"output": "60069648 1179801442"
},
{
"input": "511020182 242192314 394753578 198572007",
"output": "394753578 198572007"
},
{
"input": "134081812 857875240 82707261 667398699",
"output": "105411215 850606185"
},
{
"input": "721746595 799202881 143676564 380427290",
"output": "287353128 760854580"
},
{
"input": "912724694 1268739154 440710604 387545692",
"output": "881421208 775091384"
},
{
"input": "1103702793 1095784840 788679477 432619528",
"output": "788679477 432619528"
},
{
"input": "548893795 861438648 131329677 177735812",
"output": "525318708 710943248"
},
{
"input": "652586118 1793536161 127888702 397268645",
"output": "511554808 1589074580"
},
{
"input": "756278440 578150025 96644319 26752094",
"output": "676510233 187264658"
},
{
"input": "859970763 1510247537 37524734 97452508",
"output": "562871010 1461787620"
},
{
"input": "547278097 1977241684 51768282 183174370",
"output": "543566961 1923330885"
},
{
"input": "62256611 453071697 240966 206678",
"output": "62169228 53322924"
},
{
"input": "1979767797 878430446 5812753 3794880",
"output": "1342745943 876617280"
},
{
"input": "1143276347 1875662241 178868040 116042960",
"output": "1140283755 739773870"
},
{
"input": "435954880 1740366589 19415065 185502270",
"output": "182099920 1739883360"
},
{
"input": "664035593 983601098 4966148 2852768",
"output": "664032908 381448928"
},
{
"input": "1461963719 350925487 135888396 83344296",
"output": "572153868 350918568"
},
{
"input": "754199095 348965411 161206703 67014029",
"output": "754119492 313489356"
},
{
"input": "166102153 494841162 14166516 76948872",
"output": "91096406 494812252"
},
{
"input": "1243276346 1975662240 38441120 291740200",
"output": "259477560 1969246350"
},
{
"input": "535954879 1840366588 26278959 73433046",
"output": "535849118 1497358892"
},
{
"input": "764035592 1083601097 1192390 7267738",
"output": "177777265 1083570463"
},
{
"input": "1561963718 450925486 475523188 136236856",
"output": "1561914768 447486816"
},
{
"input": "854199094 448965410 364102983 125971431",
"output": "853687785 295356745"
},
{
"input": "266102152 594841161 15854566 13392106",
"output": "266043102 224722482"
},
{
"input": "1 1 2 1",
"output": "0 0"
},
{
"input": "2000000000 2000000000 1 1999999999",
"output": "1 1999999999"
},
{
"input": "2000000000 2000000000 1999999999 1",
"output": "1999999999 1"
},
{
"input": "2000000000 2000000000 2 1999999999",
"output": "2 1999999999"
},
{
"input": "1000000000 1000000000 999999999 2",
"output": "999999999 2"
},
{
"input": "2000000000 2000000000 1999999999 2",
"output": "1999999999 2"
},
{
"input": "2000000000 2000000000 1999999999 1999999998",
"output": "1999999999 1999999998"
},
{
"input": "2000000000 2000000000 1999999998 1999999999",
"output": "1999999998 1999999999"
}
] | 1,653,665,743 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 31 | 102,400 | """16С 1800 баллов"""
from datetime import datetime
"""#print("Размер до ")
a = float(input())
b = float(input())
#print("Размер после ")
x= int(input())
y= int(input())"""
a, b, x, y = map(int, input().split())
s = datetime.now()
#if a>x and b>y:
if a % x == 0 and b % y == 0:
print(int(a), int(b))
elif a % x != 0 and b % y == 0:
a = x * (b // y)
print(a, b)
elif a % x == 0 and b % y != 0:
b = y * (a // x)
print(int(a), int(b))
elif a % x != 0 and b % y != 0:
while a % x != 0:
a -= 1
if a <= 0:
print(0, 0)
b = y * a // x
print(int(a), int(b))
#else:
#print(0, 0)
#print(datetime.now()-s) | Title: Monitor
Time Limit: 0 seconds
Memory Limit: 64 megabytes
Problem Description:
Reca company makes monitors, the most popular of their models is AB999 with the screen size *a*<=×<=*b* centimeters. Because of some production peculiarities a screen parameters are integer numbers. Recently the screen sides ratio *x*:<=*y* became popular with users. That's why the company wants to reduce monitor AB999 size so that its screen sides ratio becomes *x*:<=*y*, at the same time they want its total area to be maximal of all possible variants. Your task is to find the screen parameters of the reduced size model, or find out that such a reduction can't be performed.
Input Specification:
The first line of the input contains 4 integers — *a*, *b*, *x* and *y* (1<=≤<=*a*,<=*b*,<=*x*,<=*y*<=≤<=2·109).
Output Specification:
If the answer exists, output 2 positive integers — screen parameters of the reduced size model. Output 0 0 otherwise.
Demo Input:
['800 600 4 3\n', '1920 1200 16 9\n', '1 1 1 2\n']
Demo Output:
['800 600\n', '1920 1080\n', '0 0\n']
Note:
none | ```python
"""16С 1800 баллов"""
from datetime import datetime
"""#print("Размер до ")
a = float(input())
b = float(input())
#print("Размер после ")
x= int(input())
y= int(input())"""
a, b, x, y = map(int, input().split())
s = datetime.now()
#if a>x and b>y:
if a % x == 0 and b % y == 0:
print(int(a), int(b))
elif a % x != 0 and b % y == 0:
a = x * (b // y)
print(a, b)
elif a % x == 0 and b % y != 0:
b = y * (a // x)
print(int(a), int(b))
elif a % x != 0 and b % y != 0:
while a % x != 0:
a -= 1
if a <= 0:
print(0, 0)
b = y * a // x
print(int(a), int(b))
#else:
#print(0, 0)
#print(datetime.now()-s)
``` | 0 |
4 | A | Watermelon | PROGRAMMING | 800 | [
"brute force",
"math"
] | A. Watermelon | 1 | 64 | One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem.
Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight. | The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys. | Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case. | [
"8\n"
] | [
"YES\n"
] | For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos). | 0 | [
{
"input": "8",
"output": "YES"
},
{
"input": "5",
"output": "NO"
},
{
"input": "4",
"output": "YES"
},
{
"input": "3",
"output": "NO"
},
{
"input": "2",
"output": "NO"
},
{
"input": "1",
"output": "NO"
},
{
"input": "7",
"output": "NO"
},
{
"input": "6",
"output": "YES"
},
{
"input": "10",
"output": "YES"
},
{
"input": "9",
"output": "NO"
},
{
"input": "53",
"output": "NO"
},
{
"input": "77",
"output": "NO"
},
{
"input": "32",
"output": "YES"
},
{
"input": "44",
"output": "YES"
},
{
"input": "98",
"output": "YES"
},
{
"input": "99",
"output": "NO"
},
{
"input": "90",
"output": "YES"
},
{
"input": "67",
"output": "NO"
},
{
"input": "100",
"output": "YES"
},
{
"input": "88",
"output": "YES"
}
] | 1,691,351,899 | 2,147,483,647 | Python 3 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | w = int(input("w"))
if (w/2=0):
ptint("Yes")
else:
print("No") | Title: Watermelon
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem.
Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight.
Input Specification:
The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys.
Output Specification:
Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case.
Demo Input:
['8\n']
Demo Output:
['YES\n']
Note:
For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos). | ```python
w = int(input("w"))
if (w/2=0):
ptint("Yes")
else:
print("No")
``` | -1 |
1,004 | A | Sonya and Hotels | PROGRAMMING | 900 | [
"implementation"
] | null | null | Sonya decided that having her own hotel business is the best way of earning money because she can profit and rest wherever she wants.
The country where Sonya lives is an endless line. There is a city in each integer coordinate on this line. She has $n$ hotels, where the $i$-th hotel is located in the city with coordinate $x_i$. Sonya is a smart girl, so she does not open two or more hotels in the same city.
Sonya understands that her business needs to be expanded by opening new hotels, so she decides to build one more. She wants to make the minimum distance from this hotel to all others to be equal to $d$. The girl understands that there are many possible locations to construct such a hotel. Thus she wants to know the number of possible coordinates of the cities where she can build a new hotel.
Because Sonya is lounging in a jacuzzi in one of her hotels, she is asking you to find the number of cities where she can build a new hotel so that the minimum distance from the original $n$ hotels to the new one is equal to $d$. | The first line contains two integers $n$ and $d$ ($1\leq n\leq 100$, $1\leq d\leq 10^9$) — the number of Sonya's hotels and the needed minimum distance from a new hotel to all others.
The second line contains $n$ different integers in strictly increasing order $x_1, x_2, \ldots, x_n$ ($-10^9\leq x_i\leq 10^9$) — coordinates of Sonya's hotels. | Print the number of cities where Sonya can build a new hotel so that the minimum distance from this hotel to all others is equal to $d$. | [
"4 3\n-3 2 9 16\n",
"5 2\n4 8 11 18 19\n"
] | [
"6\n",
"5\n"
] | In the first example, there are $6$ possible cities where Sonya can build a hotel. These cities have coordinates $-6$, $5$, $6$, $12$, $13$, and $19$.
In the second example, there are $5$ possible cities where Sonya can build a hotel. These cities have coordinates $2$, $6$, $13$, $16$, and $21$. | 500 | [
{
"input": "4 3\n-3 2 9 16",
"output": "6"
},
{
"input": "5 2\n4 8 11 18 19",
"output": "5"
},
{
"input": "10 10\n-67 -59 -49 -38 -8 20 41 59 74 83",
"output": "8"
},
{
"input": "10 10\n0 20 48 58 81 95 111 137 147 159",
"output": "9"
},
{
"input": "100 1\n0 1 2 3 4 5 7 8 10 11 12 13 14 15 16 17 19 21 22 23 24 25 26 27 28 30 32 33 36 39 40 41 42 46 48 53 54 55 59 60 61 63 65 68 70 71 74 75 76 79 80 81 82 84 88 89 90 91 93 94 96 97 98 100 101 102 105 106 107 108 109 110 111 113 114 115 116 117 118 120 121 122 125 126 128 131 132 133 134 135 137 138 139 140 143 144 146 147 148 149",
"output": "47"
},
{
"input": "1 1000000000\n-1000000000",
"output": "2"
},
{
"input": "2 1000000000\n-1000000000 1000000000",
"output": "3"
},
{
"input": "100 2\n1 3 5 6 8 9 12 13 14 17 18 21 22 23 24 25 26 27 29 30 34 35 36 39 41 44 46 48 52 53 55 56 57 59 61 63 64 66 68 69 70 71 72 73 75 76 77 79 80 81 82 87 88 91 92 93 94 95 96 97 99 100 102 103 104 106 109 110 111 112 113 114 115 117 118 119 120 122 124 125 127 128 129 130 131 132 133 134 136 137 139 140 141 142 143 145 146 148 149 150",
"output": "6"
},
{
"input": "100 3\n0 1 3 6 7 8 9 10 13 14 16 17 18 20 21 22 24 26 27 30 33 34 35 36 37 39 42 43 44 45 46 48 53 54 55 56 57 58 61 63 64 65 67 69 70 72 73 76 77 78 79 81 82 83 85 86 87 88 90 92 93 95 96 97 98 99 100 101 104 105 108 109 110 113 114 115 116 118 120 121 123 124 125 128 130 131 132 133 134 135 136 137 139 140 141 142 146 147 148 150",
"output": "2"
},
{
"input": "1 1000000000\n1000000000",
"output": "2"
},
{
"input": "10 2\n-93 -62 -53 -42 -38 11 57 58 87 94",
"output": "17"
},
{
"input": "2 500000000\n-1000000000 1000000000",
"output": "4"
},
{
"input": "100 10\n-489 -476 -445 -432 -430 -421 -420 -418 -412 -411 -404 -383 -356 -300 -295 -293 -287 -276 -265 -263 -258 -251 -249 -246 -220 -219 -205 -186 -166 -157 -143 -137 -136 -130 -103 -86 -80 -69 -67 -55 -43 -41 -40 -26 -19 -9 16 29 41 42 54 76 84 97 98 99 101 115 134 151 157 167 169 185 197 204 208 226 227 232 234 249 259 266 281 282 293 298 300 306 308 313 319 328 331 340 341 344 356 362 366 380 390 399 409 411 419 444 455 498",
"output": "23"
},
{
"input": "1 1000000000\n999999999",
"output": "2"
},
{
"input": "1 1\n-5",
"output": "2"
},
{
"input": "2 1\n-1000000000 1000000000",
"output": "4"
},
{
"input": "1 2\n1",
"output": "2"
},
{
"input": "4 5\n0 20 40 60",
"output": "8"
},
{
"input": "1 1\n-10",
"output": "2"
},
{
"input": "1 1\n-1000000000",
"output": "2"
},
{
"input": "1 1000000000\n0",
"output": "2"
},
{
"input": "1 2\n-10",
"output": "2"
},
{
"input": "1 1\n2",
"output": "2"
},
{
"input": "1 5\n-100",
"output": "2"
},
{
"input": "2 1000000000\n999999999 1000000000",
"output": "2"
},
{
"input": "2 2\n0 5",
"output": "4"
},
{
"input": "1 2\n-5",
"output": "2"
},
{
"input": "1 1\n1",
"output": "2"
},
{
"input": "1 5\n-20",
"output": "2"
},
{
"input": "2 100000000\n-1000000000 1000000000",
"output": "4"
},
{
"input": "1 1000000000\n147483641",
"output": "2"
},
{
"input": "3 3\n1 8 9",
"output": "4"
},
{
"input": "2 1\n1 1000000000",
"output": "4"
},
{
"input": "1 2\n-4",
"output": "2"
},
{
"input": "2 1\n-1000000000 -1",
"output": "4"
}
] | 1,697,189,638 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 2 | 31 | 0 | line1 = input()
line2 = input()
n=int(line1[0])
d=int(line1[2])
city = set(map(int, line2.split()))
d1 = {i+d for i in city}
d2 = {i-d for i in city}
ncity = city | d1 | d2
ncity = sorted(ncity)
min = [ncity[i+1] - ncity[i] for i in range(len(ncity)-1)]
c=0
for i in min:
if i>=d:
c += 1
print(c) | Title: Sonya and Hotels
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sonya decided that having her own hotel business is the best way of earning money because she can profit and rest wherever she wants.
The country where Sonya lives is an endless line. There is a city in each integer coordinate on this line. She has $n$ hotels, where the $i$-th hotel is located in the city with coordinate $x_i$. Sonya is a smart girl, so she does not open two or more hotels in the same city.
Sonya understands that her business needs to be expanded by opening new hotels, so she decides to build one more. She wants to make the minimum distance from this hotel to all others to be equal to $d$. The girl understands that there are many possible locations to construct such a hotel. Thus she wants to know the number of possible coordinates of the cities where she can build a new hotel.
Because Sonya is lounging in a jacuzzi in one of her hotels, she is asking you to find the number of cities where she can build a new hotel so that the minimum distance from the original $n$ hotels to the new one is equal to $d$.
Input Specification:
The first line contains two integers $n$ and $d$ ($1\leq n\leq 100$, $1\leq d\leq 10^9$) — the number of Sonya's hotels and the needed minimum distance from a new hotel to all others.
The second line contains $n$ different integers in strictly increasing order $x_1, x_2, \ldots, x_n$ ($-10^9\leq x_i\leq 10^9$) — coordinates of Sonya's hotels.
Output Specification:
Print the number of cities where Sonya can build a new hotel so that the minimum distance from this hotel to all others is equal to $d$.
Demo Input:
['4 3\n-3 2 9 16\n', '5 2\n4 8 11 18 19\n']
Demo Output:
['6\n', '5\n']
Note:
In the first example, there are $6$ possible cities where Sonya can build a hotel. These cities have coordinates $-6$, $5$, $6$, $12$, $13$, and $19$.
In the second example, there are $5$ possible cities where Sonya can build a hotel. These cities have coordinates $2$, $6$, $13$, $16$, and $21$. | ```python
line1 = input()
line2 = input()
n=int(line1[0])
d=int(line1[2])
city = set(map(int, line2.split()))
d1 = {i+d for i in city}
d2 = {i-d for i in city}
ncity = city | d1 | d2
ncity = sorted(ncity)
min = [ncity[i+1] - ncity[i] for i in range(len(ncity)-1)]
c=0
for i in min:
if i>=d:
c += 1
print(c)
``` | -1 |
|
1,008 | A | Romaji | PROGRAMMING | 900 | [
"implementation",
"strings"
] | null | null | Vitya has just started learning Berlanese language. It is known that Berlanese uses the Latin alphabet. Vowel letters are "a", "o", "u", "i", and "e". Other letters are consonant.
In Berlanese, there has to be a vowel after every consonant, but there can be any letter after any vowel. The only exception is a consonant "n"; after this letter, there can be any letter (not only a vowel) or there can be no letter at all. For example, the words "harakiri", "yupie", "man", and "nbo" are Berlanese while the words "horse", "king", "my", and "nz" are not.
Help Vitya find out if a word $s$ is Berlanese. | The first line of the input contains the string $s$ consisting of $|s|$ ($1\leq |s|\leq 100$) lowercase Latin letters. | Print "YES" (without quotes) if there is a vowel after every consonant except "n", otherwise print "NO".
You can print each letter in any case (upper or lower). | [
"sumimasen\n",
"ninja\n",
"codeforces\n"
] | [
"YES\n",
"YES\n",
"NO\n"
] | In the first and second samples, a vowel goes after each consonant except "n", so the word is Berlanese.
In the third sample, the consonant "c" goes after the consonant "r", and the consonant "s" stands on the end, so the word is not Berlanese. | 500 | [
{
"input": "sumimasen",
"output": "YES"
},
{
"input": "ninja",
"output": "YES"
},
{
"input": "codeforces",
"output": "NO"
},
{
"input": "auuaoonntanonnuewannnnpuuinniwoonennyolonnnvienonpoujinndinunnenannmuveoiuuhikucuziuhunnnmunzancenen",
"output": "YES"
},
{
"input": "n",
"output": "YES"
},
{
"input": "necnei",
"output": "NO"
},
{
"input": "nternn",
"output": "NO"
},
{
"input": "aucunuohja",
"output": "NO"
},
{
"input": "a",
"output": "YES"
},
{
"input": "b",
"output": "NO"
},
{
"input": "nn",
"output": "YES"
},
{
"input": "nnnzaaa",
"output": "YES"
},
{
"input": "zn",
"output": "NO"
},
{
"input": "ab",
"output": "NO"
},
{
"input": "aaaaaaaaaa",
"output": "YES"
},
{
"input": "aaaaaaaaab",
"output": "NO"
},
{
"input": "aaaaaaaaan",
"output": "YES"
},
{
"input": "baaaaaaaaa",
"output": "YES"
},
{
"input": "naaaaaaaaa",
"output": "YES"
},
{
"input": "nbaaaaaaaa",
"output": "YES"
},
{
"input": "bbaaaaaaaa",
"output": "NO"
},
{
"input": "bnaaaaaaaa",
"output": "NO"
},
{
"input": "eonwonojannonnufimiiniewuqaienokacevecinfuqihatenhunliquuyebayiaenifuexuanenuaounnboancaeowonu",
"output": "YES"
},
{
"input": "uixinnepnlinqaingieianndeakuniooudidonnnqeaituioeneiroionxuowudiooonayenfeonuino",
"output": "NO"
},
{
"input": "nnnnnyigaveteononnnnxaalenxuiiwannntoxonyoqonlejuoxuoconnnentoinnul",
"output": "NO"
},
{
"input": "ndonneasoiunhomuunnhuitonnntunntoanerekonoupunanuauenu",
"output": "YES"
},
{
"input": "anujemogawautiedoneobninnibonuunaoennnyoorufonxionntinimiboonununnnnnleenqunminzayoutanlalo",
"output": "NO"
},
{
"input": "y",
"output": "NO"
},
{
"input": "by",
"output": "NO"
},
{
"input": "yy",
"output": "NO"
},
{
"input": "nbn",
"output": "NO"
},
{
"input": "nz",
"output": "NO"
},
{
"input": "king",
"output": "NO"
},
{
"input": "g",
"output": "NO"
},
{
"input": "az",
"output": "NO"
},
{
"input": "x",
"output": "NO"
},
{
"input": "z",
"output": "NO"
},
{
"input": "yn",
"output": "NO"
},
{
"input": "aeo",
"output": "YES"
},
{
"input": "nb",
"output": "NO"
},
{
"input": "npn",
"output": "NO"
},
{
"input": "kini",
"output": "YES"
},
{
"input": "pya",
"output": "NO"
},
{
"input": "m",
"output": "NO"
},
{
"input": "p",
"output": "NO"
},
{
"input": "aaaaaaaak",
"output": "NO"
},
{
"input": "aab",
"output": "NO"
},
{
"input": "d",
"output": "NO"
},
{
"input": "at",
"output": "NO"
},
{
"input": "aaaaaak",
"output": "NO"
},
{
"input": "aaz",
"output": "NO"
},
{
"input": "aaab",
"output": "NO"
},
{
"input": "s",
"output": "NO"
},
{
"input": "nzzen",
"output": "NO"
},
{
"input": "aeionnhhhn",
"output": "NO"
},
{
"input": "h",
"output": "NO"
},
{
"input": "ny",
"output": "NO"
}
] | 1,638,315,578 | 2,147,483,647 | Python 3 | OK | TESTS | 57 | 62 | 0 | string=input().lower()
consonants=['b','c','d','f','g','h','j','k','l','m','p','q','r','s','t','v','w','x','y','z']
vowels=['a','e','i','o','u']
ber='YES'
for n in range(len(string)-1):
if string[n] in consonants:
if string[n+1] not in vowels:
ber='NO'
if string[-1] in consonants:
ber='NO'
print(ber) | Title: Romaji
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vitya has just started learning Berlanese language. It is known that Berlanese uses the Latin alphabet. Vowel letters are "a", "o", "u", "i", and "e". Other letters are consonant.
In Berlanese, there has to be a vowel after every consonant, but there can be any letter after any vowel. The only exception is a consonant "n"; after this letter, there can be any letter (not only a vowel) or there can be no letter at all. For example, the words "harakiri", "yupie", "man", and "nbo" are Berlanese while the words "horse", "king", "my", and "nz" are not.
Help Vitya find out if a word $s$ is Berlanese.
Input Specification:
The first line of the input contains the string $s$ consisting of $|s|$ ($1\leq |s|\leq 100$) lowercase Latin letters.
Output Specification:
Print "YES" (without quotes) if there is a vowel after every consonant except "n", otherwise print "NO".
You can print each letter in any case (upper or lower).
Demo Input:
['sumimasen\n', 'ninja\n', 'codeforces\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n']
Note:
In the first and second samples, a vowel goes after each consonant except "n", so the word is Berlanese.
In the third sample, the consonant "c" goes after the consonant "r", and the consonant "s" stands on the end, so the word is not Berlanese. | ```python
string=input().lower()
consonants=['b','c','d','f','g','h','j','k','l','m','p','q','r','s','t','v','w','x','y','z']
vowels=['a','e','i','o','u']
ber='YES'
for n in range(len(string)-1):
if string[n] in consonants:
if string[n+1] not in vowels:
ber='NO'
if string[-1] in consonants:
ber='NO'
print(ber)
``` | 3 |
|
282 | A | Bit++ | PROGRAMMING | 800 | [
"implementation"
] | null | null | The classic programming language of Bitland is Bit++. This language is so peculiar and complicated.
The language is that peculiar as it has exactly one variable, called *x*. Also, there are two operations:
- Operation ++ increases the value of variable *x* by 1. - Operation -- decreases the value of variable *x* by 1.
A statement in language Bit++ is a sequence, consisting of exactly one operation and one variable *x*. The statement is written without spaces, that is, it can only contain characters "+", "-", "X". Executing a statement means applying the operation it contains.
A programme in Bit++ is a sequence of statements, each of them needs to be executed. Executing a programme means executing all the statements it contains.
You're given a programme in language Bit++. The initial value of *x* is 0. Execute the programme and find its final value (the value of the variable when this programme is executed). | The first line contains a single integer *n* (1<=≤<=*n*<=≤<=150) — the number of statements in the programme.
Next *n* lines contain a statement each. Each statement contains exactly one operation (++ or --) and exactly one variable *x* (denoted as letter «X»). Thus, there are no empty statements. The operation and the variable can be written in any order. | Print a single integer — the final value of *x*. | [
"1\n++X\n",
"2\nX++\n--X\n"
] | [
"1\n",
"0\n"
] | none | 500 | [
{
"input": "1\n++X",
"output": "1"
},
{
"input": "2\nX++\n--X",
"output": "0"
},
{
"input": "3\n++X\n++X\n++X",
"output": "3"
},
{
"input": "2\n--X\n--X",
"output": "-2"
},
{
"input": "5\n++X\n--X\n++X\n--X\n--X",
"output": "-1"
},
{
"input": "28\nX--\n++X\nX++\nX++\nX++\n--X\n--X\nX++\nX--\n++X\nX++\n--X\nX--\nX++\nX--\n++X\n++X\nX++\nX++\nX++\nX++\n--X\n++X\n--X\n--X\n--X\n--X\nX++",
"output": "4"
},
{
"input": "94\nX++\nX++\n++X\n++X\nX--\n--X\nX++\n--X\nX++\n++X\nX++\n++X\n--X\n--X\n++X\nX++\n--X\nX--\nX--\n--X\nX--\nX--\n--X\n++X\n--X\nX--\nX--\nX++\n++X\n--X\nX--\n++X\n--X\n--X\nX--\nX--\nX++\nX++\nX--\nX++\nX--\nX--\nX--\n--X\nX--\nX--\nX--\nX++\n++X\nX--\n++X\nX++\n--X\n--X\n--X\n--X\n++X\nX--\n--X\n--X\n++X\nX--\nX--\nX++\n++X\nX++\n++X\n--X\n--X\nX--\n++X\nX--\nX--\n++X\n++X\n++X\n++X\nX++\n++X\n--X\nX++\n--X\n--X\n++X\n--X\nX++\n++X\nX++\n--X\nX--\nX--\n--X\n++X\nX++",
"output": "-10"
},
{
"input": "56\n--X\nX--\n--X\n--X\nX--\nX--\n--X\nX++\n++X\n--X\nX++\nX--\n--X\n++X\n--X\nX--\nX--\n++X\nX--\nX--\n--X\n++X\n--X\n++X\n--X\nX++\n++X\nX++\n--X\n++X\nX++\nX++\n--X\nX++\nX--\n--X\nX--\n--X\nX++\n++X\n--X\n++X\nX++\nX--\n--X\n--X\n++X\nX--\nX--\n--X\nX--\n--X\nX++\n--X\n++X\n--X",
"output": "-14"
},
{
"input": "59\nX--\n--X\nX++\n++X\nX--\n--X\n--X\n++X\n++X\n++X\n++X\nX++\n++X\n++X\nX++\n--X\nX--\nX++\n++X\n--X\nX++\n--X\n++X\nX++\n--X\n--X\nX++\nX++\n--X\nX++\nX++\nX++\nX--\nX--\n--X\nX++\nX--\nX--\n++X\nX--\nX++\n--X\nX++\nX--\nX--\nX--\nX--\n++X\n--X\nX++\nX++\nX--\nX++\n++X\nX--\nX++\nX--\nX--\n++X",
"output": "3"
},
{
"input": "87\n--X\n++X\n--X\nX++\n--X\nX--\n--X\n++X\nX--\n++X\n--X\n--X\nX++\n--X\nX--\nX++\n++X\n--X\n++X\n++X\n--X\n++X\n--X\nX--\n++X\n++X\nX--\nX++\nX++\n--X\n--X\n++X\nX--\n--X\n++X\n--X\nX++\n--X\n--X\nX--\n++X\n++X\n--X\nX--\nX--\nX--\nX--\nX--\nX++\n--X\n++X\n--X\nX++\n++X\nX++\n++X\n--X\nX++\n++X\nX--\n--X\nX++\n++X\nX++\nX++\n--X\n--X\n++X\n--X\nX++\nX++\n++X\nX++\nX++\nX++\nX++\n--X\n--X\n--X\n--X\n--X\n--X\n--X\nX--\n--X\n++X\n++X",
"output": "-5"
},
{
"input": "101\nX++\nX++\nX++\n++X\n--X\nX--\nX++\nX--\nX--\n--X\n--X\n++X\nX++\n++X\n++X\nX--\n--X\n++X\nX++\nX--\n++X\n--X\n--X\n--X\n++X\n--X\n++X\nX++\nX++\n++X\n--X\nX++\nX--\nX++\n++X\n++X\nX--\nX--\nX--\nX++\nX++\nX--\nX--\nX++\n++X\n++X\n++X\n--X\n--X\n++X\nX--\nX--\n--X\n++X\nX--\n++X\nX++\n++X\nX--\nX--\n--X\n++X\n--X\n++X\n++X\n--X\nX++\n++X\nX--\n++X\nX--\n++X\nX++\nX--\n++X\nX++\n--X\nX++\nX++\n++X\n--X\n++X\n--X\nX++\n--X\nX--\n--X\n++X\n++X\n++X\n--X\nX--\nX--\nX--\nX--\n--X\n--X\n--X\n++X\n--X\n--X",
"output": "1"
},
{
"input": "63\n--X\nX--\n++X\n--X\n++X\nX++\n--X\n--X\nX++\n--X\n--X\nX++\nX--\nX--\n--X\n++X\nX--\nX--\nX++\n++X\nX++\nX++\n--X\n--X\n++X\nX--\nX--\nX--\n++X\nX++\nX--\n--X\nX--\n++X\n++X\nX++\n++X\nX++\nX++\n--X\nX--\n++X\nX--\n--X\nX--\nX--\nX--\n++X\n++X\n++X\n++X\nX++\nX++\n++X\n--X\n--X\n++X\n++X\n++X\nX--\n++X\n++X\nX--",
"output": "1"
},
{
"input": "45\n--X\n++X\nX--\n++X\n++X\nX++\n--X\n--X\n--X\n--X\n--X\n--X\n--X\nX++\n++X\nX--\n++X\n++X\nX--\nX++\nX--\n--X\nX--\n++X\n++X\n--X\n--X\nX--\nX--\n--X\n++X\nX--\n--X\n++X\n++X\n--X\n--X\nX--\n++X\n++X\nX++\nX++\n++X\n++X\nX++",
"output": "-3"
},
{
"input": "21\n++X\nX++\n--X\nX--\nX++\n++X\n--X\nX--\nX++\nX--\nX--\nX--\nX++\n++X\nX++\n++X\n--X\nX--\n--X\nX++\n++X",
"output": "1"
},
{
"input": "100\n--X\n++X\nX++\n++X\nX--\n++X\nX--\nX++\n--X\nX++\nX--\nX--\nX--\n++X\nX--\nX++\nX++\n++X\nX++\nX++\nX++\nX++\n++X\nX++\n++X\nX--\n--X\n++X\nX--\n--X\n++X\n++X\nX--\nX++\nX++\nX++\n++X\n--X\n++X\nX++\nX--\n++X\n++X\n--X\n++X\nX--\nX--\nX--\nX++\nX--\nX--\nX++\nX++\n--X\nX++\nX++\n--X\nX--\n--X\n++X\n--X\n++X\n++X\nX--\n--X\n++X\n++X\n--X\n--X\n++X\nX++\nX--\nX++\nX--\nX++\nX++\n--X\nX--\nX--\n++X\nX--\n--X\n--X\nX++\n--X\n--X\nX--\nX--\n++X\n++X\nX--\n++X\nX++\n--X\n++X\n++X\nX++\n--X\n--X\nX++",
"output": "8"
},
{
"input": "17\nX++\nX++\n++X\n--X\n--X\n++X\n++X\n--X\nX--\nX++\nX--\n--X\n--X\nX--\n++X\nX--\nX++",
"output": "-1"
},
{
"input": "77\n++X\nX++\n--X\nX--\n--X\n--X\nX--\nX++\nX--\nX++\nX--\n++X\n--X\n--X\n--X\n--X\n++X\nX--\nX++\nX--\n--X\nX--\n--X\nX--\n++X\n--X\n++X\n++X\nX++\nX++\nX--\n--X\nX--\nX--\nX++\n--X\n--X\n++X\nX--\nX--\n++X\nX++\nX--\n++X\n--X\nX++\nX--\n++X\n++X\n++X\nX--\nX--\nX--\n--X\n++X\n++X\n++X\nX++\n--X\n--X\n++X\n--X\nX--\nX++\n++X\nX++\n++X\nX--\nX++\nX++\n--X\nX++\nX++\nX++\n--X\nX++\nX--",
"output": "-5"
},
{
"input": "21\nX--\n++X\n--X\nX--\n++X\nX--\n++X\nX--\n--X\n++X\nX++\n++X\nX++\n++X\nX--\n--X\nX++\nX++\nX--\n++X\nX--",
"output": "1"
},
{
"input": "1\nX--",
"output": "-1"
}
] | 1,699,879,770 | 2,147,483,647 | Python 3 | OK | TESTS | 36 | 46 | 0 | #n is number of statement in the program
x=0
n=int(input())
for i in range(n):
stmt=input().lower()
if stmt=='++x' or stmt=='x++':
x+=1
elif stmt=='--x' or stmt=='x--':
x+=-1
print(x) | Title: Bit++
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The classic programming language of Bitland is Bit++. This language is so peculiar and complicated.
The language is that peculiar as it has exactly one variable, called *x*. Also, there are two operations:
- Operation ++ increases the value of variable *x* by 1. - Operation -- decreases the value of variable *x* by 1.
A statement in language Bit++ is a sequence, consisting of exactly one operation and one variable *x*. The statement is written without spaces, that is, it can only contain characters "+", "-", "X". Executing a statement means applying the operation it contains.
A programme in Bit++ is a sequence of statements, each of them needs to be executed. Executing a programme means executing all the statements it contains.
You're given a programme in language Bit++. The initial value of *x* is 0. Execute the programme and find its final value (the value of the variable when this programme is executed).
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=150) — the number of statements in the programme.
Next *n* lines contain a statement each. Each statement contains exactly one operation (++ or --) and exactly one variable *x* (denoted as letter «X»). Thus, there are no empty statements. The operation and the variable can be written in any order.
Output Specification:
Print a single integer — the final value of *x*.
Demo Input:
['1\n++X\n', '2\nX++\n--X\n']
Demo Output:
['1\n', '0\n']
Note:
none | ```python
#n is number of statement in the program
x=0
n=int(input())
for i in range(n):
stmt=input().lower()
if stmt=='++x' or stmt=='x++':
x+=1
elif stmt=='--x' or stmt=='x--':
x+=-1
print(x)
``` | 3 |
|
340 | C | Tourist Problem | PROGRAMMING | 1,600 | [
"combinatorics",
"implementation",
"math"
] | null | null | Iahub is a big fan of tourists. He wants to become a tourist himself, so he planned a trip. There are *n* destinations on a straight road that Iahub wants to visit. Iahub starts the excursion from kilometer 0. The *n* destinations are described by a non-negative integers sequence *a*1, *a*2, ..., *a**n*. The number *a**k* represents that the *k*th destination is at distance *a**k* kilometers from the starting point. No two destinations are located in the same place.
Iahub wants to visit each destination only once. Note that, crossing through a destination is not considered visiting, unless Iahub explicitly wants to visit it at that point. Also, after Iahub visits his last destination, he doesn't come back to kilometer 0, as he stops his trip at the last destination.
The distance between destination located at kilometer *x* and next destination, located at kilometer *y*, is |*x*<=-<=*y*| kilometers. We call a "route" an order of visiting the destinations. Iahub can visit destinations in any order he wants, as long as he visits all *n* destinations and he doesn't visit a destination more than once.
Iahub starts writing out on a paper all possible routes and for each of them, he notes the total distance he would walk. He's interested in the average number of kilometers he would walk by choosing a route. As he got bored of writing out all the routes, he asks you to help him. | The first line contains integer *n* (2<=≤<=*n*<=≤<=105). Next line contains *n* distinct integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=107). | Output two integers — the numerator and denominator of a fraction which is equal to the wanted average number. The fraction must be irreducible. | [
"3\n2 3 5\n"
] | [
"22 3"
] | Consider 6 possible routes:
- [2, 3, 5]: total distance traveled: |2 – 0| + |3 – 2| + |5 – 3| = 5; - [2, 5, 3]: |2 – 0| + |5 – 2| + |3 – 5| = 7; - [3, 2, 5]: |3 – 0| + |2 – 3| + |5 – 2| = 7; - [3, 5, 2]: |3 – 0| + |5 – 3| + |2 – 5| = 8; - [5, 2, 3]: |5 – 0| + |2 – 5| + |3 – 2| = 9; - [5, 3, 2]: |5 – 0| + |3 – 5| + |2 – 3| = 8.
The average travel distance is <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/29119d3733c79f70eb2d77186ac1606bf938508a.png" style="max-width: 100.0%;max-height: 100.0%;"/> = <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ee9d5516ed2ca1d2b65ed21f8a64f58f94954c30.png" style="max-width: 100.0%;max-height: 100.0%;"/> = <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ed5cc8cb7dd43cfb27f2459586062538e44de7bd.png" style="max-width: 100.0%;max-height: 100.0%;"/>. | 2,000 | [
{
"input": "3\n2 3 5",
"output": "22 3"
},
{
"input": "4\n1 5 77 2",
"output": "547 4"
},
{
"input": "5\n3 3842 288 199 334",
"output": "35918 5"
},
{
"input": "7\n1 2 3 40 52 33 86",
"output": "255 1"
},
{
"input": "7\n1 10 100 1000 10000 1000000 10000000",
"output": "139050619 7"
},
{
"input": "6\n3835302 971984 8706888 1080445 2224695 1093317",
"output": "114053569 6"
},
{
"input": "40\n8995197 7520501 942559 8012058 3749344 3471059 9817796 3187774 4735591 6477783 7024598 3155420 6039802 2879311 2738670 5930138 4604402 7772492 6089337 317953 4598621 6924769 455347 4360383 1441848 9189601 1838826 5027295 9248947 7562916 8341568 4690450 6877041 507074 2390889 8405736 4562116 2755285 3032168 7770391",
"output": "644565018 5"
},
{
"input": "50\n3987477 8934938 4067156 6712855 7269334 5039822 9533601 9335400 5992073 2619268 438734 8620973 4347619 4307947 2249161 815221 7615258 8244100 8341666 5908546 6646952 4812769 6215114 7479369 6290438 5623785 6466133 9953199 3525873 4326034 3510072 8117068 2342953 1717542 9766539 651627 9541804 4518782 7049159 1159304 2892927 8106441 2222088 8240016 6058981 3924422 743755 4621476 1600677 4234884",
"output": "812321046 5"
},
{
"input": "2\n5555 1242323",
"output": "1860707 1"
},
{
"input": "3\n233232 24332 9010101",
"output": "15070247 1"
},
{
"input": "3\n4054378 7133183 7979825",
"output": "11623058 1"
},
{
"input": "3\n4663018 4080080 6848370",
"output": "26664628 3"
},
{
"input": "4\n5997728 7557181 7228856 8086019",
"output": "10514045 1"
},
{
"input": "4\n2895920 1685207 308573 3045658",
"output": "13389647 2"
},
{
"input": "5\n1789943 1662788 8254265 2248046 2588605",
"output": "72470111 5"
},
{
"input": "5\n6667561 1662704 5626810 4453455 7011856",
"output": "77072026 5"
}
] | 1,591,173,432 | 2,147,483,647 | Python 3 | OK | TESTS | 43 | 528 | 7,577,600 | #!/usr/bin/env python3
# -*- coding: utf-8 -*-
"""
Created on Wed Jun 3 11:57:46 2020
@author: shailesh
"""
from math import gcd
def reduce_fraction(x,y):
d = gcd(x,y)
x = x//d
y = y//d
return x,y
N = int(input())
A = [int(i) for i in input().split()]
A.sort()
d0 = A[0]
sum_val = 0
for i in range(N-1):
m_bf = i+2
m_af = N - i - 1
d = A[i+1]-A[i]
# d = 1
sum_val +=m_af*(2*m_bf - 1)*d
# print(A[i],A[i+1],sum_val)
numerator = N*d0 + sum_val
denominator = N
numerator,denominator = reduce_fraction(numerator,denominator)
print(numerator,denominator)
#from itertools import permutations
#perms = list(permutations([2,3,5]))
#
#perms = [(0,) + perm for perm in perms]
#
#d = {}
#d['02'] = 0
#d['23'] = 0
#d['35'] = 0
#for perm in perms:
# for i in range(len(perm)-1):
#
# start_end = [perm[i],perm[i+1]]
# start_end.sort()
# rng = range(start_end[0],start_end[1]+1)
# if 0 in rng and 2 in rng:
# d['02'] +=1
# if 2 in rng and 3 in rng:
# d['23'] += 1
# if 3 in rng and 5 in rng:
# d['35'] +=1
| Title: Tourist Problem
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Iahub is a big fan of tourists. He wants to become a tourist himself, so he planned a trip. There are *n* destinations on a straight road that Iahub wants to visit. Iahub starts the excursion from kilometer 0. The *n* destinations are described by a non-negative integers sequence *a*1, *a*2, ..., *a**n*. The number *a**k* represents that the *k*th destination is at distance *a**k* kilometers from the starting point. No two destinations are located in the same place.
Iahub wants to visit each destination only once. Note that, crossing through a destination is not considered visiting, unless Iahub explicitly wants to visit it at that point. Also, after Iahub visits his last destination, he doesn't come back to kilometer 0, as he stops his trip at the last destination.
The distance between destination located at kilometer *x* and next destination, located at kilometer *y*, is |*x*<=-<=*y*| kilometers. We call a "route" an order of visiting the destinations. Iahub can visit destinations in any order he wants, as long as he visits all *n* destinations and he doesn't visit a destination more than once.
Iahub starts writing out on a paper all possible routes and for each of them, he notes the total distance he would walk. He's interested in the average number of kilometers he would walk by choosing a route. As he got bored of writing out all the routes, he asks you to help him.
Input Specification:
The first line contains integer *n* (2<=≤<=*n*<=≤<=105). Next line contains *n* distinct integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=107).
Output Specification:
Output two integers — the numerator and denominator of a fraction which is equal to the wanted average number. The fraction must be irreducible.
Demo Input:
['3\n2 3 5\n']
Demo Output:
['22 3']
Note:
Consider 6 possible routes:
- [2, 3, 5]: total distance traveled: |2 – 0| + |3 – 2| + |5 – 3| = 5; - [2, 5, 3]: |2 – 0| + |5 – 2| + |3 – 5| = 7; - [3, 2, 5]: |3 – 0| + |2 – 3| + |5 – 2| = 7; - [3, 5, 2]: |3 – 0| + |5 – 3| + |2 – 5| = 8; - [5, 2, 3]: |5 – 0| + |2 – 5| + |3 – 2| = 9; - [5, 3, 2]: |5 – 0| + |3 – 5| + |2 – 3| = 8.
The average travel distance is <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/29119d3733c79f70eb2d77186ac1606bf938508a.png" style="max-width: 100.0%;max-height: 100.0%;"/> = <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ee9d5516ed2ca1d2b65ed21f8a64f58f94954c30.png" style="max-width: 100.0%;max-height: 100.0%;"/> = <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ed5cc8cb7dd43cfb27f2459586062538e44de7bd.png" style="max-width: 100.0%;max-height: 100.0%;"/>. | ```python
#!/usr/bin/env python3
# -*- coding: utf-8 -*-
"""
Created on Wed Jun 3 11:57:46 2020
@author: shailesh
"""
from math import gcd
def reduce_fraction(x,y):
d = gcd(x,y)
x = x//d
y = y//d
return x,y
N = int(input())
A = [int(i) for i in input().split()]
A.sort()
d0 = A[0]
sum_val = 0
for i in range(N-1):
m_bf = i+2
m_af = N - i - 1
d = A[i+1]-A[i]
# d = 1
sum_val +=m_af*(2*m_bf - 1)*d
# print(A[i],A[i+1],sum_val)
numerator = N*d0 + sum_val
denominator = N
numerator,denominator = reduce_fraction(numerator,denominator)
print(numerator,denominator)
#from itertools import permutations
#perms = list(permutations([2,3,5]))
#
#perms = [(0,) + perm for perm in perms]
#
#d = {}
#d['02'] = 0
#d['23'] = 0
#d['35'] = 0
#for perm in perms:
# for i in range(len(perm)-1):
#
# start_end = [perm[i],perm[i+1]]
# start_end.sort()
# rng = range(start_end[0],start_end[1]+1)
# if 0 in rng and 2 in rng:
# d['02'] +=1
# if 2 in rng and 3 in rng:
# d['23'] += 1
# if 3 in rng and 5 in rng:
# d['35'] +=1
``` | 3 |
|
190 | A | Vasya and the Bus | PROGRAMMING | 1,100 | [
"greedy",
"math"
] | null | null | One day Vasya heard a story: "In the city of High Bertown a bus number 62 left from the bus station. It had *n* grown-ups and *m* kids..."
The latter events happen to be of no importance to us. Vasya is an accountant and he loves counting money. So he wondered what maximum and minimum sum of money these passengers could have paid for the ride.
The bus fare equals one berland ruble in High Bertown. However, not everything is that easy — no more than one child can ride for free with each grown-up passenger. That means that a grown-up passenger who rides with his *k* (*k*<=><=0) children, pays overall *k* rubles: a ticket for himself and (*k*<=-<=1) tickets for his children. Also, a grown-up can ride without children, in this case he only pays one ruble.
We know that in High Bertown children can't ride in a bus unaccompanied by grown-ups.
Help Vasya count the minimum and the maximum sum in Berland rubles, that all passengers of this bus could have paid in total. | The input file consists of a single line containing two space-separated numbers *n* and *m* (0<=≤<=*n*,<=*m*<=≤<=105) — the number of the grown-ups and the number of the children in the bus, correspondingly. | If *n* grown-ups and *m* children could have ridden in the bus, then print on a single line two space-separated integers — the minimum and the maximum possible total bus fare, correspondingly.
Otherwise, print "Impossible" (without the quotes). | [
"1 2\n",
"0 5\n",
"2 2\n"
] | [
"2 2",
"Impossible",
"2 3"
] | In the first sample a grown-up rides with two children and pays two rubles.
In the second sample there are only children in the bus, so the situation is impossible.
In the third sample there are two cases: - Each of the two grown-ups rides with one children and pays one ruble for the tickets. In this case the passengers pay two rubles in total. - One of the grown-ups ride with two children's and pays two rubles, the another one rides alone and pays one ruble for himself. So, they pay three rubles in total. | 500 | [
{
"input": "1 2",
"output": "2 2"
},
{
"input": "0 5",
"output": "Impossible"
},
{
"input": "2 2",
"output": "2 3"
},
{
"input": "2 7",
"output": "7 8"
},
{
"input": "4 10",
"output": "10 13"
},
{
"input": "6 0",
"output": "6 6"
},
{
"input": "7 1",
"output": "7 7"
},
{
"input": "0 0",
"output": "0 0"
},
{
"input": "71 24",
"output": "71 94"
},
{
"input": "16 70",
"output": "70 85"
},
{
"input": "0 1",
"output": "Impossible"
},
{
"input": "1 0",
"output": "1 1"
},
{
"input": "1 1",
"output": "1 1"
},
{
"input": "63 82",
"output": "82 144"
},
{
"input": "8 26",
"output": "26 33"
},
{
"input": "21 27",
"output": "27 47"
},
{
"input": "0 38",
"output": "Impossible"
},
{
"input": "46 84",
"output": "84 129"
},
{
"input": "59 96",
"output": "96 154"
},
{
"input": "63028 0",
"output": "63028 63028"
},
{
"input": "9458 0",
"output": "9458 9458"
},
{
"input": "80236 0",
"output": "80236 80236"
},
{
"input": "26666 0",
"output": "26666 26666"
},
{
"input": "59617 0",
"output": "59617 59617"
},
{
"input": "0 6048",
"output": "Impossible"
},
{
"input": "63028 28217",
"output": "63028 91244"
},
{
"input": "9458 39163",
"output": "39163 48620"
},
{
"input": "80236 14868",
"output": "80236 95103"
},
{
"input": "26666 52747",
"output": "52747 79412"
},
{
"input": "59617 28452",
"output": "59617 88068"
},
{
"input": "6048 4158",
"output": "6048 10205"
},
{
"input": "76826 4210",
"output": "76826 81035"
},
{
"input": "23256 15156",
"output": "23256 38411"
},
{
"input": "56207 53035",
"output": "56207 109241"
},
{
"input": "2637 28740",
"output": "28740 31376"
},
{
"input": "73415 4445",
"output": "73415 77859"
},
{
"input": "82019 4498",
"output": "82019 86516"
},
{
"input": "28449 80204",
"output": "80204 108652"
},
{
"input": "99227 53323",
"output": "99227 152549"
},
{
"input": "45657 29028",
"output": "45657 74684"
},
{
"input": "78608 4733",
"output": "78608 83340"
},
{
"input": "25038 4786",
"output": "25038 29823"
},
{
"input": "95816 80492",
"output": "95816 176307"
},
{
"input": "42246 94024",
"output": "94024 136269"
},
{
"input": "0 100000",
"output": "Impossible"
},
{
"input": "100000 0",
"output": "100000 100000"
},
{
"input": "1 100000",
"output": "100000 100000"
},
{
"input": "100000 1",
"output": "100000 100000"
},
{
"input": "63028 63028",
"output": "63028 126055"
},
{
"input": "9458 9458",
"output": "9458 18915"
},
{
"input": "80236 80236",
"output": "80236 160471"
},
{
"input": "26666 26666",
"output": "26666 53331"
},
{
"input": "59617 59617",
"output": "59617 119233"
},
{
"input": "100000 100000",
"output": "100000 199999"
}
] | 1,648,888,039 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 1 | 92 | 0 | a,c=map(int,input().split())
if a==0:
print('IMPOSSIBLE')
else:
print(a+(c-a)*int(c>a),a+(c-1)*int(c>1)) | Title: Vasya and the Bus
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Vasya heard a story: "In the city of High Bertown a bus number 62 left from the bus station. It had *n* grown-ups and *m* kids..."
The latter events happen to be of no importance to us. Vasya is an accountant and he loves counting money. So he wondered what maximum and minimum sum of money these passengers could have paid for the ride.
The bus fare equals one berland ruble in High Bertown. However, not everything is that easy — no more than one child can ride for free with each grown-up passenger. That means that a grown-up passenger who rides with his *k* (*k*<=><=0) children, pays overall *k* rubles: a ticket for himself and (*k*<=-<=1) tickets for his children. Also, a grown-up can ride without children, in this case he only pays one ruble.
We know that in High Bertown children can't ride in a bus unaccompanied by grown-ups.
Help Vasya count the minimum and the maximum sum in Berland rubles, that all passengers of this bus could have paid in total.
Input Specification:
The input file consists of a single line containing two space-separated numbers *n* and *m* (0<=≤<=*n*,<=*m*<=≤<=105) — the number of the grown-ups and the number of the children in the bus, correspondingly.
Output Specification:
If *n* grown-ups and *m* children could have ridden in the bus, then print on a single line two space-separated integers — the minimum and the maximum possible total bus fare, correspondingly.
Otherwise, print "Impossible" (without the quotes).
Demo Input:
['1 2\n', '0 5\n', '2 2\n']
Demo Output:
['2 2', 'Impossible', '2 3']
Note:
In the first sample a grown-up rides with two children and pays two rubles.
In the second sample there are only children in the bus, so the situation is impossible.
In the third sample there are two cases: - Each of the two grown-ups rides with one children and pays one ruble for the tickets. In this case the passengers pay two rubles in total. - One of the grown-ups ride with two children's and pays two rubles, the another one rides alone and pays one ruble for himself. So, they pay three rubles in total. | ```python
a,c=map(int,input().split())
if a==0:
print('IMPOSSIBLE')
else:
print(a+(c-a)*int(c>a),a+(c-1)*int(c>1))
``` | 0 |
|
894 | A | QAQ | PROGRAMMING | 800 | [
"brute force",
"dp"
] | null | null | "QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth.
Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!).
Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact. | The only line contains a string of length *n* (1<=≤<=*n*<=≤<=100). It's guaranteed that the string only contains uppercase English letters. | Print a single integer — the number of subsequences "QAQ" in the string. | [
"QAQAQYSYIOIWIN\n",
"QAQQQZZYNOIWIN\n"
] | [
"4\n",
"3\n"
] | In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN". | 500 | [
{
"input": "QAQAQYSYIOIWIN",
"output": "4"
},
{
"input": "QAQQQZZYNOIWIN",
"output": "3"
},
{
"input": "QA",
"output": "0"
},
{
"input": "IAQVAQZLQBQVQFTQQQADAQJA",
"output": "24"
},
{
"input": "QQAAQASGAYAAAAKAKAQIQEAQAIAAIAQQQQQ",
"output": "378"
},
{
"input": "AMVFNFJIAVNQJWIVONQOAOOQSNQSONOASONAONQINAONAOIQONANOIQOANOQINAONOQINAONOXJCOIAQOAOQAQAQAQAQWWWAQQAQ",
"output": "1077"
},
{
"input": "AAQQAXBQQBQQXBNQRJAQKQNAQNQVDQASAGGANQQQQTJFFQQQTQQA",
"output": "568"
},
{
"input": "KAZXAVLPJQBQVQQQQQAPAQQGQTQVZQAAAOYA",
"output": "70"
},
{
"input": "W",
"output": "0"
},
{
"input": "DBA",
"output": "0"
},
{
"input": "RQAWNACASAAKAGAAAAQ",
"output": "10"
},
{
"input": "QJAWZAAOAAGIAAAAAOQATASQAEAAAAQFQQHPA",
"output": "111"
},
{
"input": "QQKWQAQAAAAAAAAGAAVAQUEQQUMQMAQQQNQLAMAAAUAEAAEMAAA",
"output": "411"
},
{
"input": "QQUMQAYAUAAGWAAAQSDAVAAQAAAASKQJJQQQQMAWAYYAAAAAAEAJAXWQQ",
"output": "625"
},
{
"input": "QORZOYAQ",
"output": "1"
},
{
"input": "QCQAQAGAWAQQQAQAVQAQQQQAQAQQQAQAAATQAAVAAAQQQQAAAUUQAQQNQQWQQWAQAAQQKQYAQAAQQQAAQRAQQQWBQQQQAPBAQGQA",
"output": "13174"
},
{
"input": "QQAQQAKQFAQLQAAWAMQAZQAJQAAQQOACQQAAAYANAQAQQAQAAQQAOBQQJQAQAQAQQQAAAAABQQQAVNZAQQQQAMQQAFAAEAQAQHQT",
"output": "10420"
},
{
"input": "AQEGQHQQKQAQQPQKAQQQAAAAQQQAQEQAAQAAQAQFSLAAQQAQOQQAVQAAAPQQAWAQAQAFQAXAQQQQTRLOQAQQJQNQXQQQQSQVDQQQ",
"output": "12488"
},
{
"input": "QNQKQQQLASQBAVQQQQAAQQOQRJQQAQQQEQZUOANAADAAQQJAQAQARAAAQQQEQBHTQAAQAAAAQQMKQQQIAOJJQQAQAAADADQUQQQA",
"output": "9114"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "35937"
},
{
"input": "AMQQAAQAAQAAAAAAQQQBOAAANAAKQJCYQAE",
"output": "254"
},
{
"input": "AYQBAEQGAQEOAKGIXLQJAIAKQAAAQPUAJAKAATFWQQAOQQQUFQYAQQMQHOKAAJXGFCARAQSATHAUQQAATQJJQDQRAANQQAE",
"output": "2174"
},
{
"input": "AAQXAAQAYQAAAAGAQHVQYAGIVACADFAAQAAAAQZAAQMAKZAADQAQDAAQDAAAMQQOXYAQQQAKQBAAQQKAXQBJZDDLAAHQQ",
"output": "2962"
},
{
"input": "AYQQYAVAMNIAUAAKBBQVACWKTQSAQZAAQAAASZJAWBCAALAARHACQAKQQAQAARPAQAAQAQAAZQUSHQAMFVFZQQQQSAQQXAA",
"output": "2482"
},
{
"input": "LQMAQQARQAQBJQQQAGAAZQQXALQQAARQAQQQQAAQQAQQQAQQCAQQAQQAYQQQRAAZATQALYQQAAHHAAQHAAAAAAAAQQMAAQNAKQ",
"output": "7768"
},
{
"input": "MAQQWAQOYQMAAAQAQPQZAOAAQAUAQNAAQAAAITQSAQAKAQKAQQWSQAAQQAGUCDQMQWKQUXKWQQAAQQAAQQZQDQQQAABXQUUXQOA",
"output": "5422"
},
{
"input": "QTAAQDAQXAQQJQQQGAAAQQQQSBQZKAQQAQQQQEAQNUQBZCQLYQZQEQQAAQHQVAORKQVAQYQNASZQAARZAAGAAAAOQDCQ",
"output": "3024"
},
{
"input": "QQWAQQGQQUZQQQLZAAQYQXQVAQFQUAQZUQZZQUKBHSHTQYLQAOQXAQQGAQQTQOAQARQADAJRAAQPQAQQUQAUAMAUVQAAAQQAWQ",
"output": "4527"
},
{
"input": "QQAAQQAQVAQZQQQQAOEAQZPQIBQZACQQAFQQLAAQDATZQANHKYQQAQTAAFQRQAIQAJPWQAQTEIRXAEQQAYWAAAUKQQAQAQQQSQQH",
"output": "6416"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAAAA",
"output": "14270"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQ",
"output": "13136"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA",
"output": "14270"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQQAA",
"output": "14231"
},
{
"input": "QQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA",
"output": "15296"
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "0"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "0"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "0"
},
{
"input": "QAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQA",
"output": "20825"
},
{
"input": "AQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ",
"output": "20825"
},
{
"input": "Q",
"output": "0"
},
{
"input": "A",
"output": "0"
},
{
"input": "FFF",
"output": "0"
},
{
"input": "AAAAAA",
"output": "0"
}
] | 1,671,476,320 | 2,147,483,647 | PyPy 3 | OK | TESTS | 43 | 93 | 1,536,000 | a = input()
n = len(a)
c = 0
for i in range(n):
if a[i] == 'Q':
for j in range(i + 1, n):
if a[j] == 'A':
for k in range(j + 1, n):
if a[k] == 'Q':
c += 1
print(c) | Title: QAQ
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
"QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth.
Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!).
Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact.
Input Specification:
The only line contains a string of length *n* (1<=≤<=*n*<=≤<=100). It's guaranteed that the string only contains uppercase English letters.
Output Specification:
Print a single integer — the number of subsequences "QAQ" in the string.
Demo Input:
['QAQAQYSYIOIWIN\n', 'QAQQQZZYNOIWIN\n']
Demo Output:
['4\n', '3\n']
Note:
In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN". | ```python
a = input()
n = len(a)
c = 0
for i in range(n):
if a[i] == 'Q':
for j in range(i + 1, n):
if a[j] == 'A':
for k in range(j + 1, n):
if a[k] == 'Q':
c += 1
print(c)
``` | 3 |
|
49 | A | Sleuth | PROGRAMMING | 800 | [
"implementation"
] | A. Sleuth | 2 | 256 | Vasya plays the sleuth with his friends. The rules of the game are as follows: those who play for the first time, that is Vasya is the sleuth, he should investigate a "crime" and find out what is happening. He can ask any questions whatsoever that can be answered with "Yes" or "No". All the rest agree beforehand to answer the questions like that: if the question’s last letter is a vowel, they answer "Yes" and if the last letter is a consonant, they answer "No". Of course, the sleuth knows nothing about it and his task is to understand that.
Unfortunately, Vasya is not very smart. After 5 hours of endless stupid questions everybody except Vasya got bored. That’s why Vasya’s friends ask you to write a program that would give answers instead of them.
The English alphabet vowels are: A, E, I, O, U, Y
The English alphabet consonants are: B, C, D, F, G, H, J, K, L, M, N, P, Q, R, S, T, V, W, X, Z | The single line contains a question represented by a non-empty line consisting of large and small Latin letters, spaces and a question mark. The line length does not exceed 100. It is guaranteed that the question mark occurs exactly once in the line — as the last symbol and that the line contains at least one letter. | Print answer for the question in a single line: YES if the answer is "Yes", NO if the answer is "No".
Remember that in the reply to the question the last letter, not the last character counts. I. e. the spaces and the question mark do not count as letters. | [
"Is it a melon?\n",
"Is it an apple?\n",
"Is it a banana ?\n",
"Is it an apple and a banana simultaneouSLY?\n"
] | [
"NO\n",
"YES\n",
"YES\n",
"YES\n"
] | none | 500 | [
{
"input": "Is it a melon?",
"output": "NO"
},
{
"input": "Is it an apple?",
"output": "YES"
},
{
"input": " Is it a banana ?",
"output": "YES"
},
{
"input": "Is it an apple and a banana simultaneouSLY?",
"output": "YES"
},
{
"input": "oHtSbDwzHb?",
"output": "NO"
},
{
"input": "sZecYdUvZHrXx?",
"output": "NO"
},
{
"input": "uMtXK?",
"output": "NO"
},
{
"input": "U?",
"output": "YES"
},
{
"input": "aqFDkCUKeHMyvZFcAyWlMUSQTFomtaWjoKLVyxLCw vcufPBFbaljOuHWiDCROYTcmbgzbaqHXKPOYEbuEtRqqoxBbOETCsQzhw?",
"output": "NO"
},
{
"input": "dJcNqQiFXzcbsj fItCpBLyXOnrSBPebwyFHlxUJHqCUzzCmcAvMiKL NunwOXnKeIxUZmBVwiCUfPkjRAkTPbkYCmwRRnDSLaz?",
"output": "NO"
},
{
"input": "gxzXbdcAQMuFKuuiPohtMgeypr wpDIoDSyOYTdvylcg SoEBZjnMHHYZGEqKgCgBeTbyTwyGuPZxkxsnSczotBdYyfcQsOVDVC?",
"output": "NO"
},
{
"input": "FQXBisXaJFMiHFQlXjixBDMaQuIbyqSBKGsBfTmBKCjszlGVZxEOqYYqRTUkGpSDDAoOXyXcQbHcPaegeOUBNeSD JiKOdECPOF?",
"output": "NO"
},
{
"input": "YhCuZnrWUBEed?",
"output": "NO"
},
{
"input": "hh?",
"output": "NO"
},
{
"input": "whU?",
"output": "YES"
},
{
"input": "fgwg?",
"output": "NO"
},
{
"input": "GlEmEPKrYcOnBNJUIFjszWUyVdvWw DGDjoCMtRJUburkPToCyDrOtMr?",
"output": "NO"
},
{
"input": "n?",
"output": "NO"
},
{
"input": "BueDOlxgzeNlxrzRrMbKiQdmGujEKmGxclvaPpTuHmTqBp?",
"output": "NO"
},
{
"input": "iehvZNQXDGCuVmJPOEysLyUryTdfaIxIuTzTadDbqRQGoCLXkxnyfWSGoLXebNnQQNTqAQJebbyYvHOfpUnXeWdjx?",
"output": "NO"
},
{
"input": " J ?",
"output": "NO"
},
{
"input": " j ?",
"output": "NO"
},
{
"input": " o ?",
"output": "YES"
},
{
"input": " T ?",
"output": "NO"
},
{
"input": " q ?",
"output": "NO"
},
{
"input": " j ?",
"output": "NO"
},
{
"input": " c ?",
"output": "NO"
},
{
"input": " B ?",
"output": "NO"
},
{
"input": "LuhxDHVwMPTtUIUMIQTuQETgXCOQPsfdFlyHvpfOVedjUTpGLAZGOHloIjJJtOLAlHPivzA?",
"output": "YES"
},
{
"input": "wmztmzFfwbGyOmNHENUFMTsFEMWYA?",
"output": "YES"
},
{
"input": "wGsfZCSwN PEUhNUrLfABrxA?",
"output": "YES"
},
{
"input": "mCDHENXjYbgMdBimAdPnewaHfpGWowjWrVAdvWczjw iDcUbyzMsmsnwbviiKiAyGVA?",
"output": "YES"
},
{
"input": "ARIWnwqFqxsQXsXXzHqvFjxOCttAGPUzDtWzsenPYdNXuFOIUGYZsLLK IaoxiyjBBRThoelwdPTkuCQfcBLUEJpCPIrVZlvUWA?",
"output": "YES"
},
{
"input": " PslvVpgpN BXkMFBEVXsyZFIQbBEFxGkYTeXKrOdcmhbiTUatYRUoYAayrchqbksswIlfIjerZPqptvCGnMUhyrQSvwltRhFzA?",
"output": "YES"
},
{
"input": "HpBkttwSjBXDmyleGiRWNUMPaAIE uzTrp KJDzaUiCdsMYOoWKHoUhWUoecCPmACymMUUbGav UMRpCytPETwNFAObZJA?",
"output": "YES"
}
] | 1,657,193,572 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 92 | 0 | a=input()
if a[len(a)-2]=="A" or a[len(a)-2]=="a" or a[len(a)-2]=="E" or a[len(a)-2]=="e" or a[len(a)-2]=="Y" or a[len(a)-2]=="y" or a[len(a)-2]=="U" or a[len(a)-2]=="u" or a[len(a)-2]=="I" or a[len(a)-2]=="i" or a[len(a)-2]=="O" or a[len(a)-2]=="o":
print('YES')
else:
print('NO')
| Title: Sleuth
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya plays the sleuth with his friends. The rules of the game are as follows: those who play for the first time, that is Vasya is the sleuth, he should investigate a "crime" and find out what is happening. He can ask any questions whatsoever that can be answered with "Yes" or "No". All the rest agree beforehand to answer the questions like that: if the question’s last letter is a vowel, they answer "Yes" and if the last letter is a consonant, they answer "No". Of course, the sleuth knows nothing about it and his task is to understand that.
Unfortunately, Vasya is not very smart. After 5 hours of endless stupid questions everybody except Vasya got bored. That’s why Vasya’s friends ask you to write a program that would give answers instead of them.
The English alphabet vowels are: A, E, I, O, U, Y
The English alphabet consonants are: B, C, D, F, G, H, J, K, L, M, N, P, Q, R, S, T, V, W, X, Z
Input Specification:
The single line contains a question represented by a non-empty line consisting of large and small Latin letters, spaces and a question mark. The line length does not exceed 100. It is guaranteed that the question mark occurs exactly once in the line — as the last symbol and that the line contains at least one letter.
Output Specification:
Print answer for the question in a single line: YES if the answer is "Yes", NO if the answer is "No".
Remember that in the reply to the question the last letter, not the last character counts. I. e. the spaces and the question mark do not count as letters.
Demo Input:
['Is it a melon?\n', 'Is it an apple?\n', 'Is it a banana ?\n', 'Is it an apple and a banana simultaneouSLY?\n']
Demo Output:
['NO\n', 'YES\n', 'YES\n', 'YES\n']
Note:
none | ```python
a=input()
if a[len(a)-2]=="A" or a[len(a)-2]=="a" or a[len(a)-2]=="E" or a[len(a)-2]=="e" or a[len(a)-2]=="Y" or a[len(a)-2]=="y" or a[len(a)-2]=="U" or a[len(a)-2]=="u" or a[len(a)-2]=="I" or a[len(a)-2]=="i" or a[len(a)-2]=="O" or a[len(a)-2]=="o":
print('YES')
else:
print('NO')
``` | 0 |
650 | A | Watchmen | PROGRAMMING | 1,400 | [
"data structures",
"geometry",
"math"
] | null | null | Watchmen are in a danger and Doctor Manhattan together with his friend Daniel Dreiberg should warn them as soon as possible. There are *n* watchmen on a plane, the *i*-th watchman is located at point (*x**i*,<=*y**i*).
They need to arrange a plan, but there are some difficulties on their way. As you know, Doctor Manhattan considers the distance between watchmen *i* and *j* to be |*x**i*<=-<=*x**j*|<=+<=|*y**i*<=-<=*y**j*|. Daniel, as an ordinary person, calculates the distance using the formula .
The success of the operation relies on the number of pairs (*i*,<=*j*) (1<=≤<=*i*<=<<=*j*<=≤<=*n*), such that the distance between watchman *i* and watchmen *j* calculated by Doctor Manhattan is equal to the distance between them calculated by Daniel. You were asked to compute the number of such pairs. | The first line of the input contains the single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of watchmen.
Each of the following *n* lines contains two integers *x**i* and *y**i* (|*x**i*|,<=|*y**i*|<=≤<=109).
Some positions may coincide. | Print the number of pairs of watchmen such that the distance between them calculated by Doctor Manhattan is equal to the distance calculated by Daniel. | [
"3\n1 1\n7 5\n1 5\n",
"6\n0 0\n0 1\n0 2\n-1 1\n0 1\n1 1\n"
] | [
"2\n",
"11\n"
] | In the first sample, the distance between watchman 1 and watchman 2 is equal to |1 - 7| + |1 - 5| = 10 for Doctor Manhattan and <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/bcb5b7064b5f02088da0fdcf677e6fda495dd0df.png" style="max-width: 100.0%;max-height: 100.0%;"/> for Daniel. For pairs (1, 1), (1, 5) and (7, 5), (1, 5) Doctor Manhattan and Daniel will calculate the same distances. | 500 | [
{
"input": "3\n1 1\n7 5\n1 5",
"output": "2"
},
{
"input": "6\n0 0\n0 1\n0 2\n-1 1\n0 1\n1 1",
"output": "11"
},
{
"input": "10\n46 -55\n46 45\n46 45\n83 -55\n46 45\n83 -55\n46 45\n83 45\n83 45\n46 -55",
"output": "33"
},
{
"input": "1\n-5 -90",
"output": "0"
},
{
"input": "2\n315 845\n-669 -762",
"output": "0"
},
{
"input": "3\n8911 7861\n-6888 7861\n8911 7861",
"output": "3"
},
{
"input": "2\n-1 1000000000\n0 -1",
"output": "0"
},
{
"input": "2\n1000000000 0\n-7 1",
"output": "0"
},
{
"input": "2\n1 4\n2 1",
"output": "0"
},
{
"input": "2\n1 0\n0 2333333",
"output": "0"
},
{
"input": "2\n2 1\n1 2",
"output": "0"
},
{
"input": "2\n1 1000000000\n2 -1000000000",
"output": "0"
},
{
"input": "2\n0 1000000000\n1 -7",
"output": "0"
},
{
"input": "2\n1 0\n0 19990213",
"output": "0"
}
] | 1,463,814,130 | 2,147,483,647 | Python 3 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | type
point = record
x, y: int64;
p: boolean;
end;
var
a, b, c, p, i, j: int64;
ar: array [1..300000] of point;
procedure qsort(a, b: int64);
var
d, e: int64;
c, x: point;
begin
if a < b then begin
d := a;
e := b;
x := ar[random(b - a) + a];
while d <= e do begin
while ar[d].x < x.x do inc(d);
while ar[e].x > x.x do dec(e);
if d <= e then begin
c := ar[d];
ar[d] := ar[e];
ar[e] := c;
inc(d);
dec(e);
end;
end;
qsort(a, e);
qsort(d, b);
end;
end;
procedure qsort1(a, b: int64);
var
d, e: int64;
c, x: point;
begin
if a < b then begin
d := a;
e := b;
x := ar[random(b - a) + a];
while d <= e do begin
while ar[d].y < x.y do inc(d);
while ar[e].y > x.y do dec(e);
if d <= e then begin
c := ar[d];
ar[d] := ar[e];
ar[e] := c;
inc(d);
dec(e);
end;
end;
qsort1(a, e);
qsort1(d, b);
end;
end;
begin
readln(a);
i := 1;
while i <= a do begin
readln(ar[i].x, ar[i].y);
inc(i);
end;
qsort(1, a);
i := 1;
p := 0;
j := 0;
while i < a do begin
if ar[i].x = ar[i + 1].x then inc(p)
else begin
inc(p);
inc(j, p * (p - 1) div 2);
p := 0;
end;
inc(i);
end;
inc(p);
inc(j, p * (p - 1) div 2);
qsort1(1, a);
i := 1;
p := 0;
while i < a do begin
if ar[i].y = ar[i + 1].y then inc(p)
else begin
inc(p);
inc(j, p * (p - 1) div 2);
p := 0;
end;
inc(i);
end;
inc(p);
inc(j, p * (p - 1) div 2);
qsort(1, a);
i := 1;
p := 1;
while i < a do begin
if ar[i].x <> ar[i + 1].x then begin
qsort1(p, i);
p := i + 1;
end;
inc(i);
end;
i := 1;
p := 0;
while i < a do begin
if (ar[i].x = ar[i + 1].x) and (ar[i].y = ar[i + 1].y) then inc(p)
else begin
inc(p);
dec(j, p * (p - 1) div 2);
p := 0;
end;
inc(i);
end;
inc(p);
dec(j, p * (p - 1) div 2);
writeln(j);
end. | Title: Watchmen
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Watchmen are in a danger and Doctor Manhattan together with his friend Daniel Dreiberg should warn them as soon as possible. There are *n* watchmen on a plane, the *i*-th watchman is located at point (*x**i*,<=*y**i*).
They need to arrange a plan, but there are some difficulties on their way. As you know, Doctor Manhattan considers the distance between watchmen *i* and *j* to be |*x**i*<=-<=*x**j*|<=+<=|*y**i*<=-<=*y**j*|. Daniel, as an ordinary person, calculates the distance using the formula .
The success of the operation relies on the number of pairs (*i*,<=*j*) (1<=≤<=*i*<=<<=*j*<=≤<=*n*), such that the distance between watchman *i* and watchmen *j* calculated by Doctor Manhattan is equal to the distance between them calculated by Daniel. You were asked to compute the number of such pairs.
Input Specification:
The first line of the input contains the single integer *n* (1<=≤<=*n*<=≤<=200<=000) — the number of watchmen.
Each of the following *n* lines contains two integers *x**i* and *y**i* (|*x**i*|,<=|*y**i*|<=≤<=109).
Some positions may coincide.
Output Specification:
Print the number of pairs of watchmen such that the distance between them calculated by Doctor Manhattan is equal to the distance calculated by Daniel.
Demo Input:
['3\n1 1\n7 5\n1 5\n', '6\n0 0\n0 1\n0 2\n-1 1\n0 1\n1 1\n']
Demo Output:
['2\n', '11\n']
Note:
In the first sample, the distance between watchman 1 and watchman 2 is equal to |1 - 7| + |1 - 5| = 10 for Doctor Manhattan and <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/bcb5b7064b5f02088da0fdcf677e6fda495dd0df.png" style="max-width: 100.0%;max-height: 100.0%;"/> for Daniel. For pairs (1, 1), (1, 5) and (7, 5), (1, 5) Doctor Manhattan and Daniel will calculate the same distances. | ```python
type
point = record
x, y: int64;
p: boolean;
end;
var
a, b, c, p, i, j: int64;
ar: array [1..300000] of point;
procedure qsort(a, b: int64);
var
d, e: int64;
c, x: point;
begin
if a < b then begin
d := a;
e := b;
x := ar[random(b - a) + a];
while d <= e do begin
while ar[d].x < x.x do inc(d);
while ar[e].x > x.x do dec(e);
if d <= e then begin
c := ar[d];
ar[d] := ar[e];
ar[e] := c;
inc(d);
dec(e);
end;
end;
qsort(a, e);
qsort(d, b);
end;
end;
procedure qsort1(a, b: int64);
var
d, e: int64;
c, x: point;
begin
if a < b then begin
d := a;
e := b;
x := ar[random(b - a) + a];
while d <= e do begin
while ar[d].y < x.y do inc(d);
while ar[e].y > x.y do dec(e);
if d <= e then begin
c := ar[d];
ar[d] := ar[e];
ar[e] := c;
inc(d);
dec(e);
end;
end;
qsort1(a, e);
qsort1(d, b);
end;
end;
begin
readln(a);
i := 1;
while i <= a do begin
readln(ar[i].x, ar[i].y);
inc(i);
end;
qsort(1, a);
i := 1;
p := 0;
j := 0;
while i < a do begin
if ar[i].x = ar[i + 1].x then inc(p)
else begin
inc(p);
inc(j, p * (p - 1) div 2);
p := 0;
end;
inc(i);
end;
inc(p);
inc(j, p * (p - 1) div 2);
qsort1(1, a);
i := 1;
p := 0;
while i < a do begin
if ar[i].y = ar[i + 1].y then inc(p)
else begin
inc(p);
inc(j, p * (p - 1) div 2);
p := 0;
end;
inc(i);
end;
inc(p);
inc(j, p * (p - 1) div 2);
qsort(1, a);
i := 1;
p := 1;
while i < a do begin
if ar[i].x <> ar[i + 1].x then begin
qsort1(p, i);
p := i + 1;
end;
inc(i);
end;
i := 1;
p := 0;
while i < a do begin
if (ar[i].x = ar[i + 1].x) and (ar[i].y = ar[i + 1].y) then inc(p)
else begin
inc(p);
dec(j, p * (p - 1) div 2);
p := 0;
end;
inc(i);
end;
inc(p);
dec(j, p * (p - 1) div 2);
writeln(j);
end.
``` | -1 |
|
625 | C | K-special Tables | PROGRAMMING | 1,300 | [
"constructive algorithms",
"implementation"
] | null | null | People do many crazy things to stand out in a crowd. Some of them dance, some learn by heart rules of Russian language, some try to become an outstanding competitive programmers, while others collect funny math objects.
Alis is among these collectors. Right now she wants to get one of *k*-special tables. In case you forget, the table *n*<=×<=*n* is called *k*-special if the following three conditions are satisfied:
- every integer from 1 to *n*2 appears in the table exactly once; - in each row numbers are situated in increasing order; - the sum of numbers in the *k*-th column is maximum possible.
Your goal is to help Alice and find at least one *k*-special table of size *n*<=×<=*n*. Both rows and columns are numbered from 1 to *n*, with rows numbered from top to bottom and columns numbered from left to right. | The first line of the input contains two integers *n* and *k* (1<=≤<=*n*<=≤<=500,<=1<=≤<=*k*<=≤<=*n*) — the size of the table Alice is looking for and the column that should have maximum possible sum. | First print the sum of the integers in the *k*-th column of the required table.
Next *n* lines should contain the description of the table itself: first line should contains *n* elements of the first row, second line should contain *n* elements of the second row and so on.
If there are multiple suitable table, you are allowed to print any. | [
"4 1\n",
"5 3\n"
] | [
"28\n1 2 3 4\n5 6 7 8\n9 10 11 12\n13 14 15 16\n",
"85\n5 6 17 18 19\n9 10 23 24 25\n7 8 20 21 22\n3 4 14 15 16\n1 2 11 12 13\n\n"
] | none | 1,000 | [
{
"input": "4 1",
"output": "28\n1 2 3 4\n5 6 7 8\n9 10 11 12\n13 14 15 16"
},
{
"input": "5 3",
"output": "85\n1 2 11 12 13\n3 4 14 15 16\n5 6 17 18 19\n7 8 20 21 22\n9 10 23 24 25"
},
{
"input": "1 1",
"output": "1\n1"
},
{
"input": "2 1",
"output": "4\n1 2\n3 4"
},
{
"input": "2 2",
"output": "7\n1 3\n2 4"
},
{
"input": "500 1",
"output": "62375500\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "3 1",
"output": "12\n1 2 3\n4 5 6\n7 8 9"
},
{
"input": "3 2",
"output": "18\n1 4 5\n2 6 7\n3 8 9"
},
{
"input": "3 3",
"output": "24\n1 2 7\n3 4 8\n5 6 9"
},
{
"input": "4 2",
"output": "38\n1 5 6 7\n2 8 9 10\n3 11 12 13\n4 14 15 16"
},
{
"input": "4 3",
"output": "48\n1 2 9 10\n3 4 11 12\n5 6 13 14\n7 8 15 16"
},
{
"input": "4 4",
"output": "58\n1 2 3 13\n4 5 6 14\n7 8 9 15\n10 11 12 16"
},
{
"input": "5 1",
"output": "55\n1 2 3 4 5\n6 7 8 9 10\n11 12 13 14 15\n16 17 18 19 20\n21 22 23 24 25"
},
{
"input": "5 2",
"output": "70\n1 6 7 8 9\n2 10 11 12 13\n3 14 15 16 17\n4 18 19 20 21\n5 22 23 24 25"
},
{
"input": "5 4",
"output": "100\n1 2 3 16 17\n4 5 6 18 19\n7 8 9 20 21\n10 11 12 22 23\n13 14 15 24 25"
},
{
"input": "5 5",
"output": "115\n1 2 3 4 21\n5 6 7 8 22\n9 10 11 12 23\n13 14 15 16 24\n17 18 19 20 25"
},
{
"input": "6 1",
"output": "96\n1 2 3 4 5 6\n7 8 9 10 11 12\n13 14 15 16 17 18\n19 20 21 22 23 24\n25 26 27 28 29 30\n31 32 33 34 35 36"
},
{
"input": "6 2",
"output": "117\n1 7 8 9 10 11\n2 12 13 14 15 16\n3 17 18 19 20 21\n4 22 23 24 25 26\n5 27 28 29 30 31\n6 32 33 34 35 36"
},
{
"input": "6 3",
"output": "138\n1 2 13 14 15 16\n3 4 17 18 19 20\n5 6 21 22 23 24\n7 8 25 26 27 28\n9 10 29 30 31 32\n11 12 33 34 35 36"
},
{
"input": "6 4",
"output": "159\n1 2 3 19 20 21\n4 5 6 22 23 24\n7 8 9 25 26 27\n10 11 12 28 29 30\n13 14 15 31 32 33\n16 17 18 34 35 36"
},
{
"input": "6 5",
"output": "180\n1 2 3 4 25 26\n5 6 7 8 27 28\n9 10 11 12 29 30\n13 14 15 16 31 32\n17 18 19 20 33 34\n21 22 23 24 35 36"
},
{
"input": "6 6",
"output": "201\n1 2 3 4 5 31\n6 7 8 9 10 32\n11 12 13 14 15 33\n16 17 18 19 20 34\n21 22 23 24 25 35\n26 27 28 29 30 36"
},
{
"input": "500 500",
"output": "124875250\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 ..."
},
{
"input": "500 250",
"output": "93562750\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "94 3",
"output": "419898\n1 2 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280\n3 4 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 309 310 311 31..."
},
{
"input": "22 4",
"output": "5863\n1 2 3 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85\n4 5 6 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104\n7 8 9 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123\n10 11 12 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142\n13 14 15 143 144 145 146 147 148 149 150 151 152 153 154 155 156 157 158 159 160 161\n16 17 18 162 163 164 165 166 167 168 169 170 171 172 173 174 175 176 177 178 179 180\n19 20 21 181 182 183 184 185 18..."
},
{
"input": "15 12",
"output": "2910\n1 2 3 4 5 6 7 8 9 10 11 166 167 168 169\n12 13 14 15 16 17 18 19 20 21 22 170 171 172 173\n23 24 25 26 27 28 29 30 31 32 33 174 175 176 177\n34 35 36 37 38 39 40 41 42 43 44 178 179 180 181\n45 46 47 48 49 50 51 52 53 54 55 182 183 184 185\n56 57 58 59 60 61 62 63 64 65 66 186 187 188 189\n67 68 69 70 71 72 73 74 75 76 77 190 191 192 193\n78 79 80 81 82 83 84 85 86 87 88 194 195 196 197\n89 90 91 92 93 94 95 96 97 98 99 198 199 200 201\n100 101 102 103 104 105 106 107 108 109 110 202 203 204 205\n111..."
},
{
"input": "37 35",
"output": "48581\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 1259 1260 1261\n35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 1262 1263 1264\n69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 1265 1266 1267\n103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 1268 1269 1270\n137 ..."
},
{
"input": "87 51",
"output": "516954\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 4351 4352 4353 4354 4355 4356 4357 4358 4359 4360 4361 4362 4363 4364 4365 4366 4367 4368 4369 4370 4371 4372 4373 4374 4375 4376 4377 4378 4379 4380 4381 4382 4383 4384 4385 4386 4387\n51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 4388 4389 4390 4391 4392 ..."
},
{
"input": "15 4",
"output": "1950\n1 2 3 46 47 48 49 50 51 52 53 54 55 56 57\n4 5 6 58 59 60 61 62 63 64 65 66 67 68 69\n7 8 9 70 71 72 73 74 75 76 77 78 79 80 81\n10 11 12 82 83 84 85 86 87 88 89 90 91 92 93\n13 14 15 94 95 96 97 98 99 100 101 102 103 104 105\n16 17 18 106 107 108 109 110 111 112 113 114 115 116 117\n19 20 21 118 119 120 121 122 123 124 125 126 127 128 129\n22 23 24 130 131 132 133 134 135 136 137 138 139 140 141\n25 26 27 142 143 144 145 146 147 148 149 150 151 152 153\n28 29 30 154 155 156 157 158 159 160 161 162 1..."
},
{
"input": "183 2",
"output": "3064518\n1 184 185 186 187 188 189 190 191 192 193 194 195 196 197 198 199 200 201 202 203 204 205 206 207 208 209 210 211 212 213 214 215 216 217 218 219 220 221 222 223 224 225 226 227 228 229 230 231 232 233 234 235 236 237 238 239 240 241 242 243 244 245 246 247 248 249 250 251 252 253 254 255 256 257 258 259 260 261 262 263 264 265 266 267 268 269 270 271 272 273 274 275 276 277 278 279 280 281 282 283 284 285 286 287 288 289 290 291 292 293 294 295 296 297 298 299 300 301 302 303 304 305 306 307 308 ..."
},
{
"input": "103 6",
"output": "567942\n1 2 3 4 5 516 517 518 519 520 521 522 523 524 525 526 527 528 529 530 531 532 533 534 535 536 537 538 539 540 541 542 543 544 545 546 547 548 549 550 551 552 553 554 555 556 557 558 559 560 561 562 563 564 565 566 567 568 569 570 571 572 573 574 575 576 577 578 579 580 581 582 583 584 585 586 587 588 589 590 591 592 593 594 595 596 597 598 599 600 601 602 603 604 605 606 607 608 609 610 611 612 613\n6 7 8 9 10 614 615 616 617 618 619 620 621 622 623 624 625 626 627 628 629 630 631 632 633 634 635 6..."
},
{
"input": "131 11",
"output": "1202056\n1 2 3 4 5 6 7 8 9 10 1311 1312 1313 1314 1315 1316 1317 1318 1319 1320 1321 1322 1323 1324 1325 1326 1327 1328 1329 1330 1331 1332 1333 1334 1335 1336 1337 1338 1339 1340 1341 1342 1343 1344 1345 1346 1347 1348 1349 1350 1351 1352 1353 1354 1355 1356 1357 1358 1359 1360 1361 1362 1363 1364 1365 1366 1367 1368 1369 1370 1371 1372 1373 1374 1375 1376 1377 1378 1379 1380 1381 1382 1383 1384 1385 1386 1387 1388 1389 1390 1391 1392 1393 1394 1395 1396 1397 1398 1399 1400 1401 1402 1403 1404 1405 1406 1..."
},
{
"input": "193 186",
"output": "7039482\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 15..."
},
{
"input": "117 109",
"output": "1539603\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 12637 12638 12639 12640 12641 12642 12643 12644 12645\n109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139..."
},
{
"input": "116 91",
"output": "1384576\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 10441 10442 10443 10444 10445 10446 10447 10448 10449 10450 10451 10452 10453 10454 10455 10456 10457 10458 10459 10460 10461 10462 10463 10464 10465 10466\n91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 1..."
},
{
"input": "140 79",
"output": "2132200\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 10921 10922 10923 10924 10925 10926 10927 10928 10929 10930 10931 10932 10933 10934 10935 10936 10937 10938 10939 10940 10941 10942 10943 10944 10945 10946 10947 10948 10949 10950 10951 10952 10953 10954 10955 10956 10957 10958 10959 10960 10961 10962 10963 10964 10965 10966 1..."
},
{
"input": "350 14",
"output": "22175125\n1 2 3 4 5 6 7 8 9 10 11 12 13 4551 4552 4553 4554 4555 4556 4557 4558 4559 4560 4561 4562 4563 4564 4565 4566 4567 4568 4569 4570 4571 4572 4573 4574 4575 4576 4577 4578 4579 4580 4581 4582 4583 4584 4585 4586 4587 4588 4589 4590 4591 4592 4593 4594 4595 4596 4597 4598 4599 4600 4601 4602 4603 4604 4605 4606 4607 4608 4609 4610 4611 4612 4613 4614 4615 4616 4617 4618 4619 4620 4621 4622 4623 4624 4625 4626 4627 4628 4629 4630 4631 4632 4633 4634 4635 4636 4637 4638 4639 4640 4641 4642 4643 4644 4..."
},
{
"input": "374 9",
"output": "26648248\n1 2 3 4 5 6 7 8 2993 2994 2995 2996 2997 2998 2999 3000 3001 3002 3003 3004 3005 3006 3007 3008 3009 3010 3011 3012 3013 3014 3015 3016 3017 3018 3019 3020 3021 3022 3023 3024 3025 3026 3027 3028 3029 3030 3031 3032 3033 3034 3035 3036 3037 3038 3039 3040 3041 3042 3043 3044 3045 3046 3047 3048 3049 3050 3051 3052 3053 3054 3055 3056 3057 3058 3059 3060 3061 3062 3063 3064 3065 3066 3067 3068 3069 3070 3071 3072 3073 3074 3075 3076 3077 3078 3079 3080 3081 3082 3083 3084 3085 3086 3087 3088 3089 ..."
},
{
"input": "265 255",
"output": "18222195\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "289 287",
"output": "24012143\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "276 11",
"output": "10856736\n1 2 3 4 5 6 7 8 9 10 2761 2762 2763 2764 2765 2766 2767 2768 2769 2770 2771 2772 2773 2774 2775 2776 2777 2778 2779 2780 2781 2782 2783 2784 2785 2786 2787 2788 2789 2790 2791 2792 2793 2794 2795 2796 2797 2798 2799 2800 2801 2802 2803 2804 2805 2806 2807 2808 2809 2810 2811 2812 2813 2814 2815 2816 2817 2818 2819 2820 2821 2822 2823 2824 2825 2826 2827 2828 2829 2830 2831 2832 2833 2834 2835 2836 2837 2838 2839 2840 2841 2842 2843 2844 2845 2846 2847 2848 2849 2850 2851 2852 2853 2854 2855 2856 ..."
},
{
"input": "204 7",
"output": "4349688\n1 2 3 4 5 6 1225 1226 1227 1228 1229 1230 1231 1232 1233 1234 1235 1236 1237 1238 1239 1240 1241 1242 1243 1244 1245 1246 1247 1248 1249 1250 1251 1252 1253 1254 1255 1256 1257 1258 1259 1260 1261 1262 1263 1264 1265 1266 1267 1268 1269 1270 1271 1272 1273 1274 1275 1276 1277 1278 1279 1280 1281 1282 1283 1284 1285 1286 1287 1288 1289 1290 1291 1292 1293 1294 1295 1296 1297 1298 1299 1300 1301 1302 1303 1304 1305 1306 1307 1308 1309 1310 1311 1312 1313 1314 1315 1316 1317 1318 1319 1320 1321 1322 ..."
},
{
"input": "425 15",
"output": "39560275\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 5951 5952 5953 5954 5955 5956 5957 5958 5959 5960 5961 5962 5963 5964 5965 5966 5967 5968 5969 5970 5971 5972 5973 5974 5975 5976 5977 5978 5979 5980 5981 5982 5983 5984 5985 5986 5987 5988 5989 5990 5991 5992 5993 5994 5995 5996 5997 5998 5999 6000 6001 6002 6003 6004 6005 6006 6007 6008 6009 6010 6011 6012 6013 6014 6015 6016 6017 6018 6019 6020 6021 6022 6023 6024 6025 6026 6027 6028 6029 6030 6031 6032 6033 6034 6035 6036 6037 6038 6039 6040 6041 6042 6043 604..."
},
{
"input": "449 6",
"output": "45664198\n1 2 3 4 5 2246 2247 2248 2249 2250 2251 2252 2253 2254 2255 2256 2257 2258 2259 2260 2261 2262 2263 2264 2265 2266 2267 2268 2269 2270 2271 2272 2273 2274 2275 2276 2277 2278 2279 2280 2281 2282 2283 2284 2285 2286 2287 2288 2289 2290 2291 2292 2293 2294 2295 2296 2297 2298 2299 2300 2301 2302 2303 2304 2305 2306 2307 2308 2309 2310 2311 2312 2313 2314 2315 2316 2317 2318 2319 2320 2321 2322 2323 2324 2325 2326 2327 2328 2329 2330 2331 2332 2333 2334 2335 2336 2337 2338 2339 2340 2341 2342 2343 2..."
},
{
"input": "477 19",
"output": "56204433\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 8587 8588 8589 8590 8591 8592 8593 8594 8595 8596 8597 8598 8599 8600 8601 8602 8603 8604 8605 8606 8607 8608 8609 8610 8611 8612 8613 8614 8615 8616 8617 8618 8619 8620 8621 8622 8623 8624 8625 8626 8627 8628 8629 8630 8631 8632 8633 8634 8635 8636 8637 8638 8639 8640 8641 8642 8643 8644 8645 8646 8647 8648 8649 8650 8651 8652 8653 8654 8655 8656 8657 8658 8659 8660 8661 8662 8663 8664 8665 8666 8667 8668 8669 8670 8671 8672 8673 8674 8675 8676 8677 8..."
},
{
"input": "448 437",
"output": "88708928\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "472 459",
"output": "103591728\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 ..."
},
{
"input": "500 494",
"output": "124123750\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 ..."
},
{
"input": "462 318",
"output": "83103405\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
},
{
"input": "486 481",
"output": "114081696\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 ..."
},
{
"input": "410 361",
"output": "64708660\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 1..."
}
] | 1,657,818,548 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 52 | 93 | 4,608,000 | import sys
input = sys.stdin.readline
n, k = map(int, input().split())
d = [[0]*n for _ in range(n)]
x = (k-1)*n + 1
c = 1
if k > 1:
for i in range(n):
for j in range(k-1):
d[i][j] = c
c += 1
for i in range(n):
for j in range(k-1, n):
d[i][j] = c
c += 1
print(sum(d[i][k-1] for i in range(n)))
for i in d:
print(' '.join(map(str, i))) | Title: K-special Tables
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
People do many crazy things to stand out in a crowd. Some of them dance, some learn by heart rules of Russian language, some try to become an outstanding competitive programmers, while others collect funny math objects.
Alis is among these collectors. Right now she wants to get one of *k*-special tables. In case you forget, the table *n*<=×<=*n* is called *k*-special if the following three conditions are satisfied:
- every integer from 1 to *n*2 appears in the table exactly once; - in each row numbers are situated in increasing order; - the sum of numbers in the *k*-th column is maximum possible.
Your goal is to help Alice and find at least one *k*-special table of size *n*<=×<=*n*. Both rows and columns are numbered from 1 to *n*, with rows numbered from top to bottom and columns numbered from left to right.
Input Specification:
The first line of the input contains two integers *n* and *k* (1<=≤<=*n*<=≤<=500,<=1<=≤<=*k*<=≤<=*n*) — the size of the table Alice is looking for and the column that should have maximum possible sum.
Output Specification:
First print the sum of the integers in the *k*-th column of the required table.
Next *n* lines should contain the description of the table itself: first line should contains *n* elements of the first row, second line should contain *n* elements of the second row and so on.
If there are multiple suitable table, you are allowed to print any.
Demo Input:
['4 1\n', '5 3\n']
Demo Output:
['28\n1 2 3 4\n5 6 7 8\n9 10 11 12\n13 14 15 16\n', '85\n5 6 17 18 19\n9 10 23 24 25\n7 8 20 21 22\n3 4 14 15 16\n1 2 11 12 13\n\n']
Note:
none | ```python
import sys
input = sys.stdin.readline
n, k = map(int, input().split())
d = [[0]*n for _ in range(n)]
x = (k-1)*n + 1
c = 1
if k > 1:
for i in range(n):
for j in range(k-1):
d[i][j] = c
c += 1
for i in range(n):
for j in range(k-1, n):
d[i][j] = c
c += 1
print(sum(d[i][k-1] for i in range(n)))
for i in d:
print(' '.join(map(str, i)))
``` | 3 |
|
1,006 | A | Adjacent Replacements | PROGRAMMING | 800 | [
"implementation"
] | null | null | Mishka got an integer array $a$ of length $n$ as a birthday present (what a surprise!).
Mishka doesn't like this present and wants to change it somehow. He has invented an algorithm and called it "Mishka's Adjacent Replacements Algorithm". This algorithm can be represented as a sequence of steps:
- Replace each occurrence of $1$ in the array $a$ with $2$; - Replace each occurrence of $2$ in the array $a$ with $1$; - Replace each occurrence of $3$ in the array $a$ with $4$; - Replace each occurrence of $4$ in the array $a$ with $3$; - Replace each occurrence of $5$ in the array $a$ with $6$; - Replace each occurrence of $6$ in the array $a$ with $5$; - $\dots$ - Replace each occurrence of $10^9 - 1$ in the array $a$ with $10^9$; - Replace each occurrence of $10^9$ in the array $a$ with $10^9 - 1$.
Note that the dots in the middle of this algorithm mean that Mishka applies these replacements for each pair of adjacent integers ($2i - 1, 2i$) for each $i \in\{1, 2, \ldots, 5 \cdot 10^8\}$ as described above.
For example, for the array $a = [1, 2, 4, 5, 10]$, the following sequence of arrays represents the algorithm:
$[1, 2, 4, 5, 10]$ $\rightarrow$ (replace all occurrences of $1$ with $2$) $\rightarrow$ $[2, 2, 4, 5, 10]$ $\rightarrow$ (replace all occurrences of $2$ with $1$) $\rightarrow$ $[1, 1, 4, 5, 10]$ $\rightarrow$ (replace all occurrences of $3$ with $4$) $\rightarrow$ $[1, 1, 4, 5, 10]$ $\rightarrow$ (replace all occurrences of $4$ with $3$) $\rightarrow$ $[1, 1, 3, 5, 10]$ $\rightarrow$ (replace all occurrences of $5$ with $6$) $\rightarrow$ $[1, 1, 3, 6, 10]$ $\rightarrow$ (replace all occurrences of $6$ with $5$) $\rightarrow$ $[1, 1, 3, 5, 10]$ $\rightarrow$ $\dots$ $\rightarrow$ $[1, 1, 3, 5, 10]$ $\rightarrow$ (replace all occurrences of $10$ with $9$) $\rightarrow$ $[1, 1, 3, 5, 9]$. The later steps of the algorithm do not change the array.
Mishka is very lazy and he doesn't want to apply these changes by himself. But he is very interested in their result. Help him find it. | The first line of the input contains one integer number $n$ ($1 \le n \le 1000$) — the number of elements in Mishka's birthday present (surprisingly, an array).
The second line of the input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 10^9$) — the elements of the array. | Print $n$ integers — $b_1, b_2, \dots, b_n$, where $b_i$ is the final value of the $i$-th element of the array after applying "Mishka's Adjacent Replacements Algorithm" to the array $a$. Note that you cannot change the order of elements in the array. | [
"5\n1 2 4 5 10\n",
"10\n10000 10 50605065 1 5 89 5 999999999 60506056 1000000000\n"
] | [
"1 1 3 5 9\n",
"9999 9 50605065 1 5 89 5 999999999 60506055 999999999\n"
] | The first example is described in the problem statement. | 0 | [
{
"input": "5\n1 2 4 5 10",
"output": "1 1 3 5 9"
},
{
"input": "10\n10000 10 50605065 1 5 89 5 999999999 60506056 1000000000",
"output": "9999 9 50605065 1 5 89 5 999999999 60506055 999999999"
},
{
"input": "1\n999999999",
"output": "999999999"
},
{
"input": "1\n1000000000",
"output": "999999999"
},
{
"input": "1\n210400",
"output": "210399"
},
{
"input": "5\n100000000 100000000 100000000 100000000 100000000",
"output": "99999999 99999999 99999999 99999999 99999999"
},
{
"input": "1\n2441139",
"output": "2441139"
},
{
"input": "2\n2 2",
"output": "1 1"
},
{
"input": "3\n2 2 2",
"output": "1 1 1"
},
{
"input": "2\n4 4",
"output": "3 3"
}
] | 1,598,864,624 | 2,147,483,647 | Python 3 | OK | TESTS | 18 | 93 | 6,963,200 | n = int(input())
a = [int(s) for s in input().split(' ')]
b = [str(c - ((c + 1) % 2)) for c in a]
print(' '.join(b))
| Title: Adjacent Replacements
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mishka got an integer array $a$ of length $n$ as a birthday present (what a surprise!).
Mishka doesn't like this present and wants to change it somehow. He has invented an algorithm and called it "Mishka's Adjacent Replacements Algorithm". This algorithm can be represented as a sequence of steps:
- Replace each occurrence of $1$ in the array $a$ with $2$; - Replace each occurrence of $2$ in the array $a$ with $1$; - Replace each occurrence of $3$ in the array $a$ with $4$; - Replace each occurrence of $4$ in the array $a$ with $3$; - Replace each occurrence of $5$ in the array $a$ with $6$; - Replace each occurrence of $6$ in the array $a$ with $5$; - $\dots$ - Replace each occurrence of $10^9 - 1$ in the array $a$ with $10^9$; - Replace each occurrence of $10^9$ in the array $a$ with $10^9 - 1$.
Note that the dots in the middle of this algorithm mean that Mishka applies these replacements for each pair of adjacent integers ($2i - 1, 2i$) for each $i \in\{1, 2, \ldots, 5 \cdot 10^8\}$ as described above.
For example, for the array $a = [1, 2, 4, 5, 10]$, the following sequence of arrays represents the algorithm:
$[1, 2, 4, 5, 10]$ $\rightarrow$ (replace all occurrences of $1$ with $2$) $\rightarrow$ $[2, 2, 4, 5, 10]$ $\rightarrow$ (replace all occurrences of $2$ with $1$) $\rightarrow$ $[1, 1, 4, 5, 10]$ $\rightarrow$ (replace all occurrences of $3$ with $4$) $\rightarrow$ $[1, 1, 4, 5, 10]$ $\rightarrow$ (replace all occurrences of $4$ with $3$) $\rightarrow$ $[1, 1, 3, 5, 10]$ $\rightarrow$ (replace all occurrences of $5$ with $6$) $\rightarrow$ $[1, 1, 3, 6, 10]$ $\rightarrow$ (replace all occurrences of $6$ with $5$) $\rightarrow$ $[1, 1, 3, 5, 10]$ $\rightarrow$ $\dots$ $\rightarrow$ $[1, 1, 3, 5, 10]$ $\rightarrow$ (replace all occurrences of $10$ with $9$) $\rightarrow$ $[1, 1, 3, 5, 9]$. The later steps of the algorithm do not change the array.
Mishka is very lazy and he doesn't want to apply these changes by himself. But he is very interested in their result. Help him find it.
Input Specification:
The first line of the input contains one integer number $n$ ($1 \le n \le 1000$) — the number of elements in Mishka's birthday present (surprisingly, an array).
The second line of the input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 10^9$) — the elements of the array.
Output Specification:
Print $n$ integers — $b_1, b_2, \dots, b_n$, where $b_i$ is the final value of the $i$-th element of the array after applying "Mishka's Adjacent Replacements Algorithm" to the array $a$. Note that you cannot change the order of elements in the array.
Demo Input:
['5\n1 2 4 5 10\n', '10\n10000 10 50605065 1 5 89 5 999999999 60506056 1000000000\n']
Demo Output:
['1 1 3 5 9\n', '9999 9 50605065 1 5 89 5 999999999 60506055 999999999\n']
Note:
The first example is described in the problem statement. | ```python
n = int(input())
a = [int(s) for s in input().split(' ')]
b = [str(c - ((c + 1) % 2)) for c in a]
print(' '.join(b))
``` | 3 |
|
21 | A | Jabber ID | PROGRAMMING | 1,900 | [
"implementation",
"strings"
] | A. Jabber ID | 0 | 256 | Jabber ID on the national Berland service «Babber» has a form <username>@<hostname>[/resource], where
- <username> — is a sequence of Latin letters (lowercase or uppercase), digits or underscores characters «_», the length of <username> is between 1 and 16, inclusive. - <hostname> — is a sequence of word separated by periods (characters «.»), where each word should contain only characters allowed for <username>, the length of each word is between 1 and 16, inclusive. The length of <hostname> is between 1 and 32, inclusive. - <resource> — is a sequence of Latin letters (lowercase or uppercase), digits or underscores characters «_», the length of <resource> is between 1 and 16, inclusive.
The content of square brackets is optional — it can be present or can be absent.
There are the samples of correct Jabber IDs: [[email protected]](/cdn-cgi/l/email-protection), [[email protected]](/cdn-cgi/l/email-protection)/contest.
Your task is to write program which checks if given string is a correct Jabber ID. | The input contains of a single line. The line has the length between 1 and 100 characters, inclusive. Each characters has ASCII-code between 33 and 127, inclusive. | Print YES or NO. | [
"[email protected]\n",
"[email protected]/contest.icpc/12\n"
] | [
"YES\n",
"NO\n"
] | none | 500 | [
{
"input": "[email protected]",
"output": "YES"
},
{
"input": "[email protected]/contest.icpc/12",
"output": "NO"
},
{
"input": "[email protected]/abacaba",
"output": "YES"
},
{
"input": "@ops",
"output": "NO"
},
{
"input": "this-is-the-test",
"output": "NO"
},
{
"input": "[email protected]@codeforces.com",
"output": "NO"
},
{
"input": "oooop/oooop",
"output": "NO"
},
{
"input": "w@S8/XU.5._R7fHq.@../e.WP!54Ey1L.9jv",
"output": "NO"
},
{
"input": "[email protected]!_!CcAOEEx.0z.aiW/S430sbQT",
"output": "NO"
},
{
"input": "@/YTd.K1@lD",
"output": "NO"
},
{
"input": "[email protected]./MzuI",
"output": "NO"
},
{
"input": "_TlPy65w/@[email protected]",
"output": "NO"
},
{
"input": "xpS@._s8.e0lJci/.LdiT",
"output": "NO"
},
{
"input": "lGwo[email protected]",
"output": "NO"
},
{
"input": "Ccz9T5rKZQuEerGo@6l.",
"output": "NO"
},
{
"input": "Y@[email protected]_MK7.g_..0.",
"output": "NO"
},
{
"input": "Q2/6y!SP9s[email protected]_nR8.",
"output": "NO"
},
{
"input": "eWfLL@gW!BEJUxF[email protected]/2.Pr7a/5O6zXdAkikjCEDrb",
"output": "NO"
},
{
"input": "8oI/a@Q",
"output": "NO"
},
{
"input": "J@Y9Gz550l@PqVZdQ!u",
"output": "NO"
},
{
"input": "VTE6aTTta@[email protected]@.l..3Bs",
"output": "NO"
},
{
"input": "[email protected]!Tg..wGN5YOi68U.oP2Yl3/",
"output": "NO"
},
{
"input": "[email protected]@g.9u.v.A..XNH/1/tloIceXydZf3",
"output": "NO"
},
{
"input": "4@@..f3ZT./oUGZ@",
"output": "NO"
},
{
"input": "[email protected]!KtpX4tzs/0yQGzZCPJPJoda",
"output": "NO"
},
{
"input": "[email protected]/VE7gjf",
"output": "NO"
},
{
"input": "bgko@1../xwSj_J",
"output": "NO"
},
{
"input": "[email protected]../.",
"output": "NO"
},
{
"input": "zr.KB_6ZMSwI2GA5@R/4iP1ZKHpszW!YN/",
"output": "NO"
},
{
"input": "@alK@pR",
"output": "NO"
},
{
"input": "al_Y2I4IKp@A_N.ruCw0VL/hRzJtx.S7sp/r!c.n9ffh",
"output": "NO"
},
{
"input": "C1rE26_rTAVzLm@[email protected]./kkBEVlcU",
"output": "NO"
},
{
"input": "feGSXP@eyUfr8.x4Re.JL.6B.r/fX_",
"output": "NO"
},
{
"input": "[email protected]@.",
"output": "NO"
},
{
"input": "[email protected]",
"output": "NO"
},
{
"input": "MiWPE8@fc./IViqq4T4PSUuMdhH",
"output": "NO"
},
{
"input": "[email protected]!.Ntz/QEh_sl",
"output": "NO"
},
{
"input": "s@mH@RO_/iWD",
"output": "NO"
},
{
"input": "UP51i49wX@pvx@2LWm8w/G4M3J./9L6Szy",
"output": "NO"
},
{
"input": "xC_5Vx8NgF..[email protected]@/PQYPeq@_y8!h_iF",
"output": "NO"
},
{
"input": "qG3@LKp",
"output": "YES"
},
{
"input": "flTq1knyb@2!Mtfss",
"output": "NO"
},
{
"input": "/pqi7WXQPJFM4q1@hxUyUy/_pWo0n",
"output": "NO"
},
{
"input": "[email protected]",
"output": "NO"
},
{
"input": "o3EaAnc3K6@h",
"output": "YES"
},
{
"input": "G/AZdVMTzRLV4Ucm@eQ!..pq!..tRTi5.Ejkqa/HGpFYk",
"output": "NO"
},
{
"input": "[email protected]!AFAEk7glM[email protected]/OLKoJpZlac",
"output": "NO"
},
{
"input": "WKxNIM79u@I.RM",
"output": "NO"
},
{
"input": "[email protected]/M_jTHS_6!",
"output": "NO"
},
{
"input": "pbRIiuA@[email protected]",
"output": "NO"
},
{
"input": "[email protected]/juNlxB",
"output": "YES"
},
{
"input": "[email protected]",
"output": "YES"
},
{
"input": "[email protected]",
"output": "YES"
},
{
"input": "[email protected]",
"output": "YES"
},
{
"input": "[email protected]_.38./zgVGNjpldr",
"output": "NO"
},
{
"input": "[email protected]",
"output": "YES"
},
{
"input": "[email protected]/0EY3XmYatfY",
"output": "YES"
},
{
"input": "[email protected].",
"output": "NO"
},
{
"input": "xLEctap0T@22U9W_fA/7iQeJGFu1lSgMZ",
"output": "YES"
},
{
"input": "[email protected]",
"output": "YES"
},
{
"input": "BPxNVANhtEh@Oh_go.",
"output": "NO"
},
{
"input": "mGIY@cHRNC8GlJ/2pcl3LYxpi3PaKGs",
"output": "YES"
},
{
"input": "[email protected]/UXC",
"output": "NO"
},
{
"input": "[email protected]",
"output": "YES"
},
{
"input": "[email protected]/i8cnKHT",
"output": "YES"
},
{
"input": "[email protected]/4TBzLWf724zE1r",
"output": "YES"
},
{
"input": "[email protected]/0sN",
"output": "NO"
},
{
"input": "nrKbWV@P0irxQoRxDsNvG/69WxCwCsfB",
"output": "YES"
},
{
"input": "[email protected]/tT5d36",
"output": "NO"
},
{
"input": "[email protected]/_97Ltj3",
"output": "YES"
},
{
"input": "[email protected]_TQ2.z/qfi5CZrH",
"output": "YES"
},
{
"input": "bdHl525me@XzR_iO23v.YFXbnHUybbgw.i/WVEhm",
"output": "YES"
},
{
"input": "[email protected]",
"output": "YES"
},
{
"input": "[email protected]",
"output": "YES"
},
{
"input": "[email protected]./FJ4X",
"output": "NO"
},
{
"input": "[email protected].",
"output": "NO"
},
{
"input": "[email protected]",
"output": "YES"
},
{
"input": "[email protected]/iUij1x7",
"output": "YES"
},
{
"input": "Yesx@9_KiJq2cBI6.",
"output": "NO"
},
{
"input": "Zu5VFUtSbIw@ner5e",
"output": "YES"
},
{
"input": "test@test.",
"output": "NO"
},
{
"input": "[email protected]",
"output": "NO"
},
{
"input": "est.@test",
"output": "NO"
},
{
"input": "[email protected]/",
"output": "NO"
},
{
"input": "asd@asd@",
"output": "NO"
},
{
"input": "@",
"output": "NO"
},
{
"input": "/",
"output": "NO"
},
{
"input": ".",
"output": "NO"
},
{
"input": "mike@",
"output": "NO"
},
{
"input": "@mike",
"output": "NO"
},
{
"input": "@mail.ru",
"output": "NO"
},
{
"input": "test.me",
"output": "NO"
},
{
"input": "$@ru",
"output": "NO"
},
{
"input": "[email protected]/ooooo",
"output": "YES"
},
{
"input": "oooop/oooop",
"output": "NO"
},
{
"input": "mail.ru/a",
"output": "NO"
},
{
"input": "[email protected]/aaa",
"output": "YES"
},
{
"input": "[email protected]",
"output": "YES"
}
] | 1,510,646,181 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 3 | 62 | 0 | def norm(str):
for i in range(len(str)):
if (33<= ord(str[i])<= 127) or (ord('0')<= ord(str[i])<= ord('9')) or str[i]== '_':
pass
else:
return False
if not (0 <len(str[i])< 17): return False
return True
def fin():
print('NO')
quit()
j= input()
j.lower()
res= ''
bool= True
bool_res= False
if '@' in j:
user= j.split('@')[0]
host= j.split('@')[1]
else:
fin()
if '/' in host:
bool_res= True
host= host.split('/')[0]
res= j.split('/')[-1]
if not norm(res): fin()
if not norm(user): fin()
if not (0 <len(host)< 33): fin()
Host= host.split('.')
for i in range(len(Host)):
if not norm(Host[i]): fin()
if (bool_res & (len(j)== len(user)+ len(host)+ len(res)+2)) or (len(j)== len(user)+ len(host)+ 1):
pass
else:
fin()
print('YES')
quit()
| Title: Jabber ID
Time Limit: 0 seconds
Memory Limit: 256 megabytes
Problem Description:
Jabber ID on the national Berland service «Babber» has a form <username>@<hostname>[/resource], where
- <username> — is a sequence of Latin letters (lowercase or uppercase), digits or underscores characters «_», the length of <username> is between 1 and 16, inclusive. - <hostname> — is a sequence of word separated by periods (characters «.»), where each word should contain only characters allowed for <username>, the length of each word is between 1 and 16, inclusive. The length of <hostname> is between 1 and 32, inclusive. - <resource> — is a sequence of Latin letters (lowercase or uppercase), digits or underscores characters «_», the length of <resource> is between 1 and 16, inclusive.
The content of square brackets is optional — it can be present or can be absent.
There are the samples of correct Jabber IDs: [[email protected]](/cdn-cgi/l/email-protection), [[email protected]](/cdn-cgi/l/email-protection)/contest.
Your task is to write program which checks if given string is a correct Jabber ID.
Input Specification:
The input contains of a single line. The line has the length between 1 and 100 characters, inclusive. Each characters has ASCII-code between 33 and 127, inclusive.
Output Specification:
Print YES or NO.
Demo Input:
['[email\xa0protected]\n', '[email\xa0protected]/contest.icpc/12\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none | ```python
def norm(str):
for i in range(len(str)):
if (33<= ord(str[i])<= 127) or (ord('0')<= ord(str[i])<= ord('9')) or str[i]== '_':
pass
else:
return False
if not (0 <len(str[i])< 17): return False
return True
def fin():
print('NO')
quit()
j= input()
j.lower()
res= ''
bool= True
bool_res= False
if '@' in j:
user= j.split('@')[0]
host= j.split('@')[1]
else:
fin()
if '/' in host:
bool_res= True
host= host.split('/')[0]
res= j.split('/')[-1]
if not norm(res): fin()
if not norm(user): fin()
if not (0 <len(host)< 33): fin()
Host= host.split('.')
for i in range(len(Host)):
if not norm(Host[i]): fin()
if (bool_res & (len(j)== len(user)+ len(host)+ len(res)+2)) or (len(j)== len(user)+ len(host)+ 1):
pass
else:
fin()
print('YES')
quit()
``` | 0 |
797 | A | k-Factorization | PROGRAMMING | 1,100 | [
"implementation",
"math",
"number theory"
] | null | null | Given a positive integer *n*, find *k* integers (not necessary distinct) such that all these integers are strictly greater than 1, and their product is equal to *n*. | The first line contains two integers *n* and *k* (2<=≤<=*n*<=≤<=100000, 1<=≤<=*k*<=≤<=20). | If it's impossible to find the representation of *n* as a product of *k* numbers, print -1.
Otherwise, print *k* integers in any order. Their product must be equal to *n*. If there are multiple answers, print any of them. | [
"100000 2\n",
"100000 20\n",
"1024 5\n"
] | [
"2 50000 \n",
"-1\n",
"2 64 2 2 2 \n"
] | none | 0 | [
{
"input": "100000 2",
"output": "2 50000 "
},
{
"input": "100000 20",
"output": "-1"
},
{
"input": "1024 5",
"output": "2 64 2 2 2 "
},
{
"input": "100000 10",
"output": "2 2 2 2 2 5 5 5 5 5 "
},
{
"input": "99999 3",
"output": "3 813 41 "
},
{
"input": "99999 4",
"output": "3 3 41 271 "
},
{
"input": "99999 5",
"output": "-1"
},
{
"input": "1024 10",
"output": "2 2 2 2 2 2 2 2 2 2 "
},
{
"input": "1024 11",
"output": "-1"
},
{
"input": "2048 11",
"output": "2 2 2 2 2 2 2 2 2 2 2 "
},
{
"input": "2 1",
"output": "2 "
},
{
"input": "2 2",
"output": "-1"
},
{
"input": "2 3",
"output": "-1"
},
{
"input": "2 4",
"output": "-1"
},
{
"input": "2 5",
"output": "-1"
},
{
"input": "2 1",
"output": "2 "
},
{
"input": "3 1",
"output": "3 "
},
{
"input": "3 2",
"output": "-1"
},
{
"input": "349 2",
"output": "-1"
},
{
"input": "8 1",
"output": "8 "
},
{
"input": "66049 2",
"output": "257 257 "
},
{
"input": "6557 2",
"output": "83 79 "
},
{
"input": "9 2",
"output": "3 3 "
},
{
"input": "4 2",
"output": "2 2 "
},
{
"input": "2 2",
"output": "-1"
},
{
"input": "4 4",
"output": "-1"
},
{
"input": "12 1",
"output": "12 "
},
{
"input": "17 1",
"output": "17 "
},
{
"input": "8 2",
"output": "2 4 "
},
{
"input": "14 2",
"output": "7 2 "
},
{
"input": "99991 1",
"output": "99991 "
},
{
"input": "30 2",
"output": "3 10 "
},
{
"input": "97 1",
"output": "97 "
},
{
"input": "92 2",
"output": "2 46 "
},
{
"input": "4 1",
"output": "4 "
},
{
"input": "4 3",
"output": "-1"
},
{
"input": "30 4",
"output": "-1"
},
{
"input": "2 6",
"output": "-1"
},
{
"input": "3 1",
"output": "3 "
},
{
"input": "3 2",
"output": "-1"
},
{
"input": "3 3",
"output": "-1"
},
{
"input": "3 4",
"output": "-1"
},
{
"input": "3 5",
"output": "-1"
},
{
"input": "3 6",
"output": "-1"
},
{
"input": "4 1",
"output": "4 "
},
{
"input": "4 2",
"output": "2 2 "
},
{
"input": "4 3",
"output": "-1"
},
{
"input": "4 4",
"output": "-1"
},
{
"input": "4 5",
"output": "-1"
},
{
"input": "4 6",
"output": "-1"
},
{
"input": "5 1",
"output": "5 "
},
{
"input": "5 2",
"output": "-1"
},
{
"input": "5 3",
"output": "-1"
},
{
"input": "5 4",
"output": "-1"
},
{
"input": "5 5",
"output": "-1"
},
{
"input": "5 6",
"output": "-1"
},
{
"input": "6 1",
"output": "6 "
},
{
"input": "6 2",
"output": "3 2 "
},
{
"input": "6 3",
"output": "-1"
},
{
"input": "6 4",
"output": "-1"
},
{
"input": "6 5",
"output": "-1"
},
{
"input": "6 6",
"output": "-1"
},
{
"input": "7 1",
"output": "7 "
},
{
"input": "7 2",
"output": "-1"
},
{
"input": "7 3",
"output": "-1"
},
{
"input": "7 4",
"output": "-1"
},
{
"input": "7 5",
"output": "-1"
},
{
"input": "7 6",
"output": "-1"
},
{
"input": "8 1",
"output": "8 "
},
{
"input": "8 2",
"output": "2 4 "
},
{
"input": "8 3",
"output": "2 2 2 "
},
{
"input": "8 4",
"output": "-1"
},
{
"input": "8 5",
"output": "-1"
},
{
"input": "8 6",
"output": "-1"
},
{
"input": "9 1",
"output": "9 "
},
{
"input": "9 2",
"output": "3 3 "
},
{
"input": "9 3",
"output": "-1"
},
{
"input": "9 4",
"output": "-1"
},
{
"input": "9 5",
"output": "-1"
},
{
"input": "9 6",
"output": "-1"
},
{
"input": "10 1",
"output": "10 "
},
{
"input": "10 2",
"output": "5 2 "
},
{
"input": "10 3",
"output": "-1"
},
{
"input": "10 4",
"output": "-1"
},
{
"input": "10 5",
"output": "-1"
},
{
"input": "10 6",
"output": "-1"
},
{
"input": "11 1",
"output": "11 "
},
{
"input": "11 2",
"output": "-1"
},
{
"input": "11 3",
"output": "-1"
},
{
"input": "11 4",
"output": "-1"
},
{
"input": "11 5",
"output": "-1"
},
{
"input": "11 6",
"output": "-1"
},
{
"input": "12 1",
"output": "12 "
},
{
"input": "12 2",
"output": "2 6 "
},
{
"input": "12 3",
"output": "2 2 3 "
},
{
"input": "12 4",
"output": "-1"
},
{
"input": "12 5",
"output": "-1"
},
{
"input": "12 6",
"output": "-1"
},
{
"input": "13 1",
"output": "13 "
},
{
"input": "13 2",
"output": "-1"
},
{
"input": "13 3",
"output": "-1"
},
{
"input": "13 4",
"output": "-1"
},
{
"input": "13 5",
"output": "-1"
},
{
"input": "13 6",
"output": "-1"
},
{
"input": "14 1",
"output": "14 "
},
{
"input": "14 2",
"output": "7 2 "
},
{
"input": "14 3",
"output": "-1"
},
{
"input": "14 4",
"output": "-1"
},
{
"input": "14 5",
"output": "-1"
},
{
"input": "14 6",
"output": "-1"
},
{
"input": "15 1",
"output": "15 "
},
{
"input": "15 2",
"output": "5 3 "
},
{
"input": "15 3",
"output": "-1"
},
{
"input": "15 4",
"output": "-1"
},
{
"input": "15 5",
"output": "-1"
},
{
"input": "15 6",
"output": "-1"
},
{
"input": "16 1",
"output": "16 "
},
{
"input": "16 2",
"output": "2 8 "
},
{
"input": "16 3",
"output": "2 4 2 "
},
{
"input": "16 4",
"output": "2 2 2 2 "
},
{
"input": "16 5",
"output": "-1"
},
{
"input": "16 6",
"output": "-1"
},
{
"input": "17 1",
"output": "17 "
},
{
"input": "17 2",
"output": "-1"
},
{
"input": "17 3",
"output": "-1"
},
{
"input": "17 4",
"output": "-1"
},
{
"input": "17 5",
"output": "-1"
},
{
"input": "17 6",
"output": "-1"
},
{
"input": "18 1",
"output": "18 "
},
{
"input": "18 2",
"output": "3 6 "
},
{
"input": "18 3",
"output": "3 2 3 "
},
{
"input": "18 4",
"output": "-1"
},
{
"input": "18 5",
"output": "-1"
},
{
"input": "18 6",
"output": "-1"
},
{
"input": "19 1",
"output": "19 "
},
{
"input": "19 2",
"output": "-1"
},
{
"input": "19 3",
"output": "-1"
},
{
"input": "19 4",
"output": "-1"
},
{
"input": "19 5",
"output": "-1"
},
{
"input": "19 6",
"output": "-1"
},
{
"input": "20 1",
"output": "20 "
},
{
"input": "20 2",
"output": "2 10 "
},
{
"input": "20 3",
"output": "2 2 5 "
},
{
"input": "20 4",
"output": "-1"
},
{
"input": "20 5",
"output": "-1"
},
{
"input": "20 6",
"output": "-1"
},
{
"input": "94249 1",
"output": "94249 "
},
{
"input": "94249 2",
"output": "307 307 "
},
{
"input": "94249 3",
"output": "-1"
},
{
"input": "94249 4",
"output": "-1"
},
{
"input": "94249 5",
"output": "-1"
},
{
"input": "95477 1",
"output": "95477 "
},
{
"input": "95477 2",
"output": "311 307 "
},
{
"input": "95477 3",
"output": "-1"
},
{
"input": "95477 4",
"output": "-1"
},
{
"input": "95477 5",
"output": "-1"
},
{
"input": "35557 1",
"output": "35557 "
},
{
"input": "35557 2",
"output": "31 1147 "
},
{
"input": "35557 3",
"output": "31 31 37 "
},
{
"input": "35557 4",
"output": "-1"
},
{
"input": "35557 5",
"output": "-1"
},
{
"input": "42439 1",
"output": "42439 "
},
{
"input": "42439 2",
"output": "37 1147 "
},
{
"input": "42439 3",
"output": "37 31 37 "
},
{
"input": "42439 4",
"output": "-1"
},
{
"input": "42439 5",
"output": "-1"
}
] | 1,674,129,309 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 3 | 46 | 0 | n,k=map(int,input().split())
i=2
l=[]
cnt=0
while(i*i<=n):
if(n%i==0):
while(n%i==0):
n=n//i
l.append(i)
i+=1
if(n>1):
l.append(n)
if(len(l)==k):
print(l)
elif(len(l)<k):
print(-1)
else:
ans=1
l1=l[k-1:]
for i in l1:
ans*=i
p=[i for i in l[:k-1]]
p.append(ans)
print(*p) | Title: k-Factorization
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Given a positive integer *n*, find *k* integers (not necessary distinct) such that all these integers are strictly greater than 1, and their product is equal to *n*.
Input Specification:
The first line contains two integers *n* and *k* (2<=≤<=*n*<=≤<=100000, 1<=≤<=*k*<=≤<=20).
Output Specification:
If it's impossible to find the representation of *n* as a product of *k* numbers, print -1.
Otherwise, print *k* integers in any order. Their product must be equal to *n*. If there are multiple answers, print any of them.
Demo Input:
['100000 2\n', '100000 20\n', '1024 5\n']
Demo Output:
['2 50000 \n', '-1\n', '2 64 2 2 2 \n']
Note:
none | ```python
n,k=map(int,input().split())
i=2
l=[]
cnt=0
while(i*i<=n):
if(n%i==0):
while(n%i==0):
n=n//i
l.append(i)
i+=1
if(n>1):
l.append(n)
if(len(l)==k):
print(l)
elif(len(l)<k):
print(-1)
else:
ans=1
l1=l[k-1:]
for i in l1:
ans*=i
p=[i for i in l[:k-1]]
p.append(ans)
print(*p)
``` | 0 |
|
443 | A | Anton and Letters | PROGRAMMING | 800 | [
"constructive algorithms",
"implementation"
] | null | null | Recently, Anton has found a set. The set consists of small English letters. Anton carefully wrote out all the letters from the set in one line, separated by a comma. He also added an opening curved bracket at the beginning of the line and a closing curved bracket at the end of the line.
Unfortunately, from time to time Anton would forget writing some letter and write it again. He asks you to count the total number of distinct letters in his set. | The first and the single line contains the set of letters. The length of the line doesn't exceed 1000. It is guaranteed that the line starts from an opening curved bracket and ends with a closing curved bracket. Between them, small English letters are listed, separated by a comma. Each comma is followed by a space. | Print a single number — the number of distinct letters in Anton's set. | [
"{a, b, c}\n",
"{b, a, b, a}\n",
"{}\n"
] | [
"3\n",
"2\n",
"0\n"
] | none | 500 | [
{
"input": "{a, b, c}",
"output": "3"
},
{
"input": "{b, a, b, a}",
"output": "2"
},
{
"input": "{}",
"output": "0"
},
{
"input": "{a, a, c, b, b, b, c, c, c, c}",
"output": "3"
},
{
"input": "{a, c, b, b}",
"output": "3"
},
{
"input": "{a, b}",
"output": "2"
},
{
"input": "{a}",
"output": "1"
},
{
"input": "{b, a, b, a, b, c, c, b, c, b}",
"output": "3"
},
{
"input": "{e, g, c, e}",
"output": "3"
},
{
"input": "{a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a, a}",
"output": "1"
},
{
"input": "{a, a, b}",
"output": "2"
},
{
"input": "{a, b, b, b, a, b, a, a, a, a, a, a, b, a, b, a, a, a, a, a, b, a, b, a}",
"output": "2"
},
{
"input": "{j, u, a, c, f, w, e, w, x, t, h, p, v, n, i, l, x, n, i, b, u, c, a, a}",
"output": "16"
},
{
"input": "{x, i, w, c, p, e, h, z, k, i}",
"output": "9"
},
{
"input": "{t, k, o, x, r, d, q, j, k, e, z, w, y, r, z, s, s, e, s, b, k, i}",
"output": "15"
},
{
"input": "{y}",
"output": "1"
},
{
"input": "{x}",
"output": "1"
},
{
"input": "{b, z, a, z}",
"output": "3"
},
{
"input": "{z}",
"output": "1"
},
{
"input": "{a, z}",
"output": "2"
},
{
"input": "{a, b, z}",
"output": "3"
},
{
"input": "{s, q, z, r, t, a, b, h, j, i, o, z, r, q}",
"output": "11"
}
] | 1,692,772,851 | 2,147,483,647 | PyPy 3 | OK | TESTS | 27 | 93 | 0 | a = input()
p=[]
for i in a:
if(i.isalpha()==True):
p.append(i)
s=list(set(p))
print(len(s)) | Title: Anton and Letters
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently, Anton has found a set. The set consists of small English letters. Anton carefully wrote out all the letters from the set in one line, separated by a comma. He also added an opening curved bracket at the beginning of the line and a closing curved bracket at the end of the line.
Unfortunately, from time to time Anton would forget writing some letter and write it again. He asks you to count the total number of distinct letters in his set.
Input Specification:
The first and the single line contains the set of letters. The length of the line doesn't exceed 1000. It is guaranteed that the line starts from an opening curved bracket and ends with a closing curved bracket. Between them, small English letters are listed, separated by a comma. Each comma is followed by a space.
Output Specification:
Print a single number — the number of distinct letters in Anton's set.
Demo Input:
['{a, b, c}\n', '{b, a, b, a}\n', '{}\n']
Demo Output:
['3\n', '2\n', '0\n']
Note:
none | ```python
a = input()
p=[]
for i in a:
if(i.isalpha()==True):
p.append(i)
s=list(set(p))
print(len(s))
``` | 3 |
|
985 | B | Switches and Lamps | PROGRAMMING | 1,200 | [
"implementation"
] | null | null | You are given *n* switches and *m* lamps. The *i*-th switch turns on some subset of the lamps. This information is given as the matrix *a* consisting of *n* rows and *m* columns where *a**i*,<=*j*<==<=1 if the *i*-th switch turns on the *j*-th lamp and *a**i*,<=*j*<==<=0 if the *i*-th switch is not connected to the *j*-th lamp.
Initially all *m* lamps are turned off.
Switches change state only from "off" to "on". It means that if you press two or more switches connected to the same lamp then the lamp will be turned on after any of this switches is pressed and will remain its state even if any switch connected to this lamp is pressed afterwards.
It is guaranteed that if you push all *n* switches then all *m* lamps will be turned on.
Your think that you have too many switches and you would like to ignore one of them.
Your task is to say if there exists such a switch that if you will ignore (not use) it but press all the other *n*<=-<=1 switches then all the *m* lamps will be turned on. | The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=2000) — the number of the switches and the number of the lamps.
The following *n* lines contain *m* characters each. The character *a**i*,<=*j* is equal to '1' if the *i*-th switch turns on the *j*-th lamp and '0' otherwise.
It is guaranteed that if you press all *n* switches all *m* lamps will be turned on. | Print "YES" if there is a switch that if you will ignore it and press all the other *n*<=-<=1 switches then all *m* lamps will be turned on. Print "NO" if there is no such switch. | [
"4 5\n10101\n01000\n00111\n10000\n",
"4 5\n10100\n01000\n00110\n00101\n"
] | [
"YES\n",
"NO\n"
] | none | 0 | [
{
"input": "4 5\n10101\n01000\n00111\n10000",
"output": "YES"
},
{
"input": "4 5\n10100\n01000\n00110\n00101",
"output": "NO"
},
{
"input": "1 5\n11111",
"output": "NO"
},
{
"input": "10 1\n1\n0\n0\n0\n0\n0\n0\n0\n0\n1",
"output": "YES"
},
{
"input": "1 1\n1",
"output": "NO"
},
{
"input": "3 4\n1010\n0100\n1101",
"output": "YES"
},
{
"input": "2 5\n10101\n11111",
"output": "YES"
},
{
"input": "5 5\n10000\n11000\n11100\n11110\n11111",
"output": "YES"
},
{
"input": "2 5\n10000\n11111",
"output": "YES"
},
{
"input": "4 5\n01000\n10100\n00010\n10101",
"output": "YES"
},
{
"input": "2 2\n10\n11",
"output": "YES"
},
{
"input": "2 5\n00100\n11111",
"output": "YES"
},
{
"input": "4 5\n00000\n11000\n00110\n00011",
"output": "YES"
},
{
"input": "4 3\n000\n010\n001\n100",
"output": "YES"
},
{
"input": "4 5\n10000\n10101\n01000\n00111",
"output": "YES"
},
{
"input": "4 5\n10000\n01000\n10101\n00111",
"output": "YES"
},
{
"input": "2 2\n01\n11",
"output": "YES"
},
{
"input": "3 3\n010\n101\n000",
"output": "YES"
},
{
"input": "2 2\n11\n00",
"output": "YES"
},
{
"input": "3 5\n10110\n11000\n00111",
"output": "YES"
},
{
"input": "3 8\n00111111\n01011100\n11000000",
"output": "YES"
},
{
"input": "4 6\n100000\n110000\n001100\n000011",
"output": "YES"
},
{
"input": "2 5\n11111\n00000",
"output": "YES"
},
{
"input": "2 3\n101\n111",
"output": "YES"
},
{
"input": "2 5\n01000\n11111",
"output": "YES"
},
{
"input": "2 2\n00\n11",
"output": "YES"
},
{
"input": "4 15\n111110100011010\n111111011010110\n101000001011001\n100110000111011",
"output": "YES"
},
{
"input": "2 3\n010\n111",
"output": "YES"
},
{
"input": "4 5\n10100\n11000\n00110\n00101",
"output": "YES"
},
{
"input": "4 4\n1111\n0000\n0000\n0000",
"output": "YES"
},
{
"input": "3 5\n11100\n00110\n00011",
"output": "YES"
},
{
"input": "2 1\n0\n1",
"output": "YES"
},
{
"input": "4 4\n1000\n1001\n0010\n0100",
"output": "YES"
},
{
"input": "3 5\n00110\n10011\n01100",
"output": "YES"
},
{
"input": "3 5\n10101\n00111\n01000",
"output": "NO"
},
{
"input": "4 5\n00101\n00011\n01000\n10010",
"output": "YES"
},
{
"input": "3 3\n100\n110\n111",
"output": "YES"
},
{
"input": "2 2\n11\n01",
"output": "YES"
},
{
"input": "3 3\n100\n100\n111",
"output": "YES"
},
{
"input": "4 2\n10\n01\n10\n01",
"output": "YES"
},
{
"input": "3 3\n111\n000\n000",
"output": "YES"
},
{
"input": "3 3\n010\n100\n011",
"output": "YES"
},
{
"input": "2 3\n111\n000",
"output": "YES"
},
{
"input": "3 4\n0001\n1101\n1010",
"output": "YES"
},
{
"input": "3 4\n1010\n0101\n1000",
"output": "YES"
},
{
"input": "3 4\n0001\n1101\n0110",
"output": "YES"
},
{
"input": "3 3\n111\n101\n001",
"output": "YES"
},
{
"input": "4 5\n10001\n10010\n01010\n00101",
"output": "YES"
},
{
"input": "3 3\n000\n000\n111",
"output": "YES"
},
{
"input": "2 3\n100\n111",
"output": "YES"
},
{
"input": "3 10\n1111011100\n0001100011\n1111010101",
"output": "YES"
},
{
"input": "3 4\n0110\n1010\n0101",
"output": "YES"
},
{
"input": "3 3\n100\n001\n011",
"output": "YES"
},
{
"input": "3 3\n100\n010\n001",
"output": "NO"
},
{
"input": "3 3\n010\n100\n001",
"output": "NO"
},
{
"input": "3 5\n10101\n01010\n01010",
"output": "YES"
},
{
"input": "2 6\n111111\n000000",
"output": "YES"
},
{
"input": "3 5\n00000\n10101\n01010",
"output": "YES"
},
{
"input": "4 6\n111000\n100100\n010010\n001001",
"output": "YES"
}
] | 1,527,318,977 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 8 | 2,355 | 4,710,400 | n,m = [int(i) for i in input().split()]
l = []
for i in range(n):
l.append(input())
cnt = m*[0]
for i in range(m):
for j in range(n):
cnt[i]+=int(l[j][i])
ans = 'NO'
#print(*cnt)
t = 0
for i in range(m):
if cnt[i]>=2:
t+=1
if t >= 2:
ans = 'YES'
print(ans)
| Title: Switches and Lamps
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given *n* switches and *m* lamps. The *i*-th switch turns on some subset of the lamps. This information is given as the matrix *a* consisting of *n* rows and *m* columns where *a**i*,<=*j*<==<=1 if the *i*-th switch turns on the *j*-th lamp and *a**i*,<=*j*<==<=0 if the *i*-th switch is not connected to the *j*-th lamp.
Initially all *m* lamps are turned off.
Switches change state only from "off" to "on". It means that if you press two or more switches connected to the same lamp then the lamp will be turned on after any of this switches is pressed and will remain its state even if any switch connected to this lamp is pressed afterwards.
It is guaranteed that if you push all *n* switches then all *m* lamps will be turned on.
Your think that you have too many switches and you would like to ignore one of them.
Your task is to say if there exists such a switch that if you will ignore (not use) it but press all the other *n*<=-<=1 switches then all the *m* lamps will be turned on.
Input Specification:
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=2000) — the number of the switches and the number of the lamps.
The following *n* lines contain *m* characters each. The character *a**i*,<=*j* is equal to '1' if the *i*-th switch turns on the *j*-th lamp and '0' otherwise.
It is guaranteed that if you press all *n* switches all *m* lamps will be turned on.
Output Specification:
Print "YES" if there is a switch that if you will ignore it and press all the other *n*<=-<=1 switches then all *m* lamps will be turned on. Print "NO" if there is no such switch.
Demo Input:
['4 5\n10101\n01000\n00111\n10000\n', '4 5\n10100\n01000\n00110\n00101\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none | ```python
n,m = [int(i) for i in input().split()]
l = []
for i in range(n):
l.append(input())
cnt = m*[0]
for i in range(m):
for j in range(n):
cnt[i]+=int(l[j][i])
ans = 'NO'
#print(*cnt)
t = 0
for i in range(m):
if cnt[i]>=2:
t+=1
if t >= 2:
ans = 'YES'
print(ans)
``` | 0 |
|
220 | B | Little Elephant and Array | PROGRAMMING | 1,800 | [
"constructive algorithms",
"data structures"
] | null | null | The Little Elephant loves playing with arrays. He has array *a*, consisting of *n* positive integers, indexed from 1 to *n*. Let's denote the number with index *i* as *a**i*.
Additionally the Little Elephant has *m* queries to the array, each query is characterised by a pair of integers *l**j* and *r**j* (1<=≤<=*l**j*<=≤<=*r**j*<=≤<=*n*). For each query *l**j*,<=*r**j* the Little Elephant has to count, how many numbers *x* exist, such that number *x* occurs exactly *x* times among numbers *a**l**j*,<=*a**l**j*<=+<=1,<=...,<=*a**r**j*.
Help the Little Elephant to count the answers to all queries. | The first line contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=105) — the size of array *a* and the number of queries to it. The next line contains *n* space-separated positive integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=109). Next *m* lines contain descriptions of queries, one per line. The *j*-th of these lines contains the description of the *j*-th query as two space-separated integers *l**j* and *r**j* (1<=≤<=*l**j*<=≤<=*r**j*<=≤<=*n*). | In *m* lines print *m* integers — the answers to the queries. The *j*-th line should contain the answer to the *j*-th query. | [
"7 2\n3 1 2 2 3 3 7\n1 7\n3 4\n"
] | [
"3\n1\n"
] | none | 1,000 | [
{
"input": "7 2\n3 1 2 2 3 3 7\n1 7\n3 4",
"output": "3\n1"
},
{
"input": "6 6\n1 2 2 3 3 3\n1 2\n2 2\n1 3\n2 4\n4 6\n1 6",
"output": "1\n0\n2\n1\n1\n3"
},
{
"input": "1 2\n1\n1 1\n1 1",
"output": "1\n1"
},
{
"input": "1 1\n1000000000\n1 1",
"output": "0"
}
] | 1,467,244,980 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 46 | 204,800 | def add(elem, count):
count[elem] += 1
if count[elem] == elem:
global answer
answer += 1
def remove(elem, count):
count[elem] -= 1
# case our count gets below the element count
if count[elem] == elem-1:
global answer
answer -= 1
def process_queries(queries, array):
from collections import defaultdict
currentL = 1
currentR = 1
count = defaultdict(int)
ans = {}
for querie in queries:
while currentL < querie[0]:
elem = array[currentL-1]
remove(elem, count)
currentL += 1
while currentL > querie[0]:
elem = array[currentL-1]
add(elem, count)
currentL -= 1
while currentR < querie[1]:
elem = array[currentR-1]
add(elem, count)
currentR += 1
while currentR > querie[1]:
elem = array[currentR-1]
remove(elem, count)
currentR -= 1
ans[querie] = answer
return ans
def mos_algorithm(queries):
from math import ceil, sqrt
block_len = int(ceil(sqrt(len(queries))))
blocks = [[] for x in range(block_len)]
for q in queries:
pos = q[0] // block_len
blocks[pos].append(q)
queries2 = [sorted(x, lambda x:x[1]) for x in blocks]
queries2 = [item for sublist in queries2 for item in sublist]
return queries2
if __name__ == "__main__":
from sys import stdin, stdout
# global var answer
answer = 0
alist = [line.strip() for line in stdin]
array = list(map(int, alist[1].split()))
queries = [tuple(map(int, x.split()))for x in alist[2:]]
sorted_queries = mos_algorithm(queries)
ans = process_queries(sorted_queries, array)
for q in queries:
print(ans[q])
| Title: Little Elephant and Array
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Little Elephant loves playing with arrays. He has array *a*, consisting of *n* positive integers, indexed from 1 to *n*. Let's denote the number with index *i* as *a**i*.
Additionally the Little Elephant has *m* queries to the array, each query is characterised by a pair of integers *l**j* and *r**j* (1<=≤<=*l**j*<=≤<=*r**j*<=≤<=*n*). For each query *l**j*,<=*r**j* the Little Elephant has to count, how many numbers *x* exist, such that number *x* occurs exactly *x* times among numbers *a**l**j*,<=*a**l**j*<=+<=1,<=...,<=*a**r**j*.
Help the Little Elephant to count the answers to all queries.
Input Specification:
The first line contains two space-separated integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=105) — the size of array *a* and the number of queries to it. The next line contains *n* space-separated positive integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=109). Next *m* lines contain descriptions of queries, one per line. The *j*-th of these lines contains the description of the *j*-th query as two space-separated integers *l**j* and *r**j* (1<=≤<=*l**j*<=≤<=*r**j*<=≤<=*n*).
Output Specification:
In *m* lines print *m* integers — the answers to the queries. The *j*-th line should contain the answer to the *j*-th query.
Demo Input:
['7 2\n3 1 2 2 3 3 7\n1 7\n3 4\n']
Demo Output:
['3\n1\n']
Note:
none | ```python
def add(elem, count):
count[elem] += 1
if count[elem] == elem:
global answer
answer += 1
def remove(elem, count):
count[elem] -= 1
# case our count gets below the element count
if count[elem] == elem-1:
global answer
answer -= 1
def process_queries(queries, array):
from collections import defaultdict
currentL = 1
currentR = 1
count = defaultdict(int)
ans = {}
for querie in queries:
while currentL < querie[0]:
elem = array[currentL-1]
remove(elem, count)
currentL += 1
while currentL > querie[0]:
elem = array[currentL-1]
add(elem, count)
currentL -= 1
while currentR < querie[1]:
elem = array[currentR-1]
add(elem, count)
currentR += 1
while currentR > querie[1]:
elem = array[currentR-1]
remove(elem, count)
currentR -= 1
ans[querie] = answer
return ans
def mos_algorithm(queries):
from math import ceil, sqrt
block_len = int(ceil(sqrt(len(queries))))
blocks = [[] for x in range(block_len)]
for q in queries:
pos = q[0] // block_len
blocks[pos].append(q)
queries2 = [sorted(x, lambda x:x[1]) for x in blocks]
queries2 = [item for sublist in queries2 for item in sublist]
return queries2
if __name__ == "__main__":
from sys import stdin, stdout
# global var answer
answer = 0
alist = [line.strip() for line in stdin]
array = list(map(int, alist[1].split()))
queries = [tuple(map(int, x.split()))for x in alist[2:]]
sorted_queries = mos_algorithm(queries)
ans = process_queries(sorted_queries, array)
for q in queries:
print(ans[q])
``` | -1 |
|
11 | D | A Simple Task | PROGRAMMING | 2,200 | [
"bitmasks",
"dp",
"graphs"
] | D. A Simple Task | 2 | 256 | Given a simple graph, output the number of simple cycles in it. A simple cycle is a cycle with no repeated vertices or edges. | The first line of input contains two integers *n* and *m* (1<=≤<=*n*<=≤<=19, 0<=≤<=*m*) – respectively the number of vertices and edges of the graph. Each of the subsequent *m* lines contains two integers *a* and *b*, (1<=≤<=*a*,<=*b*<=≤<=*n*, *a*<=≠<=*b*) indicating that vertices *a* and *b* are connected by an undirected edge. There is no more than one edge connecting any pair of vertices. | Output the number of cycles in the given graph. | [
"4 6\n1 2\n1 3\n1 4\n2 3\n2 4\n3 4\n"
] | [
"7\n"
] | The example graph is a clique and contains four cycles of length 3 and three cycles of length 4. | 0 | [
{
"input": "4 6\n1 2\n1 3\n1 4\n2 3\n2 4\n3 4",
"output": "7"
},
{
"input": "10 3\n4 8\n9 4\n8 9",
"output": "1"
},
{
"input": "8 28\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n2 3\n2 4\n2 5\n2 6\n2 7\n2 8\n3 4\n3 5\n3 6\n3 7\n3 8\n4 5\n4 6\n4 7\n4 8\n5 6\n5 7\n5 8\n6 7\n6 8\n7 8",
"output": "8018"
},
{
"input": "12 10\n1 6\n4 5\n4 9\n5 10\n6 12\n7 9\n7 10\n8 10\n10 12\n11 12",
"output": "1"
},
{
"input": "3 0",
"output": "0"
},
{
"input": "6 0",
"output": "0"
},
{
"input": "2 1\n1 2",
"output": "0"
},
{
"input": "2 1\n1 2",
"output": "0"
},
{
"input": "3 3\n1 2\n1 3\n2 3",
"output": "1"
},
{
"input": "3 0",
"output": "0"
},
{
"input": "3 0",
"output": "0"
},
{
"input": "3 0",
"output": "0"
},
{
"input": "7 16\n1 2\n1 3\n1 5\n1 7\n2 3\n2 4\n2 6\n3 4\n3 5\n3 6\n3 7\n4 5\n4 6\n4 7\n5 6\n6 7",
"output": "214"
},
{
"input": "14 32\n1 2\n1 3\n1 6\n1 7\n1 9\n1 11\n1 13\n2 8\n2 9\n2 14\n3 7\n3 8\n3 9\n3 13\n4 5\n4 11\n4 14\n6 7\n6 8\n6 9\n6 14\n7 12\n7 13\n8 9\n8 10\n8 11\n9 10\n10 13\n10 14\n11 12\n11 13\n13 14",
"output": "9239"
},
{
"input": "18 45\n1 2\n1 5\n1 12\n1 13\n2 3\n2 4\n2 11\n2 14\n2 15\n3 7\n3 16\n4 7\n4 8\n4 10\n4 18\n5 8\n5 10\n5 16\n5 17\n6 12\n6 16\n7 9\n7 12\n8 10\n8 16\n9 11\n9 12\n9 16\n9 17\n10 11\n10 15\n11 12\n11 14\n11 15\n12 13\n12 14\n12 15\n12 18\n13 15\n13 16\n13 17\n14 15\n14 18\n16 17\n17 18",
"output": "467111"
},
{
"input": "19 11\n3 4\n3 12\n3 14\n4 12\n5 11\n8 9\n8 10\n9 10\n9 13\n11 19\n15 16",
"output": "2"
},
{
"input": "1 0",
"output": "0"
},
{
"input": "10 44\n1 2\n1 3\n1 4\n1 5\n1 6\n1 7\n1 8\n1 9\n1 10\n2 3\n2 4\n2 5\n2 6\n2 7\n2 8\n2 9\n2 10\n3 4\n3 5\n3 6\n3 7\n3 8\n3 10\n4 5\n4 6\n4 7\n4 8\n4 9\n4 10\n5 6\n5 7\n5 8\n5 9\n5 10\n6 7\n6 8\n6 9\n6 10\n7 8\n7 9\n7 10\n8 9\n8 10\n9 10",
"output": "446414"
},
{
"input": "16 11\n1 2\n2 7\n2 12\n3 12\n4 5\n4 15\n6 7\n6 9\n7 8\n12 14\n14 16",
"output": "0"
},
{
"input": "1 0",
"output": "0"
},
{
"input": "3 3\n1 2\n1 3\n2 3",
"output": "1"
},
{
"input": "6 1\n2 5",
"output": "0"
},
{
"input": "2 1\n1 2",
"output": "0"
},
{
"input": "3 3\n1 2\n1 3\n2 3",
"output": "1"
},
{
"input": "2 0",
"output": "0"
},
{
"input": "1 0",
"output": "0"
},
{
"input": "18 54\n1 7\n1 11\n1 14\n1 15\n1 18\n2 7\n3 4\n3 9\n3 10\n3 11\n3 12\n3 13\n3 16\n3 17\n3 18\n4 5\n4 9\n4 11\n4 13\n5 12\n5 13\n5 14\n5 15\n5 16\n5 18\n6 9\n6 10\n6 12\n6 13\n6 17\n7 8\n7 17\n8 10\n8 11\n8 12\n8 14\n8 15\n9 11\n9 12\n10 11\n10 13\n10 16\n10 17\n11 12\n11 15\n11 16\n12 15\n12 18\n13 15\n13 17\n14 15\n14 16\n15 17\n17 18",
"output": "6418594"
},
{
"input": "3 0",
"output": "0"
},
{
"input": "5 8\n1 3\n1 4\n1 5\n2 3\n2 4\n3 4\n3 5\n4 5",
"output": "12"
},
{
"input": "19 48\n1 5\n1 6\n1 14\n1 17\n1 18\n2 3\n2 4\n2 7\n2 13\n2 16\n2 18\n2 19\n3 8\n3 11\n3 16\n3 17\n4 5\n4 13\n4 17\n4 19\n5 8\n5 13\n5 15\n5 16\n5 19\n6 7\n6 11\n6 12\n6 14\n7 8\n7 11\n8 11\n8 19\n9 14\n9 17\n9 18\n10 13\n10 19\n11 12\n11 18\n12 14\n13 16\n13 17\n13 19\n14 15\n16 17\n17 18\n18 19",
"output": "824798"
},
{
"input": "2 0",
"output": "0"
},
{
"input": "6 15\n1 2\n1 3\n1 4\n1 5\n1 6\n2 3\n2 4\n2 5\n2 6\n3 4\n3 5\n3 6\n4 5\n4 6\n5 6",
"output": "197"
},
{
"input": "19 22\n1 10\n1 14\n1 17\n2 10\n2 12\n2 13\n3 8\n3 13\n3 14\n4 10\n4 19\n7 9\n7 12\n9 18\n10 11\n11 13\n11 19\n12 13\n14 16\n16 17\n16 19\n17 19",
"output": "60"
},
{
"input": "1 0",
"output": "0"
},
{
"input": "3 0",
"output": "0"
}
] | 1,678,339,999 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 0 | 62 | 0 | n, m = map(int, input().split())
graph = [[] for _ in range(n)]
for i in range(m):
a, b = map(int, input().split())
graph[a-1].append(b-1)
graph[b-1].append(a-1)
def dfs(vertex, visited, path):
visited[vertex] = True
path.append(vertex)
count = 0
for neighbor in graph[vertex]:
if neighbor == path[0]:
count += 1 # found a cycle
elif not visited[neighbor]:
count += dfs(neighbor, visited, path)
path.pop()
visited[vertex] = False
return count
cycles = 0
for i in range(n):
visited = [False] * n
cycles += dfs(i, visited, [])
print(cycles//2) # divide by 2 as each cycle is counted twice
| Title: A Simple Task
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Given a simple graph, output the number of simple cycles in it. A simple cycle is a cycle with no repeated vertices or edges.
Input Specification:
The first line of input contains two integers *n* and *m* (1<=≤<=*n*<=≤<=19, 0<=≤<=*m*) – respectively the number of vertices and edges of the graph. Each of the subsequent *m* lines contains two integers *a* and *b*, (1<=≤<=*a*,<=*b*<=≤<=*n*, *a*<=≠<=*b*) indicating that vertices *a* and *b* are connected by an undirected edge. There is no more than one edge connecting any pair of vertices.
Output Specification:
Output the number of cycles in the given graph.
Demo Input:
['4 6\n1 2\n1 3\n1 4\n2 3\n2 4\n3 4\n']
Demo Output:
['7\n']
Note:
The example graph is a clique and contains four cycles of length 3 and three cycles of length 4. | ```python
n, m = map(int, input().split())
graph = [[] for _ in range(n)]
for i in range(m):
a, b = map(int, input().split())
graph[a-1].append(b-1)
graph[b-1].append(a-1)
def dfs(vertex, visited, path):
visited[vertex] = True
path.append(vertex)
count = 0
for neighbor in graph[vertex]:
if neighbor == path[0]:
count += 1 # found a cycle
elif not visited[neighbor]:
count += dfs(neighbor, visited, path)
path.pop()
visited[vertex] = False
return count
cycles = 0
for i in range(n):
visited = [False] * n
cycles += dfs(i, visited, [])
print(cycles//2) # divide by 2 as each cycle is counted twice
``` | 0 |
805 | B | 3-palindrome | PROGRAMMING | 1,000 | [
"constructive algorithms"
] | null | null | In the beginning of the new year Keivan decided to reverse his name. He doesn't like palindromes, so he changed Naviek to Navick.
He is too selfish, so for a given *n* he wants to obtain a string of *n* characters, each of which is either 'a', 'b' or 'c', with no palindromes of length 3 appearing in the string as a substring. For example, the strings "abc" and "abca" suit him, while the string "aba" doesn't. He also want the number of letters 'c' in his string to be as little as possible. | The first line contains single integer *n* (1<=≤<=*n*<=≤<=2·105) — the length of the string. | Print the string that satisfies all the constraints.
If there are multiple answers, print any of them. | [
"2\n",
"3\n"
] | [
"aa\n",
"bba\n"
] | A palindrome is a sequence of characters which reads the same backward and forward. | 1,000 | [
{
"input": "2",
"output": "aa"
},
{
"input": "3",
"output": "aab"
},
{
"input": "38",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaa"
},
{
"input": "47",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "59",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "67",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "77",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "89",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "98",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaa"
},
{
"input": "109",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "117",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "1",
"output": "a"
},
{
"input": "200000",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "100000",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "143670",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "104217",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "17879",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "131809",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "140873",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "77859",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "153022",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "179227",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "182801",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "5188",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "86539",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "12802",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "120289",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "132866",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "133377",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "31775",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "160397",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "161415",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "163623",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "22942",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "134767",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "52257",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "64905",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "183758",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "60131",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "146883",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "6",
"output": "aabbaa"
},
{
"input": "4",
"output": "aabb"
}
] | 1,602,629,518 | 418 | Python 3 | OK | TESTS | 42 | 108 | 409,600 | n = int(input())
s = 'bbaa' * (n // 4 + 1)
s = s[:n]
print(s) | Title: 3-palindrome
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In the beginning of the new year Keivan decided to reverse his name. He doesn't like palindromes, so he changed Naviek to Navick.
He is too selfish, so for a given *n* he wants to obtain a string of *n* characters, each of which is either 'a', 'b' or 'c', with no palindromes of length 3 appearing in the string as a substring. For example, the strings "abc" and "abca" suit him, while the string "aba" doesn't. He also want the number of letters 'c' in his string to be as little as possible.
Input Specification:
The first line contains single integer *n* (1<=≤<=*n*<=≤<=2·105) — the length of the string.
Output Specification:
Print the string that satisfies all the constraints.
If there are multiple answers, print any of them.
Demo Input:
['2\n', '3\n']
Demo Output:
['aa\n', 'bba\n']
Note:
A palindrome is a sequence of characters which reads the same backward and forward. | ```python
n = int(input())
s = 'bbaa' * (n // 4 + 1)
s = s[:n]
print(s)
``` | 3 |
|
242 | B | Big Segment | PROGRAMMING | 1,100 | [
"implementation",
"sortings"
] | null | null | A coordinate line has *n* segments, the *i*-th segment starts at the position *l**i* and ends at the position *r**i*. We will denote such a segment as [*l**i*,<=*r**i*].
You have suggested that one of the defined segments covers all others. In other words, there is such segment in the given set, which contains all other ones. Now you want to test your assumption. Find in the given set the segment which covers all other segments, and print its number. If such a segment doesn't exist, print -1.
Formally we will assume that segment [*a*,<=*b*] covers segment [*c*,<=*d*], if they meet this condition *a*<=≤<=*c*<=≤<=*d*<=≤<=*b*. | The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of segments. Next *n* lines contain the descriptions of the segments. The *i*-th line contains two space-separated integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=109) — the borders of the *i*-th segment.
It is guaranteed that no two segments coincide. | Print a single integer — the number of the segment that covers all other segments in the set. If there's no solution, print -1.
The segments are numbered starting from 1 in the order in which they appear in the input. | [
"3\n1 1\n2 2\n3 3\n",
"6\n1 5\n2 3\n1 10\n7 10\n7 7\n10 10\n"
] | [
"-1\n",
"3\n"
] | none | 1,000 | [
{
"input": "3\n1 1\n2 2\n3 3",
"output": "-1"
},
{
"input": "6\n1 5\n2 3\n1 10\n7 10\n7 7\n10 10",
"output": "3"
},
{
"input": "4\n1 5\n2 2\n2 4\n2 5",
"output": "1"
},
{
"input": "5\n3 3\n1 3\n2 2\n2 3\n1 2",
"output": "2"
},
{
"input": "7\n7 7\n8 8\n3 7\n1 6\n1 7\n4 7\n2 8",
"output": "-1"
},
{
"input": "3\n2 5\n3 4\n2 3",
"output": "1"
},
{
"input": "16\n15 15\n8 12\n6 9\n15 16\n8 14\n3 12\n7 19\n9 13\n5 16\n9 17\n10 15\n9 14\n9 9\n18 19\n5 15\n6 19",
"output": "-1"
},
{
"input": "9\n1 10\n7 8\n6 7\n1 4\n5 9\n2 8\n3 10\n1 1\n2 3",
"output": "1"
},
{
"input": "1\n1 100000",
"output": "1"
},
{
"input": "6\n2 2\n3 3\n3 5\n4 5\n1 1\n1 5",
"output": "6"
},
{
"input": "33\n2 18\n4 14\n2 16\n10 12\n4 6\n9 17\n2 8\n4 12\n8 20\n1 10\n11 14\n11 17\n8 15\n3 16\n3 4\n6 9\n6 19\n4 17\n17 19\n6 16\n3 12\n1 7\n6 20\n8 16\n12 19\n1 3\n12 18\n6 11\n7 20\n16 18\n4 15\n3 15\n15 19",
"output": "-1"
},
{
"input": "34\n3 8\n5 9\n2 9\n1 4\n3 7\n3 3\n8 9\n6 10\n4 7\n6 7\n5 8\n5 10\n1 5\n8 8\n2 5\n3 5\n7 7\n2 8\n4 5\n1 1\n7 9\n5 6\n2 3\n1 2\n2 4\n8 10\n7 8\n1 3\n4 8\n9 10\n1 7\n10 10\n2 2\n1 8",
"output": "-1"
},
{
"input": "55\n3 4\n6 8\n9 10\n3 9\n9 9\n2 5\n4 8\n3 8\n8 10\n1 1\n4 9\n10 10\n6 6\n8 8\n1 8\n5 5\n4 5\n5 9\n2 2\n3 10\n4 6\n3 6\n1 6\n1 7\n6 10\n2 6\n3 7\n2 4\n4 4\n5 10\n1 4\n2 9\n1 3\n7 9\n7 8\n1 9\n1 10\n2 8\n8 9\n6 7\n1 2\n6 9\n7 7\n4 7\n3 3\n2 7\n4 10\n7 10\n2 3\n2 10\n5 7\n3 5\n5 8\n1 5\n5 6",
"output": "37"
},
{
"input": "1\n999999999 1000000000",
"output": "1"
},
{
"input": "3\n1 20\n2 22\n3 18",
"output": "-1"
},
{
"input": "1\n1000000000 1000000000",
"output": "1"
},
{
"input": "2\n100001 100008\n100005 100006",
"output": "1"
},
{
"input": "1\n1000000 10000000",
"output": "1"
},
{
"input": "3\n3 6\n2 4\n1 5",
"output": "-1"
},
{
"input": "2\n3 5\n1 2",
"output": "-1"
}
] | 1,585,860,422 | 2,147,483,647 | PyPy 3 | OK | TESTS | 45 | 1,902 | 16,076,800 | n=int(input())
L=[]
aG=0;
mini = 1000000000
maxi = -1000000000;
for i in range(0,n):
a=input().rstrip().split(' ')
L.append(a)
if int(a[0])<=mini and int(a[1])>=maxi:
G=int(a[0]);
H=int(a[1]);
S=i;
mini = int(a[0])
maxi = int(a[1])
#print(S,mini,maxi)
for i in range(0,len(L)):
A=L[i];
# print(A)
if int(A[0])>=mini and int(A[0])<=maxi and int(A[1])>=mini and int(A[1]) <= maxi:
continue;
else:
aG=1;
break;
# print(i)
if aG==1:
print(-1)
else:
print(S+1); | Title: Big Segment
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A coordinate line has *n* segments, the *i*-th segment starts at the position *l**i* and ends at the position *r**i*. We will denote such a segment as [*l**i*,<=*r**i*].
You have suggested that one of the defined segments covers all others. In other words, there is such segment in the given set, which contains all other ones. Now you want to test your assumption. Find in the given set the segment which covers all other segments, and print its number. If such a segment doesn't exist, print -1.
Formally we will assume that segment [*a*,<=*b*] covers segment [*c*,<=*d*], if they meet this condition *a*<=≤<=*c*<=≤<=*d*<=≤<=*b*.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of segments. Next *n* lines contain the descriptions of the segments. The *i*-th line contains two space-separated integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=109) — the borders of the *i*-th segment.
It is guaranteed that no two segments coincide.
Output Specification:
Print a single integer — the number of the segment that covers all other segments in the set. If there's no solution, print -1.
The segments are numbered starting from 1 in the order in which they appear in the input.
Demo Input:
['3\n1 1\n2 2\n3 3\n', '6\n1 5\n2 3\n1 10\n7 10\n7 7\n10 10\n']
Demo Output:
['-1\n', '3\n']
Note:
none | ```python
n=int(input())
L=[]
aG=0;
mini = 1000000000
maxi = -1000000000;
for i in range(0,n):
a=input().rstrip().split(' ')
L.append(a)
if int(a[0])<=mini and int(a[1])>=maxi:
G=int(a[0]);
H=int(a[1]);
S=i;
mini = int(a[0])
maxi = int(a[1])
#print(S,mini,maxi)
for i in range(0,len(L)):
A=L[i];
# print(A)
if int(A[0])>=mini and int(A[0])<=maxi and int(A[1])>=mini and int(A[1]) <= maxi:
continue;
else:
aG=1;
break;
# print(i)
if aG==1:
print(-1)
else:
print(S+1);
``` | 3 |
|
920 | A | Water The Garden | PROGRAMMING | 1,000 | [
"implementation"
] | null | null | It is winter now, and Max decided it's about time he watered the garden.
The garden can be represented as *n* consecutive garden beds, numbered from 1 to *n*. *k* beds contain water taps (*i*-th tap is located in the bed *x**i*), which, if turned on, start delivering water to neighbouring beds. If the tap on the bed *x**i* is turned on, then after one second has passed, the bed *x**i* will be watered; after two seconds have passed, the beds from the segment [*x**i*<=-<=1,<=*x**i*<=+<=1] will be watered (if they exist); after *j* seconds have passed (*j* is an integer number), the beds from the segment [*x**i*<=-<=(*j*<=-<=1),<=*x**i*<=+<=(*j*<=-<=1)] will be watered (if they exist). Nothing changes during the seconds, so, for example, we can't say that the segment [*x**i*<=-<=2.5,<=*x**i*<=+<=2.5] will be watered after 2.5 seconds have passed; only the segment [*x**i*<=-<=2,<=*x**i*<=+<=2] will be watered at that moment.
Max wants to turn on all the water taps at the same moment, and now he wonders, what is the minimum number of seconds that have to pass after he turns on some taps until the whole garden is watered. Help him to find the answer! | The first line contains one integer *t* — the number of test cases to solve (1<=≤<=*t*<=≤<=200).
Then *t* test cases follow. The first line of each test case contains two integers *n* and *k* (1<=≤<=*n*<=≤<=200, 1<=≤<=*k*<=≤<=*n*) — the number of garden beds and water taps, respectively.
Next line contains *k* integers *x**i* (1<=≤<=*x**i*<=≤<=*n*) — the location of *i*-th water tap. It is guaranteed that for each condition *x**i*<=-<=1<=<<=*x**i* holds.
It is guaranteed that the sum of *n* over all test cases doesn't exceed 200.
Note that in hacks you have to set *t*<==<=1. | For each test case print one integer — the minimum number of seconds that have to pass after Max turns on some of the water taps, until the whole garden is watered. | [
"3\n5 1\n3\n3 3\n1 2 3\n4 1\n1\n"
] | [
"3\n1\n4\n"
] | The first example consists of 3 tests:
1. There are 5 garden beds, and a water tap in the bed 3. If we turn it on, then after 1 second passes, only bed 3 will be watered; after 2 seconds pass, beds [1, 3] will be watered, and after 3 seconds pass, everything will be watered. 1. There are 3 garden beds, and there is a water tap in each one. If we turn all of them on, then everything will be watered after 1 second passes. 1. There are 4 garden beds, and only one tap in the bed 1. It will take 4 seconds to water, for example, bed 4. | 0 | [
{
"input": "3\n5 1\n3\n3 3\n1 2 3\n4 1\n1",
"output": "3\n1\n4"
},
{
"input": "26\n1 1\n1\n2 1\n2\n2 1\n1\n2 2\n1 2\n3 1\n3\n3 1\n2\n3 2\n2 3\n3 1\n1\n3 2\n1 3\n3 2\n1 2\n3 3\n1 2 3\n4 1\n4\n4 1\n3\n4 2\n3 4\n4 1\n2\n4 2\n2 4\n4 2\n2 3\n4 3\n2 3 4\n4 1\n1\n4 2\n1 4\n4 2\n1 3\n4 3\n1 3 4\n4 2\n1 2\n4 3\n1 2 4\n4 3\n1 2 3\n4 4\n1 2 3 4",
"output": "1\n2\n2\n1\n3\n2\n2\n3\n2\n2\n1\n4\n3\n3\n3\n2\n2\n2\n4\n2\n2\n2\n3\n2\n2\n1"
},
{
"input": "31\n5 1\n5\n5 1\n4\n5 2\n4 5\n5 1\n3\n5 2\n3 5\n5 2\n3 4\n5 3\n3 4 5\n5 1\n2\n5 2\n2 5\n5 2\n2 4\n5 3\n2 4 5\n5 2\n2 3\n5 3\n2 3 5\n5 3\n2 3 4\n5 4\n2 3 4 5\n5 1\n1\n5 2\n1 5\n5 2\n1 4\n5 3\n1 4 5\n5 2\n1 3\n5 3\n1 3 5\n5 3\n1 3 4\n5 4\n1 3 4 5\n5 2\n1 2\n5 3\n1 2 5\n5 3\n1 2 4\n5 4\n1 2 4 5\n5 3\n1 2 3\n5 4\n1 2 3 5\n5 4\n1 2 3 4\n5 5\n1 2 3 4 5",
"output": "5\n4\n4\n3\n3\n3\n3\n4\n2\n2\n2\n3\n2\n2\n2\n5\n3\n2\n2\n3\n2\n2\n2\n4\n2\n2\n2\n3\n2\n2\n1"
},
{
"input": "1\n200 1\n200",
"output": "200"
},
{
"input": "1\n5 1\n5",
"output": "5"
},
{
"input": "1\n177 99\n1 4 7 10 11 13 14 15 16 17 19 21 22 24 25 26 27 28 32 34 35 38 39 40 42 45 46 52 54 55 57 58 59 60 62 64 65 67 70 71 74 77 78 79 80 81 83 84 88 92 93 94 95 100 101 102 104 106 107 108 109 110 112 113 114 115 116 118 122 123 124 125 127 128 129 130 134 135 137 138 139 140 142 146 148 149 154 158 160 161 162 165 166 167 169 171 172 173 176",
"output": "4"
},
{
"input": "1\n69 12\n5 7 10 11 12 18 20 27 28 31 47 67",
"output": "11"
},
{
"input": "1\n74 7\n19 39 40 47 55 57 61",
"output": "19"
},
{
"input": "1\n170 11\n14 18 37 39 80 83 103 112 124 127 131",
"output": "40"
},
{
"input": "1\n200 1\n8",
"output": "193"
},
{
"input": "1\n155 53\n2 3 7 9 10 11 12 20 24 26 28 31 38 39 40 51 53 56 58 63 65 66 69 70 72 74 79 81 83 88 90 92 100 103 104 106 111 113 114 115 116 121 124 126 127 128 133 136 142 143 145 148 150",
"output": "6"
},
{
"input": "1\n161 69\n2 5 8 11 12 13 17 18 23 25 28 29 30 33 34 35 36 38 39 44 45 49 52 53 56 57 58 60 62 70 71 74 76 77 82 83 86 90 94 95 97 104 105 108 109 112 113 118 120 123 126 127 132 135 137 139 140 141 142 143 144 146 147 148 151 152 153 154 161",
"output": "5"
},
{
"input": "1\n8 4\n1 2 3 7",
"output": "3"
},
{
"input": "1\n12 2\n5 12",
"output": "5"
},
{
"input": "1\n13 2\n6 12",
"output": "6"
},
{
"input": "1\n13 2\n8 13",
"output": "8"
},
{
"input": "1\n10 4\n1 2 3 5",
"output": "6"
},
{
"input": "1\n200 2\n50 150",
"output": "51"
},
{
"input": "1\n110 2\n1 110",
"output": "55"
}
] | 1,517,584,887 | 2,787 | Python 3 | WRONG_ANSWER | TESTS | 1 | 62 | 5,632,000 | t = int(input())
for _ in range(t):
n, k = map(int, input().split())
arr = list(map(int, input().split()))
s = 1
t = [False] * n
for i in arr:
t[i-1] = True
while set(t) != {True}:
q = list(t)
s += 1
for j in range(n):
if j+1 < n:
if q[j+1] == True:
t[j] = True
if j-1 < n:
if q[j-1] == True:
t[j] = True
print(s) | Title: Water The Garden
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
It is winter now, and Max decided it's about time he watered the garden.
The garden can be represented as *n* consecutive garden beds, numbered from 1 to *n*. *k* beds contain water taps (*i*-th tap is located in the bed *x**i*), which, if turned on, start delivering water to neighbouring beds. If the tap on the bed *x**i* is turned on, then after one second has passed, the bed *x**i* will be watered; after two seconds have passed, the beds from the segment [*x**i*<=-<=1,<=*x**i*<=+<=1] will be watered (if they exist); after *j* seconds have passed (*j* is an integer number), the beds from the segment [*x**i*<=-<=(*j*<=-<=1),<=*x**i*<=+<=(*j*<=-<=1)] will be watered (if they exist). Nothing changes during the seconds, so, for example, we can't say that the segment [*x**i*<=-<=2.5,<=*x**i*<=+<=2.5] will be watered after 2.5 seconds have passed; only the segment [*x**i*<=-<=2,<=*x**i*<=+<=2] will be watered at that moment.
Max wants to turn on all the water taps at the same moment, and now he wonders, what is the minimum number of seconds that have to pass after he turns on some taps until the whole garden is watered. Help him to find the answer!
Input Specification:
The first line contains one integer *t* — the number of test cases to solve (1<=≤<=*t*<=≤<=200).
Then *t* test cases follow. The first line of each test case contains two integers *n* and *k* (1<=≤<=*n*<=≤<=200, 1<=≤<=*k*<=≤<=*n*) — the number of garden beds and water taps, respectively.
Next line contains *k* integers *x**i* (1<=≤<=*x**i*<=≤<=*n*) — the location of *i*-th water tap. It is guaranteed that for each condition *x**i*<=-<=1<=<<=*x**i* holds.
It is guaranteed that the sum of *n* over all test cases doesn't exceed 200.
Note that in hacks you have to set *t*<==<=1.
Output Specification:
For each test case print one integer — the minimum number of seconds that have to pass after Max turns on some of the water taps, until the whole garden is watered.
Demo Input:
['3\n5 1\n3\n3 3\n1 2 3\n4 1\n1\n']
Demo Output:
['3\n1\n4\n']
Note:
The first example consists of 3 tests:
1. There are 5 garden beds, and a water tap in the bed 3. If we turn it on, then after 1 second passes, only bed 3 will be watered; after 2 seconds pass, beds [1, 3] will be watered, and after 3 seconds pass, everything will be watered. 1. There are 3 garden beds, and there is a water tap in each one. If we turn all of them on, then everything will be watered after 1 second passes. 1. There are 4 garden beds, and only one tap in the bed 1. It will take 4 seconds to water, for example, bed 4. | ```python
t = int(input())
for _ in range(t):
n, k = map(int, input().split())
arr = list(map(int, input().split()))
s = 1
t = [False] * n
for i in arr:
t[i-1] = True
while set(t) != {True}:
q = list(t)
s += 1
for j in range(n):
if j+1 < n:
if q[j+1] == True:
t[j] = True
if j-1 < n:
if q[j-1] == True:
t[j] = True
print(s)
``` | 0 |
|
25 | A | IQ test | PROGRAMMING | 1,300 | [
"brute force"
] | A. IQ test | 2 | 256 | Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness. | The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness. | Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order. | [
"5\n2 4 7 8 10\n",
"4\n1 2 1 1\n"
] | [
"3\n",
"2\n"
] | none | 0 | [
{
"input": "5\n2 4 7 8 10",
"output": "3"
},
{
"input": "4\n1 2 1 1",
"output": "2"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n100 99 100",
"output": "2"
},
{
"input": "3\n5 3 2",
"output": "3"
},
{
"input": "4\n43 28 1 91",
"output": "2"
},
{
"input": "4\n75 13 94 77",
"output": "3"
},
{
"input": "4\n97 8 27 3",
"output": "2"
},
{
"input": "10\n95 51 12 91 85 3 1 31 25 7",
"output": "3"
},
{
"input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46",
"output": "4"
},
{
"input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36",
"output": "26"
},
{
"input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83",
"output": "48"
},
{
"input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25",
"output": "1"
},
{
"input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46",
"output": "25"
},
{
"input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73",
"output": "13"
},
{
"input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76",
"output": "99"
},
{
"input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14",
"output": "1"
},
{
"input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22",
"output": "93"
},
{
"input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23",
"output": "1"
},
{
"input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98",
"output": "1"
},
{
"input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94",
"output": "93"
},
{
"input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29",
"output": "32"
},
{
"input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47",
"output": "26"
},
{
"input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72",
"output": "56"
},
{
"input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86",
"output": "97"
},
{
"input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42",
"output": "79"
},
{
"input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52",
"output": "25"
},
{
"input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86",
"output": "78"
},
{
"input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68",
"output": "70"
},
{
"input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81",
"output": "39"
},
{
"input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83",
"output": "88"
},
{
"input": "3\n100 100 1",
"output": "3"
}
] | 1,645,417,899 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 2 | 186 | 0 | n=int(input())
lst=[int(i) for i in input().split()]
diff_lst=[]
for i in range(len(lst)-1):
diff_lst.append(lst[i]-lst[i+1])
diff_prop=0
for i in set(diff_lst):
if i!=max(set(diff_lst)) and i!=min(set(diff_lst)):
diff_prop=i
break
ans=0
for i in range(len(diff_lst)):
if diff_lst[i]!=diff_prop:
ans=i+2
break
print(ans) | Title: IQ test
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output Specification:
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
Demo Input:
['5\n2 4 7 8 10\n', '4\n1 2 1 1\n']
Demo Output:
['3\n', '2\n']
Note:
none | ```python
n=int(input())
lst=[int(i) for i in input().split()]
diff_lst=[]
for i in range(len(lst)-1):
diff_lst.append(lst[i]-lst[i+1])
diff_prop=0
for i in set(diff_lst):
if i!=max(set(diff_lst)) and i!=min(set(diff_lst)):
diff_prop=i
break
ans=0
for i in range(len(diff_lst)):
if diff_lst[i]!=diff_prop:
ans=i+2
break
print(ans)
``` | 0 |
946 | A | Partition | PROGRAMMING | 800 | [
"greedy"
] | null | null | You are given a sequence *a* consisting of *n* integers. You may partition this sequence into two sequences *b* and *c* in such a way that every element belongs exactly to one of these sequences.
Let *B* be the sum of elements belonging to *b*, and *C* be the sum of elements belonging to *c* (if some of these sequences is empty, then its sum is 0). What is the maximum possible value of *B*<=-<=*C*? | The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of elements in *a*.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (<=-<=100<=≤<=*a**i*<=≤<=100) — the elements of sequence *a*. | Print the maximum possible value of *B*<=-<=*C*, where *B* is the sum of elements of sequence *b*, and *C* is the sum of elements of sequence *c*. | [
"3\n1 -2 0\n",
"6\n16 23 16 15 42 8\n"
] | [
"3\n",
"120\n"
] | In the first example we may choose *b* = {1, 0}, *c* = { - 2}. Then *B* = 1, *C* = - 2, *B* - *C* = 3.
In the second example we choose *b* = {16, 23, 16, 15, 42, 8}, *c* = {} (an empty sequence). Then *B* = 120, *C* = 0, *B* - *C* = 120. | 0 | [
{
"input": "3\n1 -2 0",
"output": "3"
},
{
"input": "6\n16 23 16 15 42 8",
"output": "120"
},
{
"input": "1\n-1",
"output": "1"
},
{
"input": "100\n-100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100 -100",
"output": "10000"
},
{
"input": "2\n-1 5",
"output": "6"
},
{
"input": "3\n-2 0 1",
"output": "3"
},
{
"input": "12\n-1 -2 -3 4 4 -6 -6 56 3 3 -3 3",
"output": "94"
},
{
"input": "4\n1 -1 1 -1",
"output": "4"
},
{
"input": "4\n100 -100 100 -100",
"output": "400"
},
{
"input": "3\n-2 -5 10",
"output": "17"
},
{
"input": "5\n1 -2 3 -4 5",
"output": "15"
},
{
"input": "3\n-100 100 -100",
"output": "300"
},
{
"input": "6\n1 -1 1 -1 1 -1",
"output": "6"
},
{
"input": "6\n2 -2 2 -2 2 -2",
"output": "12"
},
{
"input": "9\n12 93 -2 0 0 0 3 -3 -9",
"output": "122"
},
{
"input": "6\n-1 2 4 -5 -3 55",
"output": "70"
},
{
"input": "6\n-12 8 68 -53 1 -15",
"output": "157"
},
{
"input": "2\n-2 1",
"output": "3"
},
{
"input": "3\n100 -100 100",
"output": "300"
},
{
"input": "5\n100 100 -1 -100 2",
"output": "303"
},
{
"input": "6\n-5 -4 -3 -2 -1 0",
"output": "15"
},
{
"input": "6\n4 4 4 -3 -3 2",
"output": "20"
},
{
"input": "2\n-1 2",
"output": "3"
},
{
"input": "1\n100",
"output": "100"
},
{
"input": "5\n-1 -2 3 1 2",
"output": "9"
},
{
"input": "5\n100 -100 100 -100 100",
"output": "500"
},
{
"input": "5\n1 -1 1 -1 1",
"output": "5"
},
{
"input": "4\n0 0 0 -1",
"output": "1"
},
{
"input": "5\n100 -100 -1 2 100",
"output": "303"
},
{
"input": "2\n75 0",
"output": "75"
},
{
"input": "4\n55 56 -59 -58",
"output": "228"
},
{
"input": "2\n9 71",
"output": "80"
},
{
"input": "2\n9 70",
"output": "79"
},
{
"input": "2\n9 69",
"output": "78"
},
{
"input": "2\n100 -100",
"output": "200"
},
{
"input": "4\n-9 4 -9 5",
"output": "27"
},
{
"input": "42\n91 -27 -79 -56 80 -93 -23 10 80 94 61 -89 -64 81 34 99 31 -32 -69 92 79 -9 73 66 -8 64 99 99 58 -19 -40 21 1 -33 93 -23 -62 27 55 41 57 36",
"output": "2348"
},
{
"input": "7\n-1 2 2 2 -1 2 -1",
"output": "11"
},
{
"input": "6\n-12 8 17 -69 7 -88",
"output": "201"
},
{
"input": "3\n1 -2 5",
"output": "8"
},
{
"input": "6\n-2 3 -4 5 6 -1",
"output": "21"
},
{
"input": "2\n-5 1",
"output": "6"
},
{
"input": "4\n2 2 -2 4",
"output": "10"
},
{
"input": "68\n21 47 -75 -25 64 83 83 -21 89 24 43 44 -35 34 -42 92 -96 -52 -66 64 14 -87 25 -61 -78 83 -96 -18 95 83 -93 -28 75 49 87 65 -93 -69 -2 95 -24 -36 -61 -71 88 -53 -93 -51 -81 -65 -53 -46 -56 6 65 58 19 100 57 61 -53 44 -58 48 -8 80 -88 72",
"output": "3991"
},
{
"input": "5\n5 5 -10 -1 1",
"output": "22"
},
{
"input": "3\n-1 2 3",
"output": "6"
},
{
"input": "76\n57 -38 -48 -81 93 -32 96 55 -44 2 38 -46 42 64 71 -73 95 31 -39 -62 -1 75 -17 57 28 52 12 -11 82 -84 59 -86 73 -97 34 97 -57 -85 -6 39 -5 -54 95 24 -44 35 -18 9 91 7 -22 -61 -80 54 -40 74 -90 15 -97 66 -52 -49 -24 65 21 -93 -29 -24 -4 -1 76 -93 7 -55 -53 1",
"output": "3787"
},
{
"input": "5\n-1 -2 1 2 3",
"output": "9"
},
{
"input": "4\n2 2 -2 -2",
"output": "8"
},
{
"input": "6\n100 -100 100 -100 100 -100",
"output": "600"
},
{
"input": "100\n-59 -33 34 0 69 24 -22 58 62 -36 5 45 -19 -73 61 -9 95 42 -73 -64 91 -96 2 53 -8 82 -79 16 18 -5 -53 26 71 38 -31 12 -33 -1 -65 -6 3 -89 22 33 -27 -36 41 11 -47 -32 47 -56 -38 57 -63 -41 23 41 29 78 16 -65 90 -58 -12 6 -60 42 -36 -52 -54 -95 -10 29 70 50 -94 1 93 48 -71 -77 -16 54 56 -60 66 76 31 8 44 -61 -74 23 37 38 18 -18 29 41",
"output": "4362"
},
{
"input": "2\n-1 1",
"output": "2"
},
{
"input": "3\n1 -2 100",
"output": "103"
},
{
"input": "5\n1 -2 3 1 2",
"output": "9"
},
{
"input": "10\n100 -10 -100 10 10 10 10 10 10 10",
"output": "280"
},
{
"input": "4\n2 0 -2 4",
"output": "8"
},
{
"input": "4\n3 -3 1 -1",
"output": "8"
},
{
"input": "3\n1 -1 1",
"output": "3"
},
{
"input": "4\n2 5 -2 4",
"output": "13"
},
{
"input": "2\n-2 2",
"output": "4"
},
{
"input": "3\n1 -2 1",
"output": "4"
},
{
"input": "5\n-1 -2 1 1 -1",
"output": "6"
},
{
"input": "4\n-2 0 2 4",
"output": "8"
},
{
"input": "8\n-42 7 87 -16 -5 65 -88 1",
"output": "311"
},
{
"input": "3\n1 -3 4",
"output": "8"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "2\n0 1",
"output": "1"
},
{
"input": "3\n-1 2 -1",
"output": "4"
},
{
"input": "18\n-21 12 65 66 -24 62 82 35 -45 -47 28 37 5 -32 22 -14 -69 -95",
"output": "761"
},
{
"input": "4\n-1 1 -1 1",
"output": "4"
},
{
"input": "5\n-1 2 1 1 1",
"output": "6"
},
{
"input": "3\n1 1 1",
"output": "3"
}
] | 1,580,799,944 | 2,147,483,647 | Python 3 | OK | TESTS | 72 | 109 | 0 | n = int(input())
b, c = 0, 0
for i in map(int, input().split()):
if i < 0:
c += i
else:
b += i
print(b - c)
| Title: Partition
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a sequence *a* consisting of *n* integers. You may partition this sequence into two sequences *b* and *c* in such a way that every element belongs exactly to one of these sequences.
Let *B* be the sum of elements belonging to *b*, and *C* be the sum of elements belonging to *c* (if some of these sequences is empty, then its sum is 0). What is the maximum possible value of *B*<=-<=*C*?
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=100) — the number of elements in *a*.
The second line contains *n* integers *a*1, *a*2, ..., *a**n* (<=-<=100<=≤<=*a**i*<=≤<=100) — the elements of sequence *a*.
Output Specification:
Print the maximum possible value of *B*<=-<=*C*, where *B* is the sum of elements of sequence *b*, and *C* is the sum of elements of sequence *c*.
Demo Input:
['3\n1 -2 0\n', '6\n16 23 16 15 42 8\n']
Demo Output:
['3\n', '120\n']
Note:
In the first example we may choose *b* = {1, 0}, *c* = { - 2}. Then *B* = 1, *C* = - 2, *B* - *C* = 3.
In the second example we choose *b* = {16, 23, 16, 15, 42, 8}, *c* = {} (an empty sequence). Then *B* = 120, *C* = 0, *B* - *C* = 120. | ```python
n = int(input())
b, c = 0, 0
for i in map(int, input().split()):
if i < 0:
c += i
else:
b += i
print(b - c)
``` | 3 |
|
975 | C | Valhalla Siege | PROGRAMMING | 1,400 | [
"binary search"
] | null | null | Ivar the Boneless is a great leader. He is trying to capture Kattegat from Lagertha. The war has begun and wave after wave Ivar's warriors are falling in battle.
Ivar has $n$ warriors, he places them on a straight line in front of the main gate, in a way that the $i$-th warrior stands right after $(i-1)$-th warrior. The first warrior leads the attack.
Each attacker can take up to $a_i$ arrows before he falls to the ground, where $a_i$ is the $i$-th warrior's strength.
Lagertha orders her warriors to shoot $k_i$ arrows during the $i$-th minute, the arrows one by one hit the first still standing warrior. After all Ivar's warriors fall and all the currently flying arrows fly by, Thor smashes his hammer and all Ivar's warriors get their previous strengths back and stand up to fight again. In other words, if all warriors die in minute $t$, they will all be standing to fight at the end of minute $t$.
The battle will last for $q$ minutes, after each minute you should tell Ivar what is the number of his standing warriors. | The first line contains two integers $n$ and $q$ ($1 \le n, q \leq 200\,000$) — the number of warriors and the number of minutes in the battle.
The second line contains $n$ integers $a_1, a_2, \ldots, a_n$ ($1 \leq a_i \leq 10^9$) that represent the warriors' strengths.
The third line contains $q$ integers $k_1, k_2, \ldots, k_q$ ($1 \leq k_i \leq 10^{14}$), the $i$-th of them represents Lagertha's order at the $i$-th minute: $k_i$ arrows will attack the warriors. | Output $q$ lines, the $i$-th of them is the number of standing warriors after the $i$-th minute. | [
"5 5\n1 2 1 2 1\n3 10 1 1 1\n",
"4 4\n1 2 3 4\n9 1 10 6\n"
] | [
"3\n5\n4\n4\n3\n",
"1\n4\n4\n1\n"
] | In the first example:
- after the 1-st minute, the 1-st and 2-nd warriors die. - after the 2-nd minute all warriors die (and all arrows left over are wasted), then they will be revived thus answer is 5 — all warriors are alive. - after the 3-rd minute, the 1-st warrior dies. - after the 4-th minute, the 2-nd warrior takes a hit and his strength decreases by 1. - after the 5-th minute, the 2-nd warrior dies. | 1,500 | [
{
"input": "5 5\n1 2 1 2 1\n3 10 1 1 1",
"output": "3\n5\n4\n4\n3"
},
{
"input": "4 4\n1 2 3 4\n9 1 10 6",
"output": "1\n4\n4\n1"
},
{
"input": "10 3\n1 1 1 1 1 1 1 1 1 1\n10 10 5",
"output": "10\n10\n5"
},
{
"input": "1 1\n56563128\n897699770",
"output": "1"
},
{
"input": "100 55\n1 2 4 4 3 5 5 2 3 4 2 1 1 2 3 5 1 5 4 2 5 4 4 3 3 5 3 4 4 5 5 2 3 3 4 4 3 4 5 5 5 5 3 5 1 2 4 3 4 5 3 3 2 1 4 5 3 4 4 1 5 1 5 2 2 1 4 5 3 3 1 4 2 5 4 5 3 2 5 5 2 3 2 3 2 2 3 4 4 4 1 4 2 4 5 3 1 3 3 1\n5 2 1 4 3 4 3 1 4 4 1 2 3 2 1 5 5 4 5 4 2 5 2 1 5 1 4 4 3 5 4 5 1 4 4 1 5 3 1 5 2 4 1 3 2 5 4 5 4 3 4 2 2 4 3",
"output": "98\n97\n97\n96\n95\n94\n94\n94\n92\n91\n91\n90\n87\n86\n86\n85\n83\n82\n80\n80\n79\n78\n77\n77\n75\n75\n74\n73\n72\n71\n70\n69\n69\n67\n66\n66\n65\n64\n63\n62\n62\n61\n61\n60\n60\n59\n58\n57\n54\n54\n52\n52\n51\n51\n50"
}
] | 1,525,889,026 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 5 | 2,000 | 17,203,200 | n,q=map(int,input().split())
a,cd,cc=list(map(int,input().split())),0,0
for k in input().split():
k=int(k)
while k:
if a[cc]<=k+cd:
cd-=a[cc]
if cd<0:
cd,k=0,k+cd
cc+=1
else:
cd,k=k+cd,0
if cc>=n:
break
if cc>=n:
cc=0
print(n-cc)
| Title: Valhalla Siege
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ivar the Boneless is a great leader. He is trying to capture Kattegat from Lagertha. The war has begun and wave after wave Ivar's warriors are falling in battle.
Ivar has $n$ warriors, he places them on a straight line in front of the main gate, in a way that the $i$-th warrior stands right after $(i-1)$-th warrior. The first warrior leads the attack.
Each attacker can take up to $a_i$ arrows before he falls to the ground, where $a_i$ is the $i$-th warrior's strength.
Lagertha orders her warriors to shoot $k_i$ arrows during the $i$-th minute, the arrows one by one hit the first still standing warrior. After all Ivar's warriors fall and all the currently flying arrows fly by, Thor smashes his hammer and all Ivar's warriors get their previous strengths back and stand up to fight again. In other words, if all warriors die in minute $t$, they will all be standing to fight at the end of minute $t$.
The battle will last for $q$ minutes, after each minute you should tell Ivar what is the number of his standing warriors.
Input Specification:
The first line contains two integers $n$ and $q$ ($1 \le n, q \leq 200\,000$) — the number of warriors and the number of minutes in the battle.
The second line contains $n$ integers $a_1, a_2, \ldots, a_n$ ($1 \leq a_i \leq 10^9$) that represent the warriors' strengths.
The third line contains $q$ integers $k_1, k_2, \ldots, k_q$ ($1 \leq k_i \leq 10^{14}$), the $i$-th of them represents Lagertha's order at the $i$-th minute: $k_i$ arrows will attack the warriors.
Output Specification:
Output $q$ lines, the $i$-th of them is the number of standing warriors after the $i$-th minute.
Demo Input:
['5 5\n1 2 1 2 1\n3 10 1 1 1\n', '4 4\n1 2 3 4\n9 1 10 6\n']
Demo Output:
['3\n5\n4\n4\n3\n', '1\n4\n4\n1\n']
Note:
In the first example:
- after the 1-st minute, the 1-st and 2-nd warriors die. - after the 2-nd minute all warriors die (and all arrows left over are wasted), then they will be revived thus answer is 5 — all warriors are alive. - after the 3-rd minute, the 1-st warrior dies. - after the 4-th minute, the 2-nd warrior takes a hit and his strength decreases by 1. - after the 5-th minute, the 2-nd warrior dies. | ```python
n,q=map(int,input().split())
a,cd,cc=list(map(int,input().split())),0,0
for k in input().split():
k=int(k)
while k:
if a[cc]<=k+cd:
cd-=a[cc]
if cd<0:
cd,k=0,k+cd
cc+=1
else:
cd,k=k+cd,0
if cc>=n:
break
if cc>=n:
cc=0
print(n-cc)
``` | 0 |
|
5 | B | Center Alignment | PROGRAMMING | 1,200 | [
"implementation",
"strings"
] | B. Center Alignment | 1 | 64 | Almost every text editor has a built-in function of center text alignment. The developers of the popular in Berland text editor «Textpad» decided to introduce this functionality into the fourth release of the product.
You are to implement the alignment in the shortest possible time. Good luck! | The input file consists of one or more lines, each of the lines contains Latin letters, digits and/or spaces. The lines cannot start or end with a space. It is guaranteed that at least one of the lines has positive length. The length of each line and the total amount of the lines do not exceed 1000. | Format the given text, aligning it center. Frame the whole text with characters «*» of the minimum size. If a line cannot be aligned perfectly (for example, the line has even length, while the width of the block is uneven), you should place such lines rounding down the distance to the left or to the right edge and bringing them closer left or right alternatively (you should start with bringing left). Study the sample tests carefully to understand the output format better. | [
"This is\n\nCodeforces\nBeta\nRound\n5\n",
"welcome to the\nCodeforces\nBeta\nRound 5\n\nand\ngood luck\n"
] | [
"************\n* This is *\n* *\n*Codeforces*\n* Beta *\n* Round *\n* 5 *\n************\n",
"****************\n*welcome to the*\n* Codeforces *\n* Beta *\n* Round 5 *\n* *\n* and *\n* good luck *\n****************\n"
] | none | 0 | [
{
"input": "This is\n\nCodeforces\nBeta\nRound\n5",
"output": "************\n* This is *\n* *\n*Codeforces*\n* Beta *\n* Round *\n* 5 *\n************"
},
{
"input": "welcome to the\nCodeforces\nBeta\nRound 5\n\nand\ngood luck",
"output": "****************\n*welcome to the*\n* Codeforces *\n* Beta *\n* Round 5 *\n* *\n* and *\n* good luck *\n****************"
},
{
"input": "0\n2",
"output": "***\n*0*\n*2*\n***"
},
{
"input": "O\no\nd",
"output": "***\n*O*\n*o*\n*d*\n***"
},
{
"input": "0v uO M6Sy",
"output": "************\n*0v uO M6Sy*\n************"
},
{
"input": "fm v\nOL U W",
"output": "**********\n* fm v *\n*OL U W*\n**********"
},
{
"input": "vb\nJ\nyU\nZ",
"output": "****\n*vb*\n*J *\n*yU*\n* Z*\n****"
},
{
"input": "N\nSV\nEh\n6f\nX6\n9e",
"output": "****\n*N *\n*SV*\n*Eh*\n*6f*\n*X6*\n*9e*\n****"
},
{
"input": "Pj\nA\nFA\nP\nVJ\nU\nEb\nW",
"output": "****\n*Pj*\n*A *\n*FA*\n* P*\n*VJ*\n*U *\n*Eb*\n* W*\n****"
},
{
"input": "T\n7j\nS\nb\nq8\nVZ\nn\n4T\niZ\npA",
"output": "****\n*T *\n*7j*\n* S*\n*b *\n*q8*\n*VZ*\n* n*\n*4T*\n*iZ*\n*pA*\n****"
},
{
"input": "8\n\n\n\ny\nW\n\n\n\n3B\n\nw\nV\n\n\n\nL\nSr\n\n\nV\n\n5\n\nAq\n\n\n\nJ\nR\n\n04\nJ\nv\nhU\n\n\n\nY\nG\n4\n\nG\nb\n\n\n9\n\n6\nd\n\n2\n\n\nE\n7\n\nr\n\n\n\n\nKC\ns\nE\n\nab\n4\nx\n\n\n\n\n\nEe\n4\n\nl\n\np\n\nG\nM\n\n\nn\n\n\nm0\n\nw\n\n\nP\n\n\n\n0",
"output": "****\n*8 *\n* *\n* *\n* *\n* y*\n*W *\n* *\n* *\n* *\n*3B*\n* *\n* w*\n*V *\n* *\n* *\n* *\n* L*\n*Sr*\n* *\n* *\n*V *\n* *\n* 5*\n* *\n*Aq*\n* *\n* *\n* *\n*J *\n* R*\n* *\n*04*\n*J *\n* v*\n*hU*\n* *\n* *\n* *\n*Y *\n* G*\n*4 *\n* *\n* G*\n*b *\n* *\n* *\n* 9*\n* *\n*6 *\n* d*\n* *\n*2 *\n* *\n* *\n* E*\n*7 *\n* *\n* r*\n* *\n* *\n* *\n* *\n*KC*\n*s *\n* E*\n* *\n*ab*\n*4 *\n* x*\n* *\n* *\n* *\n* *\n* *\n*Ee*\n*4 *\n* *\n* l*\n* *\n*p *\n* *\n* G*\n*M *\n* *\n*..."
},
{
"input": "U",
"output": "***\n*U*\n***"
}
] | 1,474,470,618 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 60 | 0 | l=[]
maxx=0
while True:
try:
l.append(input())
except EOFError:
break
for x in l:
if len(x)>maxx:
maxx=len(x)
print("*"*(maxx+2))
for i in l:
print("*"+i.center(maxx," ")+"*")
print("*" * (maxx + 2))
| Title: Center Alignment
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Almost every text editor has a built-in function of center text alignment. The developers of the popular in Berland text editor «Textpad» decided to introduce this functionality into the fourth release of the product.
You are to implement the alignment in the shortest possible time. Good luck!
Input Specification:
The input file consists of one or more lines, each of the lines contains Latin letters, digits and/or spaces. The lines cannot start or end with a space. It is guaranteed that at least one of the lines has positive length. The length of each line and the total amount of the lines do not exceed 1000.
Output Specification:
Format the given text, aligning it center. Frame the whole text with characters «*» of the minimum size. If a line cannot be aligned perfectly (for example, the line has even length, while the width of the block is uneven), you should place such lines rounding down the distance to the left or to the right edge and bringing them closer left or right alternatively (you should start with bringing left). Study the sample tests carefully to understand the output format better.
Demo Input:
['This is\n\nCodeforces\nBeta\nRound\n5\n', 'welcome to the\nCodeforces\nBeta\nRound 5\n\nand\ngood luck\n']
Demo Output:
['************\n* This is *\n* *\n*Codeforces*\n* Beta *\n* Round *\n* 5 *\n************\n', '****************\n*welcome to the*\n* Codeforces *\n* Beta *\n* Round 5 *\n* *\n* and *\n* good luck *\n****************\n']
Note:
none | ```python
l=[]
maxx=0
while True:
try:
l.append(input())
except EOFError:
break
for x in l:
if len(x)>maxx:
maxx=len(x)
print("*"*(maxx+2))
for i in l:
print("*"+i.center(maxx," ")+"*")
print("*" * (maxx + 2))
``` | 0 |
602 | B | Approximating a Constant Range | PROGRAMMING | 1,400 | [
"dp",
"implementation",
"two pointers"
] | null | null | When Xellos was doing a practice course in university, he once had to measure the intensity of an effect that slowly approached equilibrium. A good way to determine the equilibrium intensity would be choosing a sufficiently large number of consecutive data points that seems as constant as possible and taking their average. Of course, with the usual sizes of data, it's nothing challenging — but why not make a similar programming contest problem while we're at it?
You're given a sequence of *n* data points *a*1,<=...,<=*a**n*. There aren't any big jumps between consecutive data points — for each 1<=≤<=*i*<=<<=*n*, it's guaranteed that |*a**i*<=+<=1<=-<=*a**i*|<=≤<=1.
A range [*l*,<=*r*] of data points is said to be almost constant if the difference between the largest and the smallest value in that range is at most 1. Formally, let *M* be the maximum and *m* the minimum value of *a**i* for *l*<=≤<=*i*<=≤<=*r*; the range [*l*,<=*r*] is almost constant if *M*<=-<=*m*<=≤<=1.
Find the length of the longest almost constant range. | The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000) — the number of data points.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100<=000). | Print a single number — the maximum length of an almost constant range of the given sequence. | [
"5\n1 2 3 3 2\n",
"11\n5 4 5 5 6 7 8 8 8 7 6\n"
] | [
"4\n",
"5\n"
] | In the first sample, the longest almost constant range is [2, 5]; its length (the number of data points in it) is 4.
In the second sample, there are three almost constant ranges of length 4: [1, 4], [6, 9] and [7, 10]; the only almost constant range of the maximum length 5 is [6, 10]. | 1,000 | [
{
"input": "5\n1 2 3 3 2",
"output": "4"
},
{
"input": "11\n5 4 5 5 6 7 8 8 8 7 6",
"output": "5"
},
{
"input": "2\n3 2",
"output": "2"
},
{
"input": "4\n1001 1000 1000 1001",
"output": "4"
},
{
"input": "4\n1 1 2 3",
"output": "3"
},
{
"input": "3\n1 2 1",
"output": "3"
},
{
"input": "3\n1 2 3",
"output": "2"
},
{
"input": "18\n10 9 8 7 6 5 4 3 2 1 2 3 4 5 6 7 8 9",
"output": "3"
},
{
"input": "3\n1 2 2",
"output": "3"
},
{
"input": "4\n10 9 10 9",
"output": "4"
},
{
"input": "4\n4 3 2 3",
"output": "3"
},
{
"input": "4\n8 8 7 7",
"output": "4"
},
{
"input": "3\n99998 99999 100000",
"output": "2"
},
{
"input": "3\n100000 99999 99998",
"output": "2"
},
{
"input": "3\n1 1 1",
"output": "3"
},
{
"input": "2\n99999 100000",
"output": "2"
},
{
"input": "2\n100000 100000",
"output": "2"
},
{
"input": "2\n1 1",
"output": "2"
},
{
"input": "15\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000",
"output": "15"
}
] | 1,691,855,211 | 2,147,483,647 | Python 3 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | //my
#include<cstdio>
#include<algorithm>
using namespace std;
int a[1000005];
int main()
{
int n1,ans = 2,x;
scanf("%d",&n1);
for(int i = 1; i <= n1; i++)
{
scanf("%d",&x);
a[x] = i;
if(a[x-1] > a[x+1])
ans = max(ans,i-max(a[x+1],a[x-2]));
else
ans = max(ans,i-max(a[x+2],a[x-1]));
}
printf("%d\n",ans);
return 0;
}
| Title: Approximating a Constant Range
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
When Xellos was doing a practice course in university, he once had to measure the intensity of an effect that slowly approached equilibrium. A good way to determine the equilibrium intensity would be choosing a sufficiently large number of consecutive data points that seems as constant as possible and taking their average. Of course, with the usual sizes of data, it's nothing challenging — but why not make a similar programming contest problem while we're at it?
You're given a sequence of *n* data points *a*1,<=...,<=*a**n*. There aren't any big jumps between consecutive data points — for each 1<=≤<=*i*<=<<=*n*, it's guaranteed that |*a**i*<=+<=1<=-<=*a**i*|<=≤<=1.
A range [*l*,<=*r*] of data points is said to be almost constant if the difference between the largest and the smallest value in that range is at most 1. Formally, let *M* be the maximum and *m* the minimum value of *a**i* for *l*<=≤<=*i*<=≤<=*r*; the range [*l*,<=*r*] is almost constant if *M*<=-<=*m*<=≤<=1.
Find the length of the longest almost constant range.
Input Specification:
The first line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000) — the number of data points.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100<=000).
Output Specification:
Print a single number — the maximum length of an almost constant range of the given sequence.
Demo Input:
['5\n1 2 3 3 2\n', '11\n5 4 5 5 6 7 8 8 8 7 6\n']
Demo Output:
['4\n', '5\n']
Note:
In the first sample, the longest almost constant range is [2, 5]; its length (the number of data points in it) is 4.
In the second sample, there are three almost constant ranges of length 4: [1, 4], [6, 9] and [7, 10]; the only almost constant range of the maximum length 5 is [6, 10]. | ```python
//my
#include<cstdio>
#include<algorithm>
using namespace std;
int a[1000005];
int main()
{
int n1,ans = 2,x;
scanf("%d",&n1);
for(int i = 1; i <= n1; i++)
{
scanf("%d",&x);
a[x] = i;
if(a[x-1] > a[x+1])
ans = max(ans,i-max(a[x+1],a[x-2]));
else
ans = max(ans,i-max(a[x+2],a[x-1]));
}
printf("%d\n",ans);
return 0;
}
``` | -1 |
|
842 | C | Ilya And The Tree | PROGRAMMING | 2,000 | [
"dfs and similar",
"graphs",
"math",
"number theory",
"trees"
] | null | null | Ilya is very fond of graphs, especially trees. During his last trip to the forest Ilya found a very interesting tree rooted at vertex 1. There is an integer number written on each vertex of the tree; the number written on vertex *i* is equal to *a**i*.
Ilya believes that the beauty of the vertex *x* is the greatest common divisor of all numbers written on the vertices on the path from the root to *x*, including this vertex itself. In addition, Ilya can change the number in one arbitrary vertex to 0 or leave all vertices unchanged. Now for each vertex Ilya wants to know the maximum possible beauty it can have.
For each vertex the answer must be considered independently.
The beauty of the root equals to number written on it. | First line contains one integer number *n* — the number of vertices in tree (1<=≤<=*n*<=≤<=2·105).
Next line contains *n* integer numbers *a**i* (1<=≤<=*i*<=≤<=*n*, 1<=≤<=*a**i*<=≤<=2·105).
Each of next *n*<=-<=1 lines contains two integer numbers *x* and *y* (1<=≤<=*x*,<=*y*<=≤<=*n*, *x*<=≠<=*y*), which means that there is an edge (*x*,<=*y*) in the tree. | Output *n* numbers separated by spaces, where *i*-th number equals to maximum possible beauty of vertex *i*. | [
"2\n6 2\n1 2\n",
"3\n6 2 3\n1 2\n1 3\n",
"1\n10\n"
] | [
"6 6 \n",
"6 6 6 \n",
"10 \n"
] | none | 1,500 | [
{
"input": "2\n6 2\n1 2",
"output": "6 6 "
},
{
"input": "3\n6 2 3\n1 2\n1 3",
"output": "6 6 6 "
},
{
"input": "1\n10",
"output": "10 "
},
{
"input": "10\n2 3 4 5 6 7 8 9 10 11\n1 2\n2 3\n3 4\n4 5\n5 6\n6 7\n4 8\n8 9\n9 10",
"output": "2 3 2 1 1 1 1 1 1 1 "
},
{
"input": "4\n6 2 3 2\n1 2\n2 3\n3 4",
"output": "6 6 3 2 "
}
] | 1,504,025,965 | 6,865 | PyPy 3 | WRONG_ANSWER | PRETESTS | 3 | 233 | 149,401,600 | """
Author : Arif Ahmad
Date :
Algo :
Difficulty :
"""
from sys import stdin, stdout, setrecursionlimit
import threading
from fractions import gcd
def dfs(u, g1, g2):
global a, g, ans
x1 = gcd(g1, 0)
x2 = gcd(g2, a[u])
ans[u] = max(x1, x2)
g1 = gcd(g1, a[u])
if u == 0:
g2 = 0
else:
g2 = x2
for v in g[u]:
if ans[v] == 0:
dfs(v, g1, g2)
def main():
global a, n, g, ans
n = int(stdin.readline().strip())
a = [int(_) for _ in stdin.readline().strip().split()]
g = [[] for _ in range(n)]
for _ in range(n - 1):
x, y = [int(_) for _ in stdin.readline().strip().split()]
x -= 1
y -= 1
g[x].append(y)
g[y].append(x)
ans = [0 for _ in range(n)]
# ans[0] = a[0]
dfs(0, a[0], a[0])
ans = ' '.join(str(_) for _ in ans)
stdout.write(ans)
if __name__ == '__main__':
# the following 4 lines of code are required to increase
# the recursion limit and stack size
# * if is cause any problem, comment out the lines,
# * and just call main()
setrecursionlimit(10**6)
threading.stack_size(134217728) # 128MB
thread = threading.Thread(target=main)
thread.start()
| Title: Ilya And The Tree
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ilya is very fond of graphs, especially trees. During his last trip to the forest Ilya found a very interesting tree rooted at vertex 1. There is an integer number written on each vertex of the tree; the number written on vertex *i* is equal to *a**i*.
Ilya believes that the beauty of the vertex *x* is the greatest common divisor of all numbers written on the vertices on the path from the root to *x*, including this vertex itself. In addition, Ilya can change the number in one arbitrary vertex to 0 or leave all vertices unchanged. Now for each vertex Ilya wants to know the maximum possible beauty it can have.
For each vertex the answer must be considered independently.
The beauty of the root equals to number written on it.
Input Specification:
First line contains one integer number *n* — the number of vertices in tree (1<=≤<=*n*<=≤<=2·105).
Next line contains *n* integer numbers *a**i* (1<=≤<=*i*<=≤<=*n*, 1<=≤<=*a**i*<=≤<=2·105).
Each of next *n*<=-<=1 lines contains two integer numbers *x* and *y* (1<=≤<=*x*,<=*y*<=≤<=*n*, *x*<=≠<=*y*), which means that there is an edge (*x*,<=*y*) in the tree.
Output Specification:
Output *n* numbers separated by spaces, where *i*-th number equals to maximum possible beauty of vertex *i*.
Demo Input:
['2\n6 2\n1 2\n', '3\n6 2 3\n1 2\n1 3\n', '1\n10\n']
Demo Output:
['6 6 \n', '6 6 6 \n', '10 \n']
Note:
none | ```python
"""
Author : Arif Ahmad
Date :
Algo :
Difficulty :
"""
from sys import stdin, stdout, setrecursionlimit
import threading
from fractions import gcd
def dfs(u, g1, g2):
global a, g, ans
x1 = gcd(g1, 0)
x2 = gcd(g2, a[u])
ans[u] = max(x1, x2)
g1 = gcd(g1, a[u])
if u == 0:
g2 = 0
else:
g2 = x2
for v in g[u]:
if ans[v] == 0:
dfs(v, g1, g2)
def main():
global a, n, g, ans
n = int(stdin.readline().strip())
a = [int(_) for _ in stdin.readline().strip().split()]
g = [[] for _ in range(n)]
for _ in range(n - 1):
x, y = [int(_) for _ in stdin.readline().strip().split()]
x -= 1
y -= 1
g[x].append(y)
g[y].append(x)
ans = [0 for _ in range(n)]
# ans[0] = a[0]
dfs(0, a[0], a[0])
ans = ' '.join(str(_) for _ in ans)
stdout.write(ans)
if __name__ == '__main__':
# the following 4 lines of code are required to increase
# the recursion limit and stack size
# * if is cause any problem, comment out the lines,
# * and just call main()
setrecursionlimit(10**6)
threading.stack_size(134217728) # 128MB
thread = threading.Thread(target=main)
thread.start()
``` | 0 |
|
802 | G | Fake News (easy) | PROGRAMMING | 800 | [
"implementation",
"strings"
] | null | null | As it's the first of April, Heidi is suspecting that the news she reads today are fake, and she does not want to look silly in front of all the contestants. She knows that a newspiece is fake if it contains heidi as a subsequence. Help Heidi assess whether the given piece is true, but please be discreet about it... | The first and only line of input contains a single nonempty string *s* of length at most 1000 composed of lowercase letters (a-z). | Output YES if the string *s* contains heidi as a subsequence and NO otherwise. | [
"abcheaibcdi\n",
"hiedi\n"
] | [
"YES",
"NO"
] | A string *s* contains another string *p* as a subsequence if it is possible to delete some characters from *s* and obtain *p*. | 0 | [
{
"input": "abcheaibcdi",
"output": "YES"
},
{
"input": "hiedi",
"output": "NO"
},
{
"input": "ihied",
"output": "NO"
},
{
"input": "diehi",
"output": "NO"
},
{
"input": "deiih",
"output": "NO"
},
{
"input": "iheid",
"output": "NO"
},
{
"input": "eihdi",
"output": "NO"
},
{
"input": "ehdii",
"output": "NO"
},
{
"input": "edhii",
"output": "NO"
},
{
"input": "deiih",
"output": "NO"
},
{
"input": "ehdii",
"output": "NO"
},
{
"input": "eufyajkssayhjhqcwxmctecaeepjwmfoscqprpcxsqfwnlgzsmmuwuoruantipholrauvxydfvftwfzhnckxswussvlidcojiciflpvkcxkkcmmvtfvxrkwcpeelwsuzqgamamdtdgzscmikvojfvqehblmjczkvtdeymgertgkwfwfukafqlfdhtedcctixhyetdypswgagrpyto",
"output": "YES"
},
{
"input": "arfbvxgdvqzuloojjrwoyqqbxamxybaqltfimofulusfebodjkwwrgwcppkwiodtpjaraglyplgerrpqjkpoggjmfxhwtqrijpijrcyxnoodvwpyjfpvqaoazllbrpzananbrvvybboedidtuvqquklkpeflfaltukjhzjgiofombhbmqbihgtapswykfvlgdoapjqntvqsaohmbvnphvyyhvhavslamczuqifxnwknkaenqmlvetrqogqxmlptgrmqvxzdxdmwobjesmgxckpmawtioavwdngyiwkzypfnxcovwzdohshwlavwsthdssiadhiwmhpvgkrbezm",
"output": "YES"
},
{
"input": "zcectngbqnejjjtsfrluummmqabzqbyccshjqbrjthzhlbmzjfxugvjouwhumsgrnopiyakfadjnbsesamhynsbfbfunupwbxvohfmpwlcpxhovwpfpciclatgmiufwdvtsqrsdcymvkldpnhfeisrzhyhhlkwdzthgprvkpyldeysvbmcibqkpudyrraqdlxpjecvwcvuiklcrsbgvqasmxmtxqzmawcjtozioqlfflinnxpeexbzloaeqjvglbdeufultpjqexvjjjkzemtzuzmxvawilcqdrcjzpqyhtwfphuonzwkotthsaxrmwtnlmcdylxqcfffyndqeouztluqwlhnkkvzwcfiscikv",
"output": "YES"
},
{
"input": "plqaykgovxkvsiahdbglktdlhcqwelxxmtlyymrsyubxdskvyjkrowvcbpdofpjqspsrgpakdczletxujzlsegepzleipiyycpinzxgwjsgslnxsotouddgfcybozfpjhhocpybfjbaywsehbcfrayvancbrumdfngqytnhihyxnlvilrqyhnxeckprqafofelospffhtwguzjbbjlzbqrtiielbvzutzgpqxosiaqznndgobcluuqlhmffiowkjdlkokehtjdyjvmxsiyxureflmdomerfekxdvtitvwzmdsdzplkpbtafxqfpudnhfqpoiwvjnylanunmagoweobdvfjgepbsymfutrjarlxclhgavpytiiqwvojrptofuvlohzeguxdsrihsbucelhhuedltnnjgzxwyblbqvnoliiydfinzlogbvucwykryzcyibnniggbkdkdcdgcsbvvnavtyhtkanrblpvomvjs",
"output": "YES"
},
{
"input": "fbldqzggeunkpwcfirxanmntbfrudijltoertsdvcvcmbwodbibsrxendzebvxwydpasaqnisrijctsuatihxxygbeovhxjdptdcppkvfytdpjspvrannxavmkmisqtygntxkdlousdypyfkrpzapysfpdbyprufwzhunlsfugojddkmxzinatiwfxdqmgyrnjnxvrclhxyuwxtshoqdjptmeecvgmrlvuwqtmnfnfeeiwcavwnqmyustawbjodzwsqmnjxhpqmgpysierlwbbdzcwprpsexyvreewcmlbvaiytjlxdqdaqftefdlmtmmjcwvfejshymhnouoshdzqcwzxpzupkbcievodzqkqvyjuuxxwepxjalvkzufnveji",
"output": "YES"
},
{
"input": "htsyljgoelbbuipivuzrhmfpkgderqpoprlxdpasxhpmxvaztccldtmujjzjmcpdvsdghzpretlsyyiljhjznseaacruriufswuvizwwuvdioazophhyytvbiogttnnouauxllbdn",
"output": "YES"
},
{
"input": "ikmxzqdzxqlvgeojsnhqzciujslwjyzzexnregabdqztpplosdakimjxmuqccbnwvzbajoiqgdobccwnrwmixohrbdarhoeeelzbpigiybtesybwefpcfx",
"output": "YES"
},
{
"input": "bpvbpjvbdfiodsmahxpcubjxdykesubnypalhypantshkjffmxjmelblqnjdmtaltneuyudyevkgedkqrdmrfeemgpghwrifcwincfixokfgurhqbcfzeajrgkgpwqwsepudxulywowwxzdxkumsicsvnzfxspmjpaixgejeaoyoibegosqoyoydmphfpbutrrewyjecowjckvpcceoamtfbitdneuwqfvnagswlskmsmkhmxyfsrpqwhxzocyffiumcy",
"output": "YES"
},
{
"input": "vllsexwrazvlfvhvrtqeohvzzresjdiuhomfpgqcxpqdevplecuaepixhlijatxzegciizpvyvxuembiplwklahlqibykfideysjygagjbgqkbhdhkatddcwlxboinfuomnpc",
"output": "YES"
},
{
"input": "pnjdwpxmvfoqkjtbhquqcuredrkwqzzfjmdvpnbqtypzdovemhhclkvigjvtprrpzbrbcbatkucaqteuciuozytsptvsskkeplaxdaqmjkmef",
"output": "NO"
},
{
"input": "jpwfhvlxvsdhtuozvlmnfiotrgapgjxtcsgcjnodcztupysvvvmjpzqkpommadppdrykuqkcpzojcwvlogvkddedwbggkrhuvtsvdiokehlkdlnukcufjvqxnikcdawvexxwffxtriqbdmkahxdtygodzohwtdmmuvmatdkvweqvaehaxiefpevkvqpyxsrhtmgjsdfcwzqobibeduooldrmglbinrepmunizheqzvgqvpdskhxfidxfnbisyizhepwyrcykcmjxnkyfjgrqlkixcvysa",
"output": "YES"
},
{
"input": "aftcrvuumeqbfvaqlltscnuhkpcifrrhnutjinxdhhdbzvizlrapzjdatuaynoplgjketupgaejciosofuhcgcjdcucarfvtsofgubtphijciswsvidnvpztlaarydkeqxzwdhfbmullkimerukusbrdnnujviydldrwhdfllsjtziwfeaiqotbiprespmxjulnyunkdtcghrzvhtcychkwatqqmladxpvmvlkzscthylbzkpgwlzfjqwarqvdeyngekqvrhrftpxnkfcibbowvnqdkulcdydspcubwlgoyinpnzgidbgunparnueddzwtzdiavbprbbg",
"output": "YES"
},
{
"input": "oagjghsidigeh",
"output": "NO"
},
{
"input": "chdhzpfzabupskiusjoefrwmjmqkbmdgboicnszkhdrlegeqjsldurmbshijadlwsycselhlnudndpdhcnhruhhvsgbthpruiqfirxkhpqhzhqdfpyozolbionodypfcqfeqbkcgmqkizgeyyelzeoothexcoaahedgrvoemqcwccbvoeqawqeuusyjxmgjkpfwcdttfmwunzuwvsihliexlzygqcgpbdiawfvqukikhbjerjkyhpcknlndaystrgsinghlmekbvhntcpypmchcwoglsmwwdulqneuabuuuvtyrnjxfcgoothalwkzzfxakneusezgnnepkpipzromqubraiggqndliz",
"output": "YES"
},
{
"input": "lgirxqkrkgjcutpqitmffvbujcljkqardlalyigxorscczuzikoylcxenryhskoavymexysvmhbsvhtycjlmzhijpuvcjshyfeycvvcfyzytzoyvxajpqdjtfiatnvxnyeqtfcagfftafllhhjhplbdsrfpctkqpinpdfrtlzyjllfbeffputywcckupyslkbbzpgcnxgbmhtqeqqehpdaokkjtatrhyiuusjhwgiiiikxpzdueasemosmmccoakafgvxduwiuflovhhfhffgnnjhoperhhjtvocpqytjxkmrknnknqeglffhfuplopmktykxuvcmbwpoeisrlyyhdpxfvzseucofyhziuiikihpqheqdyzwigeaqzhxzvporgisxgvhyicqyejovqloibhbunsvsunpvmdckkbuokitdzleilfwutcvuuytpupizinfjrzhxudsmjcjyfcpfgthujjowdwtgbvi",
"output": "YES"
},
{
"input": "uuehrvufgerqbzyzksmqnewacotuimawhlbycdbsmhshrsbqwybbkwjwsrkwptvlbbwjiivqugzrxxwgidrcrhrwsmwgeoleptfamzefgaeyxouxocrpvomjrazmxrnffdwrrmblgdiabdncvfougtmjgvvazasnygdrigbsrieoonirlivfyodvulouslxosswgpdexuldmkdbpdlgutiotvxjyecbrsvbmqxrlcpcipjjncduyqtohlzybvlemmfdeubihwlwqglkgjvnwrbgydcpwklmjeewqklmqdbajqgrpnynaxfvxjzgibqerxyhnxenrmcdqaaeksbzyrcaepozqpetaurlhjuxxhwppuhgoihxdxbmxeiahyaqkbknktlzkheaarjoqqrsyeducvoygwalgarldcdlqogfvsncejssmx",
"output": "YES"
},
{
"input": "iiopulfjxoitgiusqrhgbkiyzinphjtclodbkkydetylvuimkhdkklmyoacmekdvjpuxcrvqnjhqhhbfenlpzpwijtykqziocilvtpqhxuyrphdlamawjuzgjwiebkqyrzyqgtkcrhntjxqmcgkrqcslogjegfrivzidfedeegwbbsopvxvdoididlpypjogxaodtueebbwuwilacunqpozczcgrpaxxrtogpxgfkudtxchoravrrdtimhenwmnafxaruuojduxxglefejycfcyxllfimkszmbrhcwpnwjqgwvzysmlaaifdxfjjpgjmcksiigpanappjdloiolojmcqbnpnjjzaufdpjaknylmyvolhwypygwepmqwpiglpcnpypnudhdzpdvgzosyjthzcwtytxq",
"output": "YES"
}
] | 1,633,725,431 | 2,147,483,647 | Python 3 | OK | TESTS | 58 | 62 | 6,758,400 | def main():
s = input()
heidi = "heidi"
j = 0
hasHeidi = 0
for i in s:
if(i == heidi[j]):
if(j < 4):
j += 1
else:
hasHeidi = 1
if(hasHeidi == 0):
print("NO")
else:
print("YES")
if __name__ == '__main__':
main()
| Title: Fake News (easy)
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As it's the first of April, Heidi is suspecting that the news she reads today are fake, and she does not want to look silly in front of all the contestants. She knows that a newspiece is fake if it contains heidi as a subsequence. Help Heidi assess whether the given piece is true, but please be discreet about it...
Input Specification:
The first and only line of input contains a single nonempty string *s* of length at most 1000 composed of lowercase letters (a-z).
Output Specification:
Output YES if the string *s* contains heidi as a subsequence and NO otherwise.
Demo Input:
['abcheaibcdi\n', 'hiedi\n']
Demo Output:
['YES', 'NO']
Note:
A string *s* contains another string *p* as a subsequence if it is possible to delete some characters from *s* and obtain *p*. | ```python
def main():
s = input()
heidi = "heidi"
j = 0
hasHeidi = 0
for i in s:
if(i == heidi[j]):
if(j < 4):
j += 1
else:
hasHeidi = 1
if(hasHeidi == 0):
print("NO")
else:
print("YES")
if __name__ == '__main__':
main()
``` | 3 |
|
702 | A | Maximum Increase | PROGRAMMING | 800 | [
"dp",
"greedy",
"implementation"
] | null | null | You are given array consisting of *n* integers. Your task is to find the maximum length of an increasing subarray of the given array.
A subarray is the sequence of consecutive elements of the array. Subarray is called increasing if each element of this subarray strictly greater than previous. | The first line contains single positive integer *n* (1<=≤<=*n*<=≤<=105) — the number of integers.
The second line contains *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109). | Print the maximum length of an increasing subarray of the given array. | [
"5\n1 7 2 11 15\n",
"6\n100 100 100 100 100 100\n",
"3\n1 2 3\n"
] | [
"3\n",
"1\n",
"3\n"
] | none | 0 | [
{
"input": "5\n1 7 2 11 15",
"output": "3"
},
{
"input": "6\n100 100 100 100 100 100",
"output": "1"
},
{
"input": "3\n1 2 3",
"output": "3"
},
{
"input": "1\n1000000000",
"output": "1"
},
{
"input": "10\n802030518 598196518 640274071 983359971 71550121 96204862 799843967 446173607 796619138 402690754",
"output": "3"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "5\n1 2 3 3 4",
"output": "3"
},
{
"input": "4\n1 2 2 3",
"output": "2"
},
{
"input": "3\n2 1 1",
"output": "1"
},
{
"input": "3\n1 2 1",
"output": "2"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "2\n1 2",
"output": "2"
},
{
"input": "3\n1 1 2",
"output": "2"
},
{
"input": "11\n1 2 3 1 2 3 2 1 2 3 4",
"output": "4"
},
{
"input": "9\n1 2 3 4 5 6 7 8 9",
"output": "9"
},
{
"input": "9\n1 1 1 1 1 1 1 1 1",
"output": "1"
},
{
"input": "3\n3 2 1",
"output": "1"
},
{
"input": "7\n1 2 3 4 5 6 7",
"output": "7"
},
{
"input": "1\n1234394",
"output": "1"
}
] | 1,669,298,895 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 3 | 46 | 0 | n=int(input())
a=[int(i) for i in input().split()]
s=1
s1=[]
for i in range(1,n):
if a[i]>a[i-1]:
s+=1
s1.append(s)
else:
s1.append(s)
s=1
print(max(s1)) | Title: Maximum Increase
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given array consisting of *n* integers. Your task is to find the maximum length of an increasing subarray of the given array.
A subarray is the sequence of consecutive elements of the array. Subarray is called increasing if each element of this subarray strictly greater than previous.
Input Specification:
The first line contains single positive integer *n* (1<=≤<=*n*<=≤<=105) — the number of integers.
The second line contains *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109).
Output Specification:
Print the maximum length of an increasing subarray of the given array.
Demo Input:
['5\n1 7 2 11 15\n', '6\n100 100 100 100 100 100\n', '3\n1 2 3\n']
Demo Output:
['3\n', '1\n', '3\n']
Note:
none | ```python
n=int(input())
a=[int(i) for i in input().split()]
s=1
s1=[]
for i in range(1,n):
if a[i]>a[i-1]:
s+=1
s1.append(s)
else:
s1.append(s)
s=1
print(max(s1))
``` | -1 |
|
278 | B | New Problem | PROGRAMMING | 1,500 | [
"brute force",
"strings"
] | null | null | Coming up with a new problem isn't as easy as many people think. Sometimes it is hard enough to name it. We'll consider a title original if it doesn't occur as a substring in any titles of recent Codeforces problems.
You've got the titles of *n* last problems — the strings, consisting of lowercase English letters. Your task is to find the shortest original title for the new problem. If there are multiple such titles, choose the lexicographically minimum one. Note, that title of the problem can't be an empty string.
A substring *s*[*l*... *r*] (1<=≤<=*l*<=≤<=*r*<=≤<=|*s*|) of string *s*<==<=*s*1*s*2... *s*|*s*| (where |*s*| is the length of string *s*) is string *s**l**s**l*<=+<=1... *s**r*.
String *x*<==<=*x*1*x*2... *x**p* is lexicographically smaller than string *y*<==<=*y*1*y*2... *y**q*, if either *p*<=<<=*q* and *x*1<==<=*y*1,<=*x*2<==<=*y*2,<=... ,<=*x**p*<==<=*y**p*, or there exists such number *r* (*r*<=<<=*p*,<=*r*<=<<=*q*), that *x*1<==<=*y*1,<=*x*2<==<=*y*2,<=... ,<=*x**r*<==<=*y**r* and *x**r*<=+<=1<=<<=*y**r*<=+<=1. The string characters are compared by their ASCII codes. | The first line contains integer *n* (1<=≤<=*n*<=≤<=30) — the number of titles you've got to consider. Then follow *n* problem titles, one per line. Each title only consists of lowercase English letters (specifically, it doesn't contain any spaces) and has the length from 1 to 20, inclusive. | Print a string, consisting of lowercase English letters — the lexicographically minimum shortest original title. | [
"5\nthreehorses\ngoodsubstrings\nsecret\nprimematrix\nbeautifulyear\n",
"4\naa\nbdefghijklmn\nopqrstuvwxyz\nc\n"
] | [
"j\n",
"ab\n"
] | In the first sample the first 9 letters of the English alphabet (a, b, c, d, e, f, g, h, i) occur in the problem titles, so the answer is letter j.
In the second sample the titles contain 26 English letters, so the shortest original title cannot have length 1. Title aa occurs as a substring in the first title. | 1,000 | [
{
"input": "5\nthreehorses\ngoodsubstrings\nsecret\nprimematrix\nbeautifulyear",
"output": "j"
},
{
"input": "4\naa\nbdefghijklmn\nopqrstuvwxyz\nc",
"output": "ab"
},
{
"input": "1\na",
"output": "b"
},
{
"input": "1\nb",
"output": "a"
},
{
"input": "1\nz",
"output": "a"
},
{
"input": "5\nsplt\nohqykk\nxqpz\nknojbur\npmfm",
"output": "a"
},
{
"input": "2\nrxscdzkkezud\nwjehahqgouqvjienq",
"output": "b"
},
{
"input": "2\nxlaxwpjabtpwddc\ntxwdjmohrrszorrnomc",
"output": "e"
},
{
"input": "1\nepkotfpkkrhhmuipmtdk",
"output": "a"
},
{
"input": "2\nhk\nobsp",
"output": "a"
},
{
"input": "3\nrjnflsbpxqivrcdjptj\nvpojopbwbwbswdu\nrydkiwnugwddcgcrng",
"output": "a"
},
{
"input": "10\nkpmwcdoysw\ngtpr\nkuzoxmiixxbl\ncrgqtuo\njhbplhpklrgwnaugdf\nzuxdaat\naycv\nqwghrkqwkobrgevsjrk\ntdxgc\nlxyzgcmbzulcst",
"output": "ab"
},
{
"input": "30\nwaiphwcqrrinr\no\nqiqehzmgsjdoqd\nkjexeesevrlowxhghq\njudikhzkj\nz\nxo\nlsdzypkfqro\nsshgcxsky\ngecntpcmoojfwp\nsvmytmcfhc\njrsrvsvbaiumlmkptn\ns\nwpcsovfjlyspviflk\nktvyzvddgllht\nszahigtmklglrcocbo\nznligfxkgxzkcfeu\nliryvzmqwhr\nxgrxkgiehxztv\netrjxdczppafly\njrdgajschhwsci\ndoxnxbjwptnimjmsuijx\nzciwkbvrhgsjhrr\nehh\nbzlnmd\nxpbtbpftimnn\nkhbknqbvdkdd\nmldj\nskrvnyz\navptgpjmenfzfxwckmt",
"output": "aa"
},
{
"input": "30\ne\nx\nitaubd\nxcn\nv\nx\ni\nci\naqs\nzbi\nq\ncvdu\na\njos\nqy\nfjf\nnayke\nge\ns\nq\nqwad\ngvz\no\nubn\nnzoc\nh\nwnjwjrf\nt\nbq\nbw",
"output": "l"
},
{
"input": "30\nb\nu\np\nn\nf\nm\nt\ni\nj\nk\np\nh\na\nc\nw\nz\nz\np\nt\nd\no\nw\nu\nq\nl\ny\ni\no\na\nu",
"output": "e"
},
{
"input": "5\nojdfhi\nabcdefghijklmnopqrst\nuvwxyz\nddfhdfhlasjt\nqqq",
"output": "aa"
},
{
"input": "5\ndfijdfhi\nabcdefghijklmnopqrst\nuvwxy\nkopsdfgiopjipw\njty",
"output": "z"
},
{
"input": "5\nzzxpfk\nabcdefghijklmnopqrst\nuvwxz\nsrgkjaskldfkln\nvgnsdfdgfh",
"output": "y"
}
] | 1,571,597,995 | 2,147,483,647 | Python 3 | OK | TESTS | 33 | 248 | 0 | # from dust i have come, dust i will be
n = int(input())
a = []
for i in range(n):
x = input()
a.append(x)
arr = []
for i in range(26):
arr.append(chr(i + ord('a')))
for i in range(26):
for j in range(26):
arr.append(arr[i] + chr(j + ord('a')))
for i in range(len(arr)):
cnt = 0
for j in range(n):
if arr[i] not in a[j]:
cnt += 1
if cnt == n:
print(arr[i])
exit(0)
| Title: New Problem
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Coming up with a new problem isn't as easy as many people think. Sometimes it is hard enough to name it. We'll consider a title original if it doesn't occur as a substring in any titles of recent Codeforces problems.
You've got the titles of *n* last problems — the strings, consisting of lowercase English letters. Your task is to find the shortest original title for the new problem. If there are multiple such titles, choose the lexicographically minimum one. Note, that title of the problem can't be an empty string.
A substring *s*[*l*... *r*] (1<=≤<=*l*<=≤<=*r*<=≤<=|*s*|) of string *s*<==<=*s*1*s*2... *s*|*s*| (where |*s*| is the length of string *s*) is string *s**l**s**l*<=+<=1... *s**r*.
String *x*<==<=*x*1*x*2... *x**p* is lexicographically smaller than string *y*<==<=*y*1*y*2... *y**q*, if either *p*<=<<=*q* and *x*1<==<=*y*1,<=*x*2<==<=*y*2,<=... ,<=*x**p*<==<=*y**p*, or there exists such number *r* (*r*<=<<=*p*,<=*r*<=<<=*q*), that *x*1<==<=*y*1,<=*x*2<==<=*y*2,<=... ,<=*x**r*<==<=*y**r* and *x**r*<=+<=1<=<<=*y**r*<=+<=1. The string characters are compared by their ASCII codes.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=30) — the number of titles you've got to consider. Then follow *n* problem titles, one per line. Each title only consists of lowercase English letters (specifically, it doesn't contain any spaces) and has the length from 1 to 20, inclusive.
Output Specification:
Print a string, consisting of lowercase English letters — the lexicographically minimum shortest original title.
Demo Input:
['5\nthreehorses\ngoodsubstrings\nsecret\nprimematrix\nbeautifulyear\n', '4\naa\nbdefghijklmn\nopqrstuvwxyz\nc\n']
Demo Output:
['j\n', 'ab\n']
Note:
In the first sample the first 9 letters of the English alphabet (a, b, c, d, e, f, g, h, i) occur in the problem titles, so the answer is letter j.
In the second sample the titles contain 26 English letters, so the shortest original title cannot have length 1. Title aa occurs as a substring in the first title. | ```python
# from dust i have come, dust i will be
n = int(input())
a = []
for i in range(n):
x = input()
a.append(x)
arr = []
for i in range(26):
arr.append(chr(i + ord('a')))
for i in range(26):
for j in range(26):
arr.append(arr[i] + chr(j + ord('a')))
for i in range(len(arr)):
cnt = 0
for j in range(n):
if arr[i] not in a[j]:
cnt += 1
if cnt == n:
print(arr[i])
exit(0)
``` | 3 |
|
2 | B | The least round way | PROGRAMMING | 2,000 | [
"dp",
"math"
] | B. The least round way | 2 | 64 | There is a square matrix *n*<=×<=*n*, consisting of non-negative integer numbers. You should find such a way on it that
- starts in the upper left cell of the matrix; - each following cell is to the right or down from the current cell; - the way ends in the bottom right cell.
Moreover, if we multiply together all the numbers along the way, the result should be the least "round". In other words, it should end in the least possible number of zeros. | The first line contains an integer number *n* (2<=≤<=*n*<=≤<=1000), *n* is the size of the matrix. Then follow *n* lines containing the matrix elements (non-negative integer numbers not exceeding 109). | In the first line print the least number of trailing zeros. In the second line print the correspondent way itself. | [
"3\n1 2 3\n4 5 6\n7 8 9\n"
] | [
"0\nDDRR\n"
] | none | 0 | [
{
"input": "3\n1 2 3\n4 5 6\n7 8 9",
"output": "0\nDDRR"
},
{
"input": "2\n7 6\n3 8",
"output": "0\nDR"
},
{
"input": "3\n4 10 5\n10 9 4\n6 5 3",
"output": "1\nDRRD"
},
{
"input": "4\n1 1 9 9\n3 4 7 3\n7 9 1 7\n1 7 1 5",
"output": "0\nDDDRRR"
},
{
"input": "5\n8 3 2 1 4\n3 7 2 4 8\n9 2 8 9 10\n2 3 6 10 1\n8 2 2 8 4",
"output": "0\nDDDDRRRR"
},
{
"input": "6\n5 5 4 10 5 5\n7 10 8 7 6 6\n7 1 7 9 7 8\n5 5 3 3 10 9\n5 8 10 6 3 8\n3 10 5 4 3 4",
"output": "1\nDDRRDRDDRR"
},
{
"input": "7\n2 9 8 2 7 4 8\n9 5 4 4 8 5 3\n5 7 2 10 8 1 8\n2 7 10 7 5 7 7\n9 2 7 6 4 8 4\n7 2 4 7 4 1 8\n9 5 3 10 1 6 2",
"output": "0\nRRDRRDRDDDDR"
},
{
"input": "8\n1 1 10 1 8 4 8 7\n9 3 3 2 2 6 2 4\n7 4 3 5 10 3 5 1\n8 4 4 10 4 5 9 4\n5 5 5 2 6 7 1 8\n4 10 1 3 2 4 8 3\n8 1 10 2 8 2 2 4\n2 10 6 8 10 2 8 4",
"output": "0\nDRRRRRRRDDDDDD"
},
{
"input": "9\n8 3 3 3 10 3 10 5 6\n2 1 6 1 8 1 9 1 6\n6 1 5 4 2 2 10 4 9\n1 9 1 3 10 6 10 5 5\n1 10 5 4 7 2 5 9 10\n6 6 1 3 1 9 4 9 9\n5 3 7 6 4 6 2 10 2\n9 3 3 10 5 6 7 6 4\n4 9 6 7 4 3 7 6 5",
"output": "1\nDDDDDRDDDRRRRRRR"
},
{
"input": "10\n10 8 6 5 9 8 2 5 3 2\n3 1 8 6 8 10 5 5 7 8\n5 9 7 7 4 9 7 2 5 2\n5 9 9 5 4 2 6 6 8 1\n10 6 9 9 10 5 6 3 5 9\n6 7 10 3 1 4 3 6 7 6\n10 10 4 7 4 4 8 6 7 4\n10 5 8 2 2 7 4 4 1 4\n8 4 6 10 10 6 1 3 3 1\n9 9 7 2 9 5 1 8 6 3",
"output": "1\nDRDDDRRDDDRRDRDRRR"
}
] | 1,578,040,754 | 2,147,483,647 | PyPy 3 | RUNTIME_ERROR | TESTS | 21 | 1,356 | 27,545,600 | # -*- coding:utf-8 -*-
"""
created by shuangquan.huang at 1/3/20
"""
import collections
import time
import os
import sys
import bisect
import heapq
from typing import List
N = int(input())
A = []
for i in range(N):
row = [int(x) for x in input().split()]
A.append(row)
def count(val, div):
c = 0
while val % div == 0:
val //= div
c += 1
return c
def solve(div):
dp = [[1000 for _ in range(N)] for _ in range(N)]
pre = [['' for _ in range(N)] for _ in range(N)]
dp[0][0] = count(A[0][0], div)
for r in range(N):
for c in range(N):
dc = count(A[r][c], div)
if r > 0 and dp[r-1][c] + dc < dp[r][c]:
dp[r][c] = dp[r-1][c] + dc
pre[r][c] = 'U'
if c > 0 and dp[r][c-1] + dc < dp[r][c]:
pre[r][c] = 'L'
dp[r][c] = dp[r][c-1] + dc
path = []
r, c = N-1, N-1
while r > 0 or c > 0:
if pre[r][c] == 'U':
path.append('D')
r, c = r-1, c
else:
path.append('R')
r, c = r, c-1
return dp[N-1][N-1], ''.join(path[::-1])
a, b = solve(2)
c, d = solve(5)
if a < c:
print(a)
print(b)
else:
print(c)
print(d)
| Title: The least round way
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
There is a square matrix *n*<=×<=*n*, consisting of non-negative integer numbers. You should find such a way on it that
- starts in the upper left cell of the matrix; - each following cell is to the right or down from the current cell; - the way ends in the bottom right cell.
Moreover, if we multiply together all the numbers along the way, the result should be the least "round". In other words, it should end in the least possible number of zeros.
Input Specification:
The first line contains an integer number *n* (2<=≤<=*n*<=≤<=1000), *n* is the size of the matrix. Then follow *n* lines containing the matrix elements (non-negative integer numbers not exceeding 109).
Output Specification:
In the first line print the least number of trailing zeros. In the second line print the correspondent way itself.
Demo Input:
['3\n1 2 3\n4 5 6\n7 8 9\n']
Demo Output:
['0\nDDRR\n']
Note:
none | ```python
# -*- coding:utf-8 -*-
"""
created by shuangquan.huang at 1/3/20
"""
import collections
import time
import os
import sys
import bisect
import heapq
from typing import List
N = int(input())
A = []
for i in range(N):
row = [int(x) for x in input().split()]
A.append(row)
def count(val, div):
c = 0
while val % div == 0:
val //= div
c += 1
return c
def solve(div):
dp = [[1000 for _ in range(N)] for _ in range(N)]
pre = [['' for _ in range(N)] for _ in range(N)]
dp[0][0] = count(A[0][0], div)
for r in range(N):
for c in range(N):
dc = count(A[r][c], div)
if r > 0 and dp[r-1][c] + dc < dp[r][c]:
dp[r][c] = dp[r-1][c] + dc
pre[r][c] = 'U'
if c > 0 and dp[r][c-1] + dc < dp[r][c]:
pre[r][c] = 'L'
dp[r][c] = dp[r][c-1] + dc
path = []
r, c = N-1, N-1
while r > 0 or c > 0:
if pre[r][c] == 'U':
path.append('D')
r, c = r-1, c
else:
path.append('R')
r, c = r, c-1
return dp[N-1][N-1], ''.join(path[::-1])
a, b = solve(2)
c, d = solve(5)
if a < c:
print(a)
print(b)
else:
print(c)
print(d)
``` | -1 |
805 | B | 3-palindrome | PROGRAMMING | 1,000 | [
"constructive algorithms"
] | null | null | In the beginning of the new year Keivan decided to reverse his name. He doesn't like palindromes, so he changed Naviek to Navick.
He is too selfish, so for a given *n* he wants to obtain a string of *n* characters, each of which is either 'a', 'b' or 'c', with no palindromes of length 3 appearing in the string as a substring. For example, the strings "abc" and "abca" suit him, while the string "aba" doesn't. He also want the number of letters 'c' in his string to be as little as possible. | The first line contains single integer *n* (1<=≤<=*n*<=≤<=2·105) — the length of the string. | Print the string that satisfies all the constraints.
If there are multiple answers, print any of them. | [
"2\n",
"3\n"
] | [
"aa\n",
"bba\n"
] | A palindrome is a sequence of characters which reads the same backward and forward. | 1,000 | [
{
"input": "2",
"output": "aa"
},
{
"input": "3",
"output": "aab"
},
{
"input": "38",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaa"
},
{
"input": "47",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "59",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "67",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "77",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "89",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "98",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaa"
},
{
"input": "109",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "117",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "1",
"output": "a"
},
{
"input": "200000",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "100000",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "143670",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "104217",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "17879",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "131809",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "140873",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "77859",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "153022",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "179227",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "182801",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "5188",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "86539",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "12802",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "120289",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "132866",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "133377",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "31775",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "160397",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "161415",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "163623",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "22942",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "134767",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "52257",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "64905",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "183758",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "60131",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "146883",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "6",
"output": "aabbaa"
},
{
"input": "4",
"output": "aabb"
}
] | 1,596,355,058 | 2,147,483,647 | PyPy 3 | OK | TESTS | 42 | 155 | 21,196,800 | n = int(input())
thingo=["a","a","b","b"]
print(int(n/4)*"aabb" + "".join(thingo[:n%4])) | Title: 3-palindrome
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In the beginning of the new year Keivan decided to reverse his name. He doesn't like palindromes, so he changed Naviek to Navick.
He is too selfish, so for a given *n* he wants to obtain a string of *n* characters, each of which is either 'a', 'b' or 'c', with no palindromes of length 3 appearing in the string as a substring. For example, the strings "abc" and "abca" suit him, while the string "aba" doesn't. He also want the number of letters 'c' in his string to be as little as possible.
Input Specification:
The first line contains single integer *n* (1<=≤<=*n*<=≤<=2·105) — the length of the string.
Output Specification:
Print the string that satisfies all the constraints.
If there are multiple answers, print any of them.
Demo Input:
['2\n', '3\n']
Demo Output:
['aa\n', 'bba\n']
Note:
A palindrome is a sequence of characters which reads the same backward and forward. | ```python
n = int(input())
thingo=["a","a","b","b"]
print(int(n/4)*"aabb" + "".join(thingo[:n%4]))
``` | 3 |
|
129 | A | Cookies | PROGRAMMING | 900 | [
"implementation"
] | null | null | Olga came to visit the twins Anna and Maria and saw that they have many cookies. The cookies are distributed into bags. As there are many cookies, Olga decided that it's no big deal if she steals a bag. However, she doesn't want the sisters to quarrel because of nothing when they divide the cookies. That's why Olga wants to steal a bag with cookies so that the number of cookies in the remaining bags was even, that is, so that Anna and Maria could evenly divide it into two (even 0 remaining cookies will do, just as any other even number). How many ways there are to steal exactly one cookie bag so that the total number of cookies in the remaining bags was even? | The first line contains the only integer *n* (1<=≤<=*n*<=≤<=100) — the number of cookie bags Anna and Maria have. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=100) — the number of cookies in the *i*-th bag. | Print in the only line the only number — the sought number of ways. If there are no such ways print 0. | [
"1\n1\n",
"10\n1 2 2 3 4 4 4 2 2 2\n",
"11\n2 2 2 2 2 2 2 2 2 2 99\n"
] | [
"1\n",
"8\n",
"1\n"
] | In the first sample Olga should take the only bag so that the twins ended up with the even number of cookies.
In the second sample Olga can take any of five bags with two cookies or any of three bags with four cookies — 5 + 3 = 8 ways in total.
In the third sample, no matter which bag with two cookies Olga chooses, the twins are left with 2 * 9 + 99 = 117 cookies. Thus, Olga has only one option: to take the bag with 99 cookies. | 500 | [
{
"input": "1\n1",
"output": "1"
},
{
"input": "10\n1 2 2 3 4 4 4 2 2 2",
"output": "8"
},
{
"input": "11\n2 2 2 2 2 2 2 2 2 2 99",
"output": "1"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n2 2",
"output": "2"
},
{
"input": "2\n1 2",
"output": "1"
},
{
"input": "7\n7 7 7 7 7 7 7",
"output": "7"
},
{
"input": "8\n1 2 3 4 5 6 7 8",
"output": "4"
},
{
"input": "100\n1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2 1 1 1 1 1 2 2 2 2 2",
"output": "50"
},
{
"input": "99\n99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99 100 99",
"output": "49"
},
{
"input": "82\n43 44 96 33 23 42 33 66 53 87 8 90 43 91 40 88 51 18 48 62 59 10 22 20 54 6 13 63 2 56 31 52 98 42 54 32 26 77 9 24 33 91 16 30 39 34 78 82 73 90 12 15 67 76 30 18 44 86 84 98 65 54 100 79 28 34 40 56 11 43 72 35 86 59 89 40 30 33 7 19 44 15",
"output": "50"
},
{
"input": "17\n50 14 17 77 74 74 38 76 41 27 45 29 66 98 38 73 38",
"output": "7"
},
{
"input": "94\n81 19 90 99 26 11 86 44 78 36 80 59 99 90 78 72 71 20 94 56 42 40 71 84 10 85 10 70 52 27 39 55 90 16 48 25 7 79 99 100 38 10 99 56 3 4 78 9 16 57 14 40 52 54 57 70 30 86 56 84 97 60 59 69 49 66 23 92 90 46 86 73 53 47 1 83 14 20 24 66 13 45 41 14 86 75 55 88 48 95 82 24 47 87",
"output": "39"
},
{
"input": "88\n64 95 12 90 40 65 98 45 52 54 79 7 81 25 98 19 68 82 41 53 35 50 5 22 32 21 8 39 8 6 72 27 81 30 12 79 21 42 60 2 66 87 46 93 62 78 52 71 76 32 78 94 86 85 55 15 34 76 41 20 32 26 94 81 89 45 74 49 11 40 40 39 49 46 80 85 90 23 80 40 86 58 70 26 48 93 23 53",
"output": "37"
},
{
"input": "84\n95 9 43 43 13 84 60 90 1 8 97 99 54 34 59 83 33 15 51 26 40 12 66 65 19 30 29 78 92 60 25 13 19 84 71 73 12 24 54 49 16 41 11 40 57 59 34 40 39 9 71 83 1 77 79 53 94 47 78 55 77 85 29 52 80 90 53 77 97 97 27 79 28 23 83 25 26 22 49 86 63 56 3 32",
"output": "51"
},
{
"input": "47\n61 97 76 94 91 22 2 68 62 73 90 47 16 79 44 71 98 68 43 6 53 52 40 27 68 67 43 96 14 91 60 61 96 24 97 13 32 65 85 96 81 77 34 18 23 14 80",
"output": "21"
},
{
"input": "69\n71 1 78 74 58 89 30 6 100 90 22 61 11 59 14 74 27 25 78 61 45 19 25 33 37 4 52 43 53 38 9 100 56 67 69 38 76 91 63 60 93 52 28 61 9 98 8 14 57 63 89 64 98 51 36 66 36 86 13 82 50 91 52 64 86 78 78 83 81",
"output": "37"
},
{
"input": "52\n38 78 36 75 19 3 56 1 39 97 24 79 84 16 93 55 96 64 12 24 1 86 80 29 12 32 36 36 73 39 76 65 53 98 30 20 28 8 86 43 70 22 75 69 62 65 81 25 53 40 71 59",
"output": "28"
},
{
"input": "74\n81 31 67 97 26 75 69 81 11 13 13 74 77 88 52 20 52 64 66 75 72 28 41 54 26 75 41 91 75 15 18 36 13 83 63 61 14 48 53 63 19 67 35 48 23 65 73 100 44 55 92 88 99 17 73 25 83 7 31 89 12 80 98 39 42 75 14 29 81 35 77 87 33 94",
"output": "47"
},
{
"input": "44\n46 56 31 31 37 71 94 2 14 100 45 72 36 72 80 3 38 54 42 98 50 32 31 42 62 31 45 50 95 100 18 17 64 22 18 25 52 56 70 57 43 40 81 28",
"output": "15"
},
{
"input": "22\n28 57 40 74 51 4 45 84 99 12 95 14 92 60 47 81 84 51 31 91 59 42",
"output": "11"
},
{
"input": "59\n73 45 94 76 41 49 65 13 74 66 36 25 47 75 40 23 92 72 11 32 32 8 81 26 68 56 41 8 76 47 96 55 70 11 84 14 83 18 70 22 30 39 28 100 48 11 92 45 78 69 86 1 54 90 98 91 13 17 35",
"output": "33"
},
{
"input": "63\n20 18 44 94 68 57 16 43 74 55 68 24 21 95 76 84 50 50 47 86 86 12 58 55 28 72 86 18 34 45 81 88 3 72 41 9 60 90 81 93 12 6 9 6 2 41 1 7 9 29 81 14 64 80 20 36 67 54 7 5 35 81 22",
"output": "37"
},
{
"input": "28\n49 84 48 19 44 91 11 82 96 95 88 90 71 82 87 25 31 23 18 13 98 45 26 65 35 12 31 14",
"output": "15"
},
{
"input": "61\n34 18 28 64 28 45 9 77 77 20 63 92 79 16 16 100 86 2 91 91 57 15 31 95 10 88 84 5 82 83 53 98 59 17 97 80 76 80 81 3 91 81 87 93 61 46 10 49 6 22 21 75 63 89 21 81 30 19 67 38 77",
"output": "35"
},
{
"input": "90\n41 90 43 1 28 75 90 50 3 70 76 64 81 63 25 69 83 82 29 91 59 66 21 61 7 55 72 49 38 69 72 20 64 58 30 81 61 29 96 14 39 5 100 20 29 98 75 29 44 78 97 45 26 77 73 59 22 99 41 6 3 96 71 20 9 18 96 18 90 62 34 78 54 5 41 6 73 33 2 54 26 21 18 6 45 57 43 73 95 75",
"output": "42"
},
{
"input": "45\n93 69 4 27 20 14 71 48 79 3 32 26 49 30 57 88 13 56 49 61 37 32 47 41 41 70 45 68 82 18 8 6 25 20 15 13 71 99 28 6 52 34 19 59 26",
"output": "23"
},
{
"input": "33\n29 95 48 49 91 10 83 71 47 25 66 36 51 12 34 10 54 74 41 96 89 26 89 1 42 33 1 62 9 32 49 65 78",
"output": "15"
},
{
"input": "34\n98 24 42 36 41 82 28 58 89 34 77 70 76 44 74 54 66 100 13 79 4 88 21 1 11 45 91 29 87 100 29 54 82 78",
"output": "13"
},
{
"input": "29\n91 84 26 84 9 63 52 9 65 56 90 2 36 7 67 33 91 14 65 38 53 36 81 83 85 14 33 95 51",
"output": "17"
},
{
"input": "100\n2 88 92 82 87 100 78 28 84 43 78 32 43 33 97 19 15 52 29 84 57 72 54 13 99 28 82 79 40 70 34 92 91 53 9 88 27 43 14 92 72 37 26 37 20 95 19 34 49 64 33 37 34 27 80 79 9 54 99 68 25 4 68 73 46 66 24 78 3 87 26 52 50 84 4 95 23 83 39 58 86 36 33 16 98 2 84 19 53 12 69 60 10 11 78 17 79 92 77 59",
"output": "45"
},
{
"input": "100\n2 95 45 73 9 54 20 97 57 82 88 26 18 71 25 27 75 54 31 11 58 85 69 75 72 91 76 5 25 80 45 49 4 73 8 81 81 38 5 12 53 77 7 96 90 35 28 80 73 94 19 69 96 17 94 49 69 9 32 19 5 12 46 29 26 40 59 59 6 95 82 50 72 2 45 69 12 5 72 29 39 72 23 96 81 28 28 56 68 58 37 41 30 1 90 84 15 24 96 43",
"output": "53"
},
{
"input": "100\n27 72 35 91 13 10 35 45 24 55 83 84 63 96 29 79 34 67 63 92 48 83 18 77 28 27 49 66 29 88 55 15 6 58 14 67 94 36 77 7 7 64 61 52 71 18 36 99 76 6 50 67 16 13 41 7 89 73 61 51 78 22 78 32 76 100 3 31 89 71 63 53 15 85 77 54 89 33 68 74 3 23 57 5 43 89 75 35 9 86 90 11 31 46 48 37 74 17 77 8",
"output": "40"
},
{
"input": "100\n69 98 69 88 11 49 55 8 25 91 17 81 47 26 15 73 96 71 18 42 42 61 48 14 92 78 35 72 4 27 62 75 83 79 17 16 46 80 96 90 82 54 37 69 85 21 67 70 96 10 46 63 21 59 56 92 54 88 77 30 75 45 44 29 86 100 51 11 65 69 66 56 82 63 27 1 51 51 13 10 3 55 26 85 34 16 87 72 13 100 81 71 90 95 86 50 83 55 55 54",
"output": "53"
},
{
"input": "100\n34 35 99 64 2 66 78 93 20 48 12 79 19 10 87 7 42 92 60 79 5 2 24 89 57 48 63 92 74 4 16 51 7 12 90 48 87 17 18 73 51 58 97 97 25 38 15 97 96 73 67 91 6 75 14 13 87 79 75 3 15 55 35 95 71 45 10 13 20 37 82 26 2 22 13 83 97 84 39 79 43 100 54 59 98 8 61 34 7 65 75 44 24 77 73 88 34 95 44 77",
"output": "55"
},
{
"input": "100\n15 86 3 1 51 26 74 85 37 87 64 58 10 6 57 26 30 47 85 65 24 72 50 40 12 35 91 47 91 60 47 87 95 34 80 91 26 3 36 39 14 86 28 70 51 44 28 21 72 79 57 61 16 71 100 94 57 67 36 74 24 21 89 85 25 2 97 67 76 53 76 80 97 64 35 13 8 32 21 52 62 61 67 14 74 73 66 44 55 76 24 3 43 42 99 61 36 80 38 66",
"output": "52"
},
{
"input": "100\n45 16 54 54 80 94 74 93 75 85 58 95 79 30 81 2 84 4 57 23 92 64 78 1 50 36 13 27 56 54 10 77 87 1 5 38 85 74 94 82 30 45 72 83 82 30 81 82 82 3 69 82 7 92 39 60 94 42 41 5 3 17 67 21 79 44 79 96 28 3 53 68 79 89 63 83 1 44 4 31 84 15 73 77 19 66 54 6 73 1 67 24 91 11 86 45 96 82 20 89",
"output": "51"
},
{
"input": "100\n84 23 50 32 90 71 92 43 58 70 6 82 7 55 85 19 70 89 12 26 29 56 74 30 2 27 4 39 63 67 91 81 11 33 75 10 82 88 39 43 43 80 68 35 55 67 53 62 73 65 86 74 43 51 14 48 42 92 83 57 22 33 24 99 5 27 78 96 7 28 11 15 8 38 85 67 5 92 24 96 57 59 14 95 91 4 9 18 45 33 74 83 64 85 14 51 51 94 29 2",
"output": "53"
},
{
"input": "100\n77 56 56 45 73 55 32 37 39 50 30 95 79 21 44 34 51 43 86 91 39 30 85 15 35 93 100 14 57 31 80 79 38 40 88 4 91 54 7 95 76 26 62 84 17 33 67 47 6 82 69 51 17 2 59 24 11 12 31 90 12 11 55 38 72 49 30 50 42 46 5 97 9 9 30 45 86 23 19 82 40 42 5 40 35 98 35 32 60 60 5 28 84 35 21 49 68 53 68 23",
"output": "48"
},
{
"input": "100\n78 38 79 61 45 86 83 83 86 90 74 69 2 84 73 39 2 5 20 71 24 80 54 89 58 34 77 40 39 62 2 47 28 53 97 75 88 98 94 96 33 71 44 90 47 36 19 89 87 98 90 87 5 85 34 79 82 3 42 88 89 63 35 7 89 30 40 48 12 41 56 76 83 60 80 80 39 56 77 4 72 96 30 55 57 51 7 19 11 1 66 1 91 87 11 62 95 85 79 25",
"output": "48"
},
{
"input": "100\n5 34 23 20 76 75 19 51 17 82 60 13 83 6 65 16 20 43 66 54 87 10 87 73 50 24 16 98 33 28 80 52 54 82 26 92 14 13 84 92 94 29 61 21 60 20 48 94 24 20 75 70 58 27 68 45 86 89 29 8 67 38 83 48 18 100 11 22 46 84 52 97 70 19 50 75 3 7 52 53 72 41 18 31 1 38 49 53 11 64 99 76 9 87 48 12 100 32 44 71",
"output": "58"
},
{
"input": "100\n76 89 68 78 24 72 73 95 98 72 58 15 2 5 56 32 9 65 50 70 94 31 29 54 89 52 31 93 43 56 26 35 72 95 51 55 78 70 11 92 17 5 54 94 81 31 78 95 73 91 95 37 59 9 53 48 65 55 84 8 45 97 64 37 96 34 36 53 66 17 72 48 99 23 27 18 92 84 44 73 60 78 53 29 68 99 19 39 61 40 69 6 77 12 47 29 15 4 8 45",
"output": "53"
},
{
"input": "100\n82 40 31 53 8 50 85 93 3 84 54 17 96 59 51 42 18 19 35 84 79 31 17 46 54 82 72 49 35 73 26 89 61 73 3 50 12 29 25 77 88 21 58 24 22 89 96 54 82 29 96 56 77 16 1 68 90 93 20 23 57 22 31 18 92 90 51 14 50 72 31 54 12 50 66 62 2 34 17 45 68 50 87 97 23 71 1 72 17 82 42 15 20 78 4 49 66 59 10 17",
"output": "54"
},
{
"input": "100\n32 82 82 24 39 53 48 5 29 24 9 37 91 37 91 95 1 97 84 52 12 56 93 47 22 20 14 17 40 22 79 34 24 2 69 30 69 29 3 89 21 46 60 92 39 29 18 24 49 18 40 22 60 13 77 50 39 64 50 70 99 8 66 31 90 38 20 54 7 21 5 56 41 68 69 20 54 89 69 62 9 53 43 89 81 97 15 2 52 78 89 65 16 61 59 42 56 25 32 52",
"output": "49"
},
{
"input": "100\n72 54 23 24 97 14 99 87 15 25 7 23 17 87 72 31 71 87 34 82 51 77 74 85 62 38 24 7 84 48 98 21 29 71 70 84 25 58 67 92 18 44 32 9 81 15 53 29 63 18 86 16 7 31 38 99 70 32 89 16 23 11 66 96 69 82 97 59 6 9 49 80 85 19 6 9 52 51 85 74 53 46 73 55 31 63 78 61 34 80 77 65 87 77 92 52 89 8 52 31",
"output": "44"
},
{
"input": "100\n56 88 8 19 7 15 11 54 35 50 19 57 63 72 51 43 50 19 57 90 40 100 8 92 11 96 30 32 59 65 93 47 62 3 50 41 30 50 72 83 61 46 83 60 20 46 33 1 5 18 83 22 34 16 41 95 63 63 7 59 55 95 91 29 64 60 64 81 45 45 10 9 88 37 69 85 21 82 41 76 42 34 47 78 51 83 65 100 13 22 59 76 63 1 26 86 36 94 99 74",
"output": "46"
},
{
"input": "100\n27 89 67 60 62 80 43 50 28 88 72 5 94 11 63 91 18 78 99 3 71 26 12 97 74 62 23 24 22 3 100 72 98 7 94 32 12 75 61 88 42 48 10 14 45 9 48 56 73 76 70 70 79 90 35 39 96 37 81 11 19 65 99 39 23 79 34 61 35 74 90 37 73 23 46 21 94 84 73 58 11 89 13 9 10 85 42 78 73 32 53 39 49 90 43 5 28 31 97 75",
"output": "53"
},
{
"input": "100\n33 24 97 96 1 14 99 51 13 65 67 20 46 88 42 44 20 49 5 89 98 83 15 40 74 83 58 3 10 79 34 2 69 28 37 100 55 52 14 8 44 94 97 89 6 42 11 28 30 33 55 56 20 57 52 25 75 1 87 42 62 41 37 12 54 85 95 80 42 36 94 96 28 76 54 36 4 17 26 24 62 15 17 79 84 36 92 78 74 91 96 77 54 92 81 91 62 98 37 37",
"output": "43"
},
{
"input": "100\n86 24 61 15 11 85 1 31 47 36 23 36 59 34 3 27 16 29 82 28 58 52 52 66 71 61 98 39 60 20 67 41 67 90 73 29 92 17 70 95 58 98 58 32 21 73 46 56 87 72 80 75 40 27 94 31 59 92 93 37 14 99 96 21 97 23 81 91 52 52 96 94 92 28 38 29 52 16 57 27 17 24 91 21 79 55 96 98 95 94 23 78 79 12 77 35 32 75 100 82",
"output": "51"
},
{
"input": "100\n88 85 41 37 69 21 7 69 36 5 92 26 64 75 22 46 67 20 70 22 62 66 38 24 47 49 68 30 90 31 67 86 86 82 9 51 43 45 48 42 73 44 31 94 45 60 54 66 20 87 11 94 34 32 87 66 56 28 75 39 37 90 72 93 55 72 31 42 30 71 87 61 4 12 12 81 23 61 56 98 71 32 30 33 96 63 92 16 8 78 47 91 47 54 49 3 81 82 41 5",
"output": "47"
},
{
"input": "1\n2",
"output": "1"
},
{
"input": "5\n1 1 3 2 2",
"output": "3"
}
] | 1,656,272,331 | 2,147,483,647 | Python 3 | OK | TESTS | 52 | 92 | 4,505,600 | n = int(input())
a = [int(i) for i in input().split()]
x = sum(a)
counter = 0
for i in range(len(a)):
difference = x - a[i]
if difference % 2 == 0:
counter = counter + 1
print(counter) | Title: Cookies
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Olga came to visit the twins Anna and Maria and saw that they have many cookies. The cookies are distributed into bags. As there are many cookies, Olga decided that it's no big deal if she steals a bag. However, she doesn't want the sisters to quarrel because of nothing when they divide the cookies. That's why Olga wants to steal a bag with cookies so that the number of cookies in the remaining bags was even, that is, so that Anna and Maria could evenly divide it into two (even 0 remaining cookies will do, just as any other even number). How many ways there are to steal exactly one cookie bag so that the total number of cookies in the remaining bags was even?
Input Specification:
The first line contains the only integer *n* (1<=≤<=*n*<=≤<=100) — the number of cookie bags Anna and Maria have. The second line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=100) — the number of cookies in the *i*-th bag.
Output Specification:
Print in the only line the only number — the sought number of ways. If there are no such ways print 0.
Demo Input:
['1\n1\n', '10\n1 2 2 3 4 4 4 2 2 2\n', '11\n2 2 2 2 2 2 2 2 2 2 99\n']
Demo Output:
['1\n', '8\n', '1\n']
Note:
In the first sample Olga should take the only bag so that the twins ended up with the even number of cookies.
In the second sample Olga can take any of five bags with two cookies or any of three bags with four cookies — 5 + 3 = 8 ways in total.
In the third sample, no matter which bag with two cookies Olga chooses, the twins are left with 2 * 9 + 99 = 117 cookies. Thus, Olga has only one option: to take the bag with 99 cookies. | ```python
n = int(input())
a = [int(i) for i in input().split()]
x = sum(a)
counter = 0
for i in range(len(a)):
difference = x - a[i]
if difference % 2 == 0:
counter = counter + 1
print(counter)
``` | 3 |
|
750 | A | New Year and Hurry | PROGRAMMING | 800 | [
"binary search",
"brute force",
"implementation",
"math"
] | null | null | Limak is going to participate in a contest on the last day of the 2016. The contest will start at 20:00 and will last four hours, exactly until midnight. There will be *n* problems, sorted by difficulty, i.e. problem 1 is the easiest and problem *n* is the hardest. Limak knows it will take him 5·*i* minutes to solve the *i*-th problem.
Limak's friends organize a New Year's Eve party and Limak wants to be there at midnight or earlier. He needs *k* minutes to get there from his house, where he will participate in the contest first.
How many problems can Limak solve if he wants to make it to the party? | The only line of the input contains two integers *n* and *k* (1<=≤<=*n*<=≤<=10, 1<=≤<=*k*<=≤<=240) — the number of the problems in the contest and the number of minutes Limak needs to get to the party from his house. | Print one integer, denoting the maximum possible number of problems Limak can solve so that he could get to the party at midnight or earlier. | [
"3 222\n",
"4 190\n",
"7 1\n"
] | [
"2\n",
"4\n",
"7\n"
] | In the first sample, there are 3 problems and Limak needs 222 minutes to get to the party. The three problems require 5, 10 and 15 minutes respectively. Limak can spend 5 + 10 = 15 minutes to solve first two problems. Then, at 20:15 he can leave his house to get to the party at 23:57 (after 222 minutes). In this scenario Limak would solve 2 problems. He doesn't have enough time to solve 3 problems so the answer is 2.
In the second sample, Limak can solve all 4 problems in 5 + 10 + 15 + 20 = 50 minutes. At 20:50 he will leave the house and go to the party. He will get there exactly at midnight.
In the third sample, Limak needs only 1 minute to get to the party. He has enough time to solve all 7 problems. | 500 | [
{
"input": "3 222",
"output": "2"
},
{
"input": "4 190",
"output": "4"
},
{
"input": "7 1",
"output": "7"
},
{
"input": "10 135",
"output": "6"
},
{
"input": "10 136",
"output": "5"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1 240",
"output": "0"
},
{
"input": "10 1",
"output": "9"
},
{
"input": "10 240",
"output": "0"
},
{
"input": "9 240",
"output": "0"
},
{
"input": "9 1",
"output": "9"
},
{
"input": "9 235",
"output": "1"
},
{
"input": "9 236",
"output": "0"
},
{
"input": "5 225",
"output": "2"
},
{
"input": "5 226",
"output": "1"
},
{
"input": "4 210",
"output": "3"
},
{
"input": "4 211",
"output": "2"
},
{
"input": "4 191",
"output": "3"
},
{
"input": "10 165",
"output": "5"
},
{
"input": "10 166",
"output": "4"
},
{
"input": "8 100",
"output": "7"
},
{
"input": "8 101",
"output": "6"
},
{
"input": "8 60",
"output": "8"
},
{
"input": "8 61",
"output": "7"
},
{
"input": "10 15",
"output": "9"
},
{
"input": "10 16",
"output": "8"
},
{
"input": "4 100",
"output": "4"
},
{
"input": "4 101",
"output": "4"
},
{
"input": "7 167",
"output": "4"
},
{
"input": "10 164",
"output": "5"
},
{
"input": "9 170",
"output": "4"
},
{
"input": "8 160",
"output": "5"
},
{
"input": "1 100",
"output": "1"
},
{
"input": "8 123",
"output": "6"
},
{
"input": "2 99",
"output": "2"
},
{
"input": "10 88",
"output": "7"
},
{
"input": "1 235",
"output": "1"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "4 240",
"output": "0"
},
{
"input": "1 55",
"output": "1"
},
{
"input": "1 240",
"output": "0"
},
{
"input": "3 240",
"output": "0"
},
{
"input": "10 240",
"output": "0"
},
{
"input": "2 240",
"output": "0"
},
{
"input": "10 1",
"output": "9"
},
{
"input": "9 1",
"output": "9"
},
{
"input": "2 236",
"output": "0"
},
{
"input": "10 2",
"output": "9"
},
{
"input": "3 239",
"output": "0"
},
{
"input": "1 237",
"output": "0"
},
{
"input": "7 8",
"output": "7"
},
{
"input": "10 235",
"output": "1"
}
] | 1,700,313,373 | 2,147,483,647 | Python 3 | OK | TESTS | 52 | 46 | 0 | Q, min = input().split()
QsolvinTime = 0
count = 0
qmin = 5
for i in range(int(Q)):
QsolvinTime += qmin
if 240 - int(min) >= QsolvinTime:
qmin += 5
count += 1
else:
break
print(count) | Title: New Year and Hurry
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Limak is going to participate in a contest on the last day of the 2016. The contest will start at 20:00 and will last four hours, exactly until midnight. There will be *n* problems, sorted by difficulty, i.e. problem 1 is the easiest and problem *n* is the hardest. Limak knows it will take him 5·*i* minutes to solve the *i*-th problem.
Limak's friends organize a New Year's Eve party and Limak wants to be there at midnight or earlier. He needs *k* minutes to get there from his house, where he will participate in the contest first.
How many problems can Limak solve if he wants to make it to the party?
Input Specification:
The only line of the input contains two integers *n* and *k* (1<=≤<=*n*<=≤<=10, 1<=≤<=*k*<=≤<=240) — the number of the problems in the contest and the number of minutes Limak needs to get to the party from his house.
Output Specification:
Print one integer, denoting the maximum possible number of problems Limak can solve so that he could get to the party at midnight or earlier.
Demo Input:
['3 222\n', '4 190\n', '7 1\n']
Demo Output:
['2\n', '4\n', '7\n']
Note:
In the first sample, there are 3 problems and Limak needs 222 minutes to get to the party. The three problems require 5, 10 and 15 minutes respectively. Limak can spend 5 + 10 = 15 minutes to solve first two problems. Then, at 20:15 he can leave his house to get to the party at 23:57 (after 222 minutes). In this scenario Limak would solve 2 problems. He doesn't have enough time to solve 3 problems so the answer is 2.
In the second sample, Limak can solve all 4 problems in 5 + 10 + 15 + 20 = 50 minutes. At 20:50 he will leave the house and go to the party. He will get there exactly at midnight.
In the third sample, Limak needs only 1 minute to get to the party. He has enough time to solve all 7 problems. | ```python
Q, min = input().split()
QsolvinTime = 0
count = 0
qmin = 5
for i in range(int(Q)):
QsolvinTime += qmin
if 240 - int(min) >= QsolvinTime:
qmin += 5
count += 1
else:
break
print(count)
``` | 3 |
|
988 | A | Diverse Team | PROGRAMMING | 800 | [
"brute force",
"implementation"
] | null | null | There are $n$ students in a school class, the rating of the $i$-th student on Codehorses is $a_i$. You have to form a team consisting of $k$ students ($1 \le k \le n$) such that the ratings of all team members are distinct.
If it is impossible to form a suitable team, print "NO" (without quotes). Otherwise print "YES", and then print $k$ distinct numbers which should be the indices of students in the team you form. If there are multiple answers, print any of them. | The first line contains two integers $n$ and $k$ ($1 \le k \le n \le 100$) — the number of students and the size of the team you have to form.
The second line contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$), where $a_i$ is the rating of $i$-th student. | If it is impossible to form a suitable team, print "NO" (without quotes). Otherwise print "YES", and then print $k$ distinct integers from $1$ to $n$ which should be the indices of students in the team you form. All the ratings of the students in the team should be distinct. You may print the indices in any order. If there are multiple answers, print any of them.
Assume that the students are numbered from $1$ to $n$. | [
"5 3\n15 13 15 15 12\n",
"5 4\n15 13 15 15 12\n",
"4 4\n20 10 40 30\n"
] | [
"YES\n1 2 5 \n",
"NO\n",
"YES\n1 2 3 4 \n"
] | All possible answers for the first example:
- {1 2 5} - {2 3 5} - {2 4 5}
Note that the order does not matter. | 0 | [
{
"input": "5 3\n15 13 15 15 12",
"output": "YES\n1 2 5 "
},
{
"input": "5 4\n15 13 15 15 12",
"output": "NO"
},
{
"input": "4 4\n20 10 40 30",
"output": "YES\n1 2 3 4 "
},
{
"input": "1 1\n1",
"output": "YES\n1 "
},
{
"input": "100 53\n16 17 1 2 27 5 9 9 53 24 17 33 35 24 20 48 56 73 12 14 39 55 58 13 59 73 29 26 40 33 22 29 34 22 55 38 63 66 36 13 60 42 10 15 21 9 11 5 23 37 79 47 26 3 79 53 44 8 71 75 42 11 34 39 79 33 10 26 23 23 17 14 54 41 60 31 83 5 45 4 14 35 6 60 28 48 23 18 60 36 21 28 7 34 9 25 52 43 54 19",
"output": "YES\n1 2 3 4 5 6 7 9 10 12 13 15 16 17 18 19 20 21 22 23 24 25 27 28 29 31 33 36 37 38 39 41 42 43 44 45 47 49 50 51 52 54 57 58 59 60 73 74 76 77 79 80 83 "
},
{
"input": "2 2\n100 100",
"output": "NO"
},
{
"input": "2 2\n100 99",
"output": "YES\n1 2 "
},
{
"input": "100 100\n63 100 75 32 53 24 73 98 76 15 70 48 8 81 88 58 95 78 27 92 14 16 72 43 46 39 66 38 64 42 59 9 22 51 4 6 10 94 28 99 68 80 35 50 45 20 47 7 30 26 49 91 77 19 96 57 65 1 11 13 31 12 82 87 93 34 62 3 21 79 56 41 89 18 44 23 74 86 2 33 69 36 61 67 25 83 5 84 90 37 40 29 97 60 52 55 54 71 17 85",
"output": "YES\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 "
},
{
"input": "100 41\n54 16 42 3 45 6 9 72 100 13 24 57 35 5 89 13 97 27 43 9 73 89 48 16 48 55 18 15 55 28 30 6 18 41 100 61 9 42 35 54 57 25 73 15 42 54 49 5 72 48 30 55 4 43 94 5 60 92 93 23 89 75 53 92 74 93 89 28 69 6 3 49 15 28 49 57 54 55 30 57 69 18 89 6 25 23 93 74 30 13 87 53 6 42 4 54 60 30 4 35",
"output": "NO"
},
{
"input": "100 2\n70 64 70 32 70 64 32 70 64 32 32 64 70 64 64 32 64 64 64 70 70 64 64 64 64 70 32 64 70 64 32 70 70 70 64 70 64 70 64 32 70 32 70 64 64 64 32 70 64 70 70 32 70 32 32 32 70 32 70 32 64 64 70 32 32 64 70 64 32 32 64 64 32 32 70 70 32 70 32 64 32 70 64 64 32 64 32 64 70 32 70 32 70 64 64 64 70 70 64 70",
"output": "YES\n1 2 "
}
] | 1,625,758,791 | 2,147,483,647 | Python 3 | OK | TESTS | 10 | 62 | 0 | n,k=map(int,input().split())
l=list(map(int,input().split()))
s=set()
for i in range(len(l)):
s.add(l[i])
l1=[i for i in s]
l2=[]
if len(s)>=k:
print("YES")
for i in range(k):
if(l1[i] in l):
l2.append(l.index(l1[i])+1)
l2.sort()
for i in range(len(l2)):
print(l2[i],end=' ')
else:
print("NO")
| Title: Diverse Team
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are $n$ students in a school class, the rating of the $i$-th student on Codehorses is $a_i$. You have to form a team consisting of $k$ students ($1 \le k \le n$) such that the ratings of all team members are distinct.
If it is impossible to form a suitable team, print "NO" (without quotes). Otherwise print "YES", and then print $k$ distinct numbers which should be the indices of students in the team you form. If there are multiple answers, print any of them.
Input Specification:
The first line contains two integers $n$ and $k$ ($1 \le k \le n \le 100$) — the number of students and the size of the team you have to form.
The second line contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$), where $a_i$ is the rating of $i$-th student.
Output Specification:
If it is impossible to form a suitable team, print "NO" (without quotes). Otherwise print "YES", and then print $k$ distinct integers from $1$ to $n$ which should be the indices of students in the team you form. All the ratings of the students in the team should be distinct. You may print the indices in any order. If there are multiple answers, print any of them.
Assume that the students are numbered from $1$ to $n$.
Demo Input:
['5 3\n15 13 15 15 12\n', '5 4\n15 13 15 15 12\n', '4 4\n20 10 40 30\n']
Demo Output:
['YES\n1 2 5 \n', 'NO\n', 'YES\n1 2 3 4 \n']
Note:
All possible answers for the first example:
- {1 2 5} - {2 3 5} - {2 4 5}
Note that the order does not matter. | ```python
n,k=map(int,input().split())
l=list(map(int,input().split()))
s=set()
for i in range(len(l)):
s.add(l[i])
l1=[i for i in s]
l2=[]
if len(s)>=k:
print("YES")
for i in range(k):
if(l1[i] in l):
l2.append(l.index(l1[i])+1)
l2.sort()
for i in range(len(l2)):
print(l2[i],end=' ')
else:
print("NO")
``` | 3 |
|
246 | A | Buggy Sorting | PROGRAMMING | 900 | [
"constructive algorithms",
"greedy",
"sortings"
] | null | null | Little boy Valera studies an algorithm of sorting an integer array. After studying the theory, he went on to the practical tasks. As a result, he wrote a program that sorts an array of *n* integers *a*1,<=*a*2,<=...,<=*a**n* in the non-decreasing order. The pseudocode of the program, written by Valera, is given below. The input of the program gets number *n* and array *a*.
But Valera could have made a mistake, because he hasn't yet fully learned the sorting algorithm. If Valera made a mistake in his program, you need to give a counter-example that makes his program work improperly (that is, the example that makes the program sort the array not in the non-decreasing order). If such example for the given value of *n* doesn't exist, print -1. | You've got a single integer *n* (1<=≤<=*n*<=≤<=50) — the size of the sorted array. | Print *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100) — the counter-example, for which Valera's algorithm won't work correctly. If the counter-example that meets the described conditions is impossible to give, print -1.
If there are several counter-examples, consisting of *n* numbers, you are allowed to print any of them. | [
"1\n"
] | [
"-1\n"
] | none | 500 | [
{
"input": "1",
"output": "-1"
},
{
"input": "2",
"output": "-1"
},
{
"input": "3",
"output": "3 2 1 "
},
{
"input": "4",
"output": "4 3 2 1 "
},
{
"input": "5",
"output": "5 4 3 2 1 "
},
{
"input": "6",
"output": "6 5 4 3 2 1 "
},
{
"input": "7",
"output": "7 6 5 4 3 2 1 "
},
{
"input": "8",
"output": "8 7 6 5 4 3 2 1 "
},
{
"input": "9",
"output": "9 8 7 6 5 4 3 2 1 "
},
{
"input": "50",
"output": "50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 "
},
{
"input": "22",
"output": "22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 "
},
{
"input": "34",
"output": "34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 "
},
{
"input": "50",
"output": "50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 "
},
{
"input": "12",
"output": "12 11 10 9 8 7 6 5 4 3 2 1 "
},
{
"input": "26",
"output": "26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 "
},
{
"input": "38",
"output": "38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 "
},
{
"input": "4",
"output": "4 3 2 1 "
},
{
"input": "18",
"output": "18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 "
},
{
"input": "30",
"output": "30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 "
},
{
"input": "46",
"output": "46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 "
},
{
"input": "32",
"output": "32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 "
}
] | 1,676,717,806 | 2,147,483,647 | Python 3 | OK | TESTS | 21 | 46 | 0 | # LUOGU_RID: 102443681
n = int(input())
if n < 3:
print(-1)
else:
print(*range(n, 0, -1)) | Title: Buggy Sorting
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little boy Valera studies an algorithm of sorting an integer array. After studying the theory, he went on to the practical tasks. As a result, he wrote a program that sorts an array of *n* integers *a*1,<=*a*2,<=...,<=*a**n* in the non-decreasing order. The pseudocode of the program, written by Valera, is given below. The input of the program gets number *n* and array *a*.
But Valera could have made a mistake, because he hasn't yet fully learned the sorting algorithm. If Valera made a mistake in his program, you need to give a counter-example that makes his program work improperly (that is, the example that makes the program sort the array not in the non-decreasing order). If such example for the given value of *n* doesn't exist, print -1.
Input Specification:
You've got a single integer *n* (1<=≤<=*n*<=≤<=50) — the size of the sorted array.
Output Specification:
Print *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=100) — the counter-example, for which Valera's algorithm won't work correctly. If the counter-example that meets the described conditions is impossible to give, print -1.
If there are several counter-examples, consisting of *n* numbers, you are allowed to print any of them.
Demo Input:
['1\n']
Demo Output:
['-1\n']
Note:
none | ```python
# LUOGU_RID: 102443681
n = int(input())
if n < 3:
print(-1)
else:
print(*range(n, 0, -1))
``` | 3 |
|
544 | B | Sea and Islands | PROGRAMMING | 1,400 | [
"constructive algorithms",
"implementation"
] | null | null | A map of some object is a rectangular field consisting of *n* rows and *n* columns. Each cell is initially occupied by the sea but you can cover some some cells of the map with sand so that exactly *k* islands appear on the map. We will call a set of sand cells to be island if it is possible to get from each of them to each of them by moving only through sand cells and by moving from a cell only to a side-adjacent cell. The cells are called to be side-adjacent if they share a vertical or horizontal side. It is easy to see that islands do not share cells (otherwise they together form a bigger island).
Find a way to cover some cells with sand so that exactly *k* islands appear on the *n*<=×<=*n* map, or determine that no such way exists. | The single line contains two positive integers *n*, *k* (1<=≤<=*n*<=≤<=100, 0<=≤<=*k*<=≤<=*n*2) — the size of the map and the number of islands you should form. | If the answer doesn't exist, print "NO" (without the quotes) in a single line.
Otherwise, print "YES" in the first line. In the next *n* lines print the description of the map. Each of the lines of the description must consist only of characters 'S' and 'L', where 'S' is a cell that is occupied by the sea and 'L' is the cell covered with sand. The length of each line of the description must equal *n*.
If there are multiple answers, you may print any of them.
You should not maximize the sizes of islands. | [
"5 2\n",
"5 25\n"
] | [
"YES\nSSSSS\nLLLLL\nSSSSS\nLLLLL\nSSSSS\n",
"NO\n"
] | none | 1,000 | [
{
"input": "5 2",
"output": "YES\nSSSSS\nLLLLL\nSSSSS\nLLLLL\nSSSSS"
},
{
"input": "5 25",
"output": "NO"
},
{
"input": "82 6047",
"output": "NO"
},
{
"input": "6 5",
"output": "YES\nLSLSLS\nSLSLSS\nSSSSSS\nSSSSSS\nSSSSSS\nSSSSSS"
},
{
"input": "10 80",
"output": "NO"
},
{
"input": "48 1279",
"output": "NO"
},
{
"input": "40 1092",
"output": "NO"
},
{
"input": "9 12",
"output": "YES\nLSLSLSLSL\nSLSLSLSLS\nLSLSLSSSS\nSSSSSSSSS\nSSSSSSSSS\nSSSSSSSSS\nSSSSSSSSS\nSSSSSSSSS\nSSSSSSSSS"
},
{
"input": "43 146",
"output": "YES\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSS..."
},
{
"input": "100 5000",
"output": "YES\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS..."
},
{
"input": "100 4999",
"output": "YES\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS..."
},
{
"input": "100 5001",
"output": "NO"
},
{
"input": "99 4901",
"output": "YES\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nS..."
},
{
"input": "99 4900",
"output": "YES\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nS..."
},
{
"input": "99 4902",
"output": "NO"
},
{
"input": "99 9801",
"output": "NO"
},
{
"input": "99 10",
"output": "YES\nLSLSLSLSLSLSLSLSLSLSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nS..."
},
{
"input": "99 1",
"output": "YES\nLSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nS..."
},
{
"input": "100 10000",
"output": "NO"
},
{
"input": "100 10",
"output": "YES\nLSLSLSLSLSLSLSLSLSLSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS..."
},
{
"input": "50 1200",
"output": "YES\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL..."
},
{
"input": "50 1438",
"output": "NO"
},
{
"input": "50 2447",
"output": "NO"
},
{
"input": "49 1719",
"output": "NO"
},
{
"input": "51 1996",
"output": "NO"
},
{
"input": "51 1981",
"output": "NO"
},
{
"input": "34 1060",
"output": "NO"
},
{
"input": "74 3901",
"output": "NO"
},
{
"input": "65 617",
"output": "YES\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS..."
},
{
"input": "89 497",
"output": "YES\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS\nLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSL\nSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLSLS..."
},
{
"input": "34 621",
"output": "NO"
},
{
"input": "1 0",
"output": "YES\nS"
},
{
"input": "10 0",
"output": "YES\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS\nSSSSSSSSSS"
},
{
"input": "11 0",
"output": "YES\nSSSSSSSSSSS\nSSSSSSSSSSS\nSSSSSSSSSSS\nSSSSSSSSSSS\nSSSSSSSSSSS\nSSSSSSSSSSS\nSSSSSSSSSSS\nSSSSSSSSSSS\nSSSSSSSSSSS\nSSSSSSSSSSS\nSSSSSSSSSSS"
},
{
"input": "99 0",
"output": "YES\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nS..."
},
{
"input": "100 0",
"output": "YES\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS\nSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSS..."
},
{
"input": "1 1",
"output": "YES\nL"
},
{
"input": "2 1",
"output": "YES\nLS\nSS"
},
{
"input": "2 0",
"output": "YES\nSS\nSS"
},
{
"input": "2 2",
"output": "YES\nLS\nSL"
},
{
"input": "2 3",
"output": "NO"
},
{
"input": "2 4",
"output": "NO"
}
] | 1,574,799,916 | 2,147,483,647 | Python 3 | OK | TESTS | 42 | 124 | 307,200 | import sys
input = sys.stdin.readline
read_tuple = lambda _type: map(_type, input().split(' '))
def solve():
n, k = read_tuple(int)
grid = [['S' for _ in range(n)] for _ in range(n)]
flag = True
for i in range(n):
for j in range(n):
if k and flag:
grid[i][j] = 'L'
k -= 1
flag ^= True
if n % 2 == 0:
flag ^= True
if k == 0:
print("YES")
else:
print("NO")
if k == 0:
for row in grid:
print(''.join(row))
if __name__ == '__main__':
solve()
| Title: Sea and Islands
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A map of some object is a rectangular field consisting of *n* rows and *n* columns. Each cell is initially occupied by the sea but you can cover some some cells of the map with sand so that exactly *k* islands appear on the map. We will call a set of sand cells to be island if it is possible to get from each of them to each of them by moving only through sand cells and by moving from a cell only to a side-adjacent cell. The cells are called to be side-adjacent if they share a vertical or horizontal side. It is easy to see that islands do not share cells (otherwise they together form a bigger island).
Find a way to cover some cells with sand so that exactly *k* islands appear on the *n*<=×<=*n* map, or determine that no such way exists.
Input Specification:
The single line contains two positive integers *n*, *k* (1<=≤<=*n*<=≤<=100, 0<=≤<=*k*<=≤<=*n*2) — the size of the map and the number of islands you should form.
Output Specification:
If the answer doesn't exist, print "NO" (without the quotes) in a single line.
Otherwise, print "YES" in the first line. In the next *n* lines print the description of the map. Each of the lines of the description must consist only of characters 'S' and 'L', where 'S' is a cell that is occupied by the sea and 'L' is the cell covered with sand. The length of each line of the description must equal *n*.
If there are multiple answers, you may print any of them.
You should not maximize the sizes of islands.
Demo Input:
['5 2\n', '5 25\n']
Demo Output:
['YES\nSSSSS\nLLLLL\nSSSSS\nLLLLL\nSSSSS\n', 'NO\n']
Note:
none | ```python
import sys
input = sys.stdin.readline
read_tuple = lambda _type: map(_type, input().split(' '))
def solve():
n, k = read_tuple(int)
grid = [['S' for _ in range(n)] for _ in range(n)]
flag = True
for i in range(n):
for j in range(n):
if k and flag:
grid[i][j] = 'L'
k -= 1
flag ^= True
if n % 2 == 0:
flag ^= True
if k == 0:
print("YES")
else:
print("NO")
if k == 0:
for row in grid:
print(''.join(row))
if __name__ == '__main__':
solve()
``` | 3 |
|
690 | F1 | Tree of Life (easy) | PROGRAMMING | 1,300 | [] | null | null | Heidi has finally found the mythical Tree of Life – a legendary combinatorial structure which is said to contain a prophecy crucially needed to defeat the undead armies.
On the surface, the Tree of Life is just a regular undirected tree well-known from computer science. This means that it is a collection of *n* points (called vertices), some of which are connected using *n*<=-<=1 line segments (edges) so that each pair of vertices is connected by a path (a sequence of one or more edges).
To decipher the prophecy, Heidi needs to perform a number of steps. The first is counting the number of lifelines in the tree – these are paths of length 2, i.e., consisting of two edges. Help her! | The first line of the input contains a single integer *n* – the number of vertices in the tree (1<=≤<=*n*<=≤<=10000). The vertices are labeled with the numbers from 1 to *n*. Then *n*<=-<=1 lines follow, each describing one edge using two space-separated numbers *a* *b* – the labels of the vertices connected by the edge (1<=≤<=*a*<=<<=*b*<=≤<=*n*). It is guaranteed that the input represents a tree. | Print one integer – the number of lifelines in the tree. | [
"4\n1 2\n1 3\n1 4\n",
"5\n1 2\n2 3\n3 4\n3 5\n"
] | [
"3",
"4"
] | In the second sample, there are four lifelines: paths between vertices 1 and 3, 2 and 4, 2 and 5, and 4 and 5. | 0 | [
{
"input": "4\n1 2\n1 3\n1 4",
"output": "3"
},
{
"input": "5\n1 2\n2 3\n3 4\n3 5",
"output": "4"
},
{
"input": "2\n1 2",
"output": "0"
},
{
"input": "3\n2 1\n3 2",
"output": "1"
},
{
"input": "10\n5 1\n1 2\n9 3\n10 5\n6 3\n8 5\n2 7\n2 3\n9 4",
"output": "11"
}
] | 1,490,269,770 | 2,147,483,647 | Python 3 | OK | TESTS | 19 | 93 | 4,812,800 | n = int(input())
t = [0] * n
out = 0
for _ in range(n-1):
a, b = input().split(' ')
a, b = [int(a), int(b)]
t[a-1] += 1
t[b-1] += 1
for x in t:
out += x * (x-1) / 2
print(int(out))
| Title: Tree of Life (easy)
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Heidi has finally found the mythical Tree of Life – a legendary combinatorial structure which is said to contain a prophecy crucially needed to defeat the undead armies.
On the surface, the Tree of Life is just a regular undirected tree well-known from computer science. This means that it is a collection of *n* points (called vertices), some of which are connected using *n*<=-<=1 line segments (edges) so that each pair of vertices is connected by a path (a sequence of one or more edges).
To decipher the prophecy, Heidi needs to perform a number of steps. The first is counting the number of lifelines in the tree – these are paths of length 2, i.e., consisting of two edges. Help her!
Input Specification:
The first line of the input contains a single integer *n* – the number of vertices in the tree (1<=≤<=*n*<=≤<=10000). The vertices are labeled with the numbers from 1 to *n*. Then *n*<=-<=1 lines follow, each describing one edge using two space-separated numbers *a* *b* – the labels of the vertices connected by the edge (1<=≤<=*a*<=<<=*b*<=≤<=*n*). It is guaranteed that the input represents a tree.
Output Specification:
Print one integer – the number of lifelines in the tree.
Demo Input:
['4\n1 2\n1 3\n1 4\n', '5\n1 2\n2 3\n3 4\n3 5\n']
Demo Output:
['3', '4']
Note:
In the second sample, there are four lifelines: paths between vertices 1 and 3, 2 and 4, 2 and 5, and 4 and 5. | ```python
n = int(input())
t = [0] * n
out = 0
for _ in range(n-1):
a, b = input().split(' ')
a, b = [int(a), int(b)]
t[a-1] += 1
t[b-1] += 1
for x in t:
out += x * (x-1) / 2
print(int(out))
``` | 3 |
|
381 | A | Sereja and Dima | PROGRAMMING | 800 | [
"greedy",
"implementation",
"two pointers"
] | null | null | Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins.
Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move.
Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her. | The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000. | On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game. | [
"4\n4 1 2 10\n",
"7\n1 2 3 4 5 6 7\n"
] | [
"12 5\n",
"16 12\n"
] | In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5. | 500 | [
{
"input": "4\n4 1 2 10",
"output": "12 5"
},
{
"input": "7\n1 2 3 4 5 6 7",
"output": "16 12"
},
{
"input": "42\n15 29 37 22 16 5 26 31 6 32 19 3 45 36 33 14 25 20 48 7 42 11 24 28 9 18 8 21 47 17 38 40 44 4 35 1 43 39 41 27 12 13",
"output": "613 418"
},
{
"input": "43\n32 1 15 48 38 26 25 14 20 44 11 30 3 42 49 19 18 46 5 45 10 23 34 9 29 41 2 52 6 17 35 4 50 22 33 51 7 28 47 13 39 37 24",
"output": "644 500"
},
{
"input": "1\n3",
"output": "3 0"
},
{
"input": "45\n553 40 94 225 415 471 126 190 647 394 515 303 189 159 308 6 139 132 326 78 455 75 85 295 135 613 360 614 351 228 578 259 258 591 444 29 33 463 561 174 368 183 140 168 646",
"output": "6848 6568"
},
{
"input": "44\n849 373 112 307 479 608 856 769 526 82 168 143 573 762 115 501 688 36 214 450 396 496 236 309 287 786 397 43 811 141 745 846 350 270 276 677 420 459 403 722 267 54 394 727",
"output": "9562 9561"
},
{
"input": "35\n10 15 18 1 28 16 2 33 6 22 23 4 9 25 35 8 7 26 3 20 30 14 31 19 27 32 11 5 29 24 21 34 13 17 12",
"output": "315 315"
},
{
"input": "17\n580 376 191 496 73 44 520 357 483 149 81 178 514 300 216 598 304",
"output": "3238 2222"
},
{
"input": "30\n334 443 223 424 168 549 189 303 429 559 516 220 459 134 344 346 316 446 209 148 487 526 69 286 102 366 518 280 392 325",
"output": "5246 4864"
},
{
"input": "95\n122 29 188 265 292 287 183 225 222 187 155 256 64 148 173 278 218 136 290 17 31 130 2 87 57 283 255 280 68 166 174 142 102 39 116 206 288 154 26 78 296 172 184 232 77 91 277 8 249 186 94 93 207 251 257 195 101 299 193 124 293 65 58 35 24 302 220 189 252 125 27 284 247 182 141 103 198 97 234 83 281 216 85 180 267 236 109 143 149 239 79 300 191 244 71",
"output": "8147 7807"
},
{
"input": "1\n1",
"output": "1 0"
}
] | 1,676,105,198 | 2,147,483,647 | Python 3 | OK | TESTS | 34 | 46 | 102,400 | from collections import defaultdict, deque, Counter
from heapq import heapify, heappop, heappush
def main():
t = 1
# t = int(input())
for _ in range(t):
run_test_case()
def run_test_case():
n = int(input())
l = list(map(int, input().split()))
sereja = dima = 0
left, right = 0, n - 1
i = 0
while left <= right:
curMax = max(l[left], l[right])
if i % 2 == 0:
sereja += curMax
else:
dima += curMax
if l[left] > l[right]:
left += 1
else:
right -= 1
i += 1
print(sereja, dima)
if __name__ == "__main__":
main()
"""
/* stuff you should look for
* int overflow, array bounds
* special cases (n=1?)
* do smth instead of nothing and stay organized
* WRITE STUFF DOWN
* DON'T GET STUCK ON ONE APPROACH
*/
"""
| Title: Sereja and Dima
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Sereja and Dima play a game. The rules of the game are very simple. The players have *n* cards in a row. Each card contains a number, all numbers on the cards are distinct. The players take turns, Sereja moves first. During his turn a player can take one card: either the leftmost card in a row, or the rightmost one. The game ends when there is no more cards. The player who has the maximum sum of numbers on his cards by the end of the game, wins.
Sereja and Dima are being greedy. Each of them chooses the card with the larger number during his move.
Inna is a friend of Sereja and Dima. She knows which strategy the guys are using, so she wants to determine the final score, given the initial state of the game. Help her.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of cards on the table. The second line contains space-separated numbers on the cards from left to right. The numbers on the cards are distinct integers from 1 to 1000.
Output Specification:
On a single line, print two integers. The first number is the number of Sereja's points at the end of the game, the second number is the number of Dima's points at the end of the game.
Demo Input:
['4\n4 1 2 10\n', '7\n1 2 3 4 5 6 7\n']
Demo Output:
['12 5\n', '16 12\n']
Note:
In the first sample Sereja will take cards with numbers 10 and 2, so Sereja's sum is 12. Dima will take cards with numbers 4 and 1, so Dima's sum is 5. | ```python
from collections import defaultdict, deque, Counter
from heapq import heapify, heappop, heappush
def main():
t = 1
# t = int(input())
for _ in range(t):
run_test_case()
def run_test_case():
n = int(input())
l = list(map(int, input().split()))
sereja = dima = 0
left, right = 0, n - 1
i = 0
while left <= right:
curMax = max(l[left], l[right])
if i % 2 == 0:
sereja += curMax
else:
dima += curMax
if l[left] > l[right]:
left += 1
else:
right -= 1
i += 1
print(sereja, dima)
if __name__ == "__main__":
main()
"""
/* stuff you should look for
* int overflow, array bounds
* special cases (n=1?)
* do smth instead of nothing and stay organized
* WRITE STUFF DOWN
* DON'T GET STUCK ON ONE APPROACH
*/
"""
``` | 3 |
|
845 | C | Two TVs | PROGRAMMING | 1,500 | [
"data structures",
"greedy",
"sortings"
] | null | null | Polycarp is a great fan of television.
He wrote down all the TV programs he is interested in for today. His list contains *n* shows, *i*-th of them starts at moment *l**i* and ends at moment *r**i*.
Polycarp owns two TVs. He can watch two different shows simultaneously with two TVs but he can only watch one show at any given moment on a single TV. If one show ends at the same moment some other show starts then you can't watch them on a single TV.
Polycarp wants to check out all *n* shows. Are two TVs enough to do so? | The first line contains one integer *n* (1<=≤<=*n*<=≤<=2·105) — the number of shows.
Each of the next *n* lines contains two integers *l**i* and *r**i* (0<=≤<=*l**i*<=<<=*r**i*<=≤<=109) — starting and ending time of *i*-th show. | If Polycarp is able to check out all the shows using only two TVs then print "YES" (without quotes). Otherwise, print "NO" (without quotes). | [
"3\n1 2\n2 3\n4 5\n",
"4\n1 2\n2 3\n2 3\n1 2\n"
] | [
"YES\n",
"NO\n"
] | none | 0 | [
{
"input": "3\n1 2\n2 3\n4 5",
"output": "YES"
},
{
"input": "4\n1 2\n2 3\n2 3\n1 2",
"output": "NO"
},
{
"input": "4\n0 1\n1 2\n2 3\n3 4",
"output": "YES"
},
{
"input": "3\n1 2\n2 3\n2 4",
"output": "NO"
},
{
"input": "3\n0 100\n0 100\n0 100",
"output": "NO"
},
{
"input": "1\n0 1000000000",
"output": "YES"
},
{
"input": "2\n0 1\n0 1",
"output": "YES"
},
{
"input": "3\n2 3\n4 5\n1 6",
"output": "YES"
},
{
"input": "5\n1 3\n1 4\n4 10\n5 8\n9 11",
"output": "YES"
},
{
"input": "3\n1 2\n1 2\n2 3",
"output": "NO"
},
{
"input": "4\n1 100\n10 15\n20 25\n30 35",
"output": "YES"
},
{
"input": "3\n1 8\n6 7\n8 11",
"output": "YES"
},
{
"input": "5\n1 2\n3 5\n4 7\n8 9\n5 10",
"output": "NO"
},
{
"input": "4\n1 7\n2 3\n4 5\n6 7",
"output": "YES"
},
{
"input": "4\n1 100\n50 51\n60 90\n51 52",
"output": "NO"
},
{
"input": "3\n1 10\n2 9\n3 8",
"output": "NO"
},
{
"input": "2\n0 4\n0 4",
"output": "YES"
},
{
"input": "2\n0 2\n0 6",
"output": "YES"
},
{
"input": "5\n3 4\n21 26\n12 17\n9 14\n15 16",
"output": "YES"
},
{
"input": "5\n1 4\n13 15\n11 12\n9 15\n2 5",
"output": "YES"
},
{
"input": "4\n16 19\n9 14\n14 15\n15 19",
"output": "YES"
},
{
"input": "5\n16 19\n23 29\n3 8\n23 26\n22 23",
"output": "NO"
},
{
"input": "5\n19 23\n12 17\n16 21\n20 23\n8 10",
"output": "NO"
},
{
"input": "5\n8 10\n4 10\n3 4\n14 15\n17 19",
"output": "YES"
},
{
"input": "3\n2 8\n5 7\n6 7",
"output": "NO"
},
{
"input": "5\n10 12\n4 6\n21 24\n9 12\n7 13",
"output": "NO"
},
{
"input": "5\n0 3\n14 16\n6 8\n5 9\n9 15",
"output": "YES"
},
{
"input": "5\n6 12\n23 25\n6 7\n19 25\n10 11",
"output": "YES"
},
{
"input": "5\n15 18\n23 24\n23 28\n22 24\n15 19",
"output": "NO"
},
{
"input": "4\n1 8\n8 9\n5 7\n1 4",
"output": "YES"
},
{
"input": "3\n6 10\n1 9\n2 5",
"output": "YES"
},
{
"input": "3\n1 8\n5 6\n6 9",
"output": "NO"
},
{
"input": "4\n2 3\n5 9\n8 10\n9 10",
"output": "NO"
},
{
"input": "4\n0 8\n6 7\n5 9\n1 4",
"output": "NO"
},
{
"input": "3\n6 9\n0 1\n0 2",
"output": "YES"
},
{
"input": "5\n0 6\n21 25\n18 19\n0 3\n6 12",
"output": "YES"
},
{
"input": "4\n1 5\n6 9\n4 8\n1 3",
"output": "YES"
},
{
"input": "2\n2 5\n0 5",
"output": "YES"
},
{
"input": "4\n5 8\n11 15\n3 7\n10 14",
"output": "YES"
},
{
"input": "3\n12 14\n0 4\n2 3",
"output": "YES"
},
{
"input": "4\n4 10\n0 1\n2 10\n0 5",
"output": "NO"
},
{
"input": "4\n0 3\n0 1\n2 4\n2 5",
"output": "NO"
}
] | 1,612,078,280 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 5 | 421 | 204,800 | t=int(input())
television1=[]
television2=[]
start,end=map(int,input().split())
television1=[start,end]
start,end=map(int,input().split())
television2=[start,end]
count=2
for i in range(t-2):
start,end=map(int,input().split())
if start>television1[0]:
television1=[start,end]
count+=1
elif start>television2[0]:
television2=[start,end]
count+=1
if count==t:
print("YES")
else:
print("NO")
| Title: Two TVs
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp is a great fan of television.
He wrote down all the TV programs he is interested in for today. His list contains *n* shows, *i*-th of them starts at moment *l**i* and ends at moment *r**i*.
Polycarp owns two TVs. He can watch two different shows simultaneously with two TVs but he can only watch one show at any given moment on a single TV. If one show ends at the same moment some other show starts then you can't watch them on a single TV.
Polycarp wants to check out all *n* shows. Are two TVs enough to do so?
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=2·105) — the number of shows.
Each of the next *n* lines contains two integers *l**i* and *r**i* (0<=≤<=*l**i*<=<<=*r**i*<=≤<=109) — starting and ending time of *i*-th show.
Output Specification:
If Polycarp is able to check out all the shows using only two TVs then print "YES" (without quotes). Otherwise, print "NO" (without quotes).
Demo Input:
['3\n1 2\n2 3\n4 5\n', '4\n1 2\n2 3\n2 3\n1 2\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none | ```python
t=int(input())
television1=[]
television2=[]
start,end=map(int,input().split())
television1=[start,end]
start,end=map(int,input().split())
television2=[start,end]
count=2
for i in range(t-2):
start,end=map(int,input().split())
if start>television1[0]:
television1=[start,end]
count+=1
elif start>television2[0]:
television2=[start,end]
count+=1
if count==t:
print("YES")
else:
print("NO")
``` | 0 |
|
793 | A | Oleg and shares | PROGRAMMING | 900 | [
"implementation",
"math"
] | null | null | Oleg the bank client checks share prices every day. There are *n* share prices he is interested in. Today he observed that each second exactly one of these prices decreases by *k* rubles (note that each second exactly one price changes, but at different seconds different prices can change). Prices can become negative. Oleg found this process interesting, and he asked Igor the financial analyst, what is the minimum time needed for all *n* prices to become equal, or it is impossible at all? Igor is busy right now, so he asked you to help Oleg. Can you answer this question? | The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=105,<=1<=≤<=*k*<=≤<=109) — the number of share prices, and the amount of rubles some price decreases each second.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the initial prices. | Print the only line containing the minimum number of seconds needed for prices to become equal, of «-1» if it is impossible. | [
"3 3\n12 9 15\n",
"2 2\n10 9\n",
"4 1\n1 1000000000 1000000000 1000000000\n"
] | [
"3",
"-1",
"2999999997"
] | Consider the first example.
Suppose the third price decreases in the first second and become equal 12 rubles, then the first price decreases and becomes equal 9 rubles, and in the third second the third price decreases again and becomes equal 9 rubles. In this case all prices become equal 9 rubles in 3 seconds.
There could be other possibilities, but this minimizes the time needed for all prices to become equal. Thus the answer is 3.
In the second example we can notice that parity of first and second price is different and never changes within described process. Thus prices never can become equal.
In the third example following scenario can take place: firstly, the second price drops, then the third price, and then fourth price. It happens 999999999 times, and, since in one second only one price can drop, the whole process takes 999999999 * 3 = 2999999997 seconds. We can note that this is the minimum possible time. | 500 | [
{
"input": "3 3\n12 9 15",
"output": "3"
},
{
"input": "2 2\n10 9",
"output": "-1"
},
{
"input": "4 1\n1 1000000000 1000000000 1000000000",
"output": "2999999997"
},
{
"input": "1 11\n123",
"output": "0"
},
{
"input": "20 6\n38 86 86 50 98 62 32 2 14 62 98 50 2 50 32 38 62 62 8 14",
"output": "151"
},
{
"input": "20 5\n59 54 19 88 55 100 54 3 6 13 99 38 36 71 59 6 64 85 45 54",
"output": "-1"
},
{
"input": "100 10\n340 70 440 330 130 120 340 210 440 110 410 120 180 40 50 230 70 110 310 360 480 70 230 120 230 310 470 60 210 60 210 480 290 250 450 440 150 40 500 230 280 250 30 50 310 50 230 360 420 260 330 80 50 160 70 470 140 180 380 190 250 30 220 410 80 310 280 50 20 430 440 180 310 190 190 330 90 190 320 390 170 460 230 30 80 500 470 370 80 500 400 120 220 150 70 120 70 320 260 260",
"output": "2157"
},
{
"input": "100 18\n489 42 300 366 473 105 220 448 70 488 201 396 168 281 67 235 324 291 313 387 407 223 39 144 224 233 72 318 229 377 62 171 448 119 354 282 147 447 260 384 172 199 67 326 311 431 337 142 281 202 404 468 38 120 90 437 33 420 249 372 367 253 255 411 309 333 103 176 162 120 203 41 352 478 216 498 224 31 261 493 277 99 375 370 394 229 71 488 246 194 233 13 66 111 366 456 277 360 116 354",
"output": "-1"
},
{
"input": "4 2\n1 2 3 4",
"output": "-1"
},
{
"input": "3 4\n3 5 5",
"output": "-1"
},
{
"input": "3 2\n88888884 88888886 88888888",
"output": "3"
},
{
"input": "2 1\n1000000000 1000000000",
"output": "0"
},
{
"input": "4 2\n1000000000 100000000 100000000 100000000",
"output": "450000000"
},
{
"input": "2 2\n1000000000 1000000000",
"output": "0"
},
{
"input": "3 3\n3 2 1",
"output": "-1"
},
{
"input": "3 4\n3 5 3",
"output": "-1"
},
{
"input": "3 2\n1 2 2",
"output": "-1"
},
{
"input": "4 2\n2 3 3 2",
"output": "-1"
},
{
"input": "3 2\n1 2 4",
"output": "-1"
},
{
"input": "3 2\n3 4 4",
"output": "-1"
},
{
"input": "3 3\n4 7 10",
"output": "3"
},
{
"input": "4 3\n2 2 5 1",
"output": "-1"
},
{
"input": "3 3\n1 3 5",
"output": "-1"
},
{
"input": "2 5\n5 9",
"output": "-1"
},
{
"input": "2 3\n5 7",
"output": "-1"
},
{
"input": "3 137\n1000000000 1000000000 1000000000",
"output": "0"
},
{
"input": "5 1000000000\n1000000000 1000000000 1000000000 1000000000 1000000000",
"output": "0"
},
{
"input": "3 5\n1 2 5",
"output": "-1"
},
{
"input": "3 3\n1000000000 1000000000 999999997",
"output": "2"
},
{
"input": "2 4\n5 6",
"output": "-1"
},
{
"input": "4 1\n1000000000 1000000000 1000000000 1000000000",
"output": "0"
},
{
"input": "2 3\n5 8",
"output": "1"
},
{
"input": "2 6\n8 16",
"output": "-1"
},
{
"input": "5 3\n15 14 9 12 18",
"output": "-1"
},
{
"input": "3 3\n1 2 3",
"output": "-1"
},
{
"input": "3 3\n3 4 5",
"output": "-1"
},
{
"input": "2 5\n8 17",
"output": "-1"
},
{
"input": "2 1\n1 2",
"output": "1"
},
{
"input": "1 1\n1000000000",
"output": "0"
},
{
"input": "3 3\n5 3 4",
"output": "-1"
},
{
"input": "3 6\n10 14 12",
"output": "-1"
},
{
"input": "2 2\n3 5",
"output": "1"
},
{
"input": "3 5\n1 3 4",
"output": "-1"
},
{
"input": "4 3\n1 6 6 6",
"output": "-1"
},
{
"input": "2 3\n1 8",
"output": "-1"
},
{
"input": "3 5\n6 11 17",
"output": "-1"
},
{
"input": "2 2\n1 4",
"output": "-1"
},
{
"input": "2 4\n6 8",
"output": "-1"
},
{
"input": "2 1\n2 3",
"output": "1"
},
{
"input": "4 4\n1 5 8 14",
"output": "-1"
},
{
"input": "3 3\n1 5 3",
"output": "-1"
},
{
"input": "4 3\n1 2 2 5",
"output": "-1"
},
{
"input": "3 2\n1 4 6",
"output": "-1"
},
{
"input": "2 3\n6 9",
"output": "1"
},
{
"input": "3 3\n2 3 4",
"output": "-1"
},
{
"input": "3 2\n9 10 10",
"output": "-1"
},
{
"input": "2 2\n9 12",
"output": "-1"
},
{
"input": "2 2\n100000003 100000005",
"output": "1"
},
{
"input": "2 3\n2 4",
"output": "-1"
},
{
"input": "3 2\n2 3 5",
"output": "-1"
},
{
"input": "3 3\n1 3 4",
"output": "-1"
},
{
"input": "10 2\n2 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000",
"output": "4499999991"
},
{
"input": "3 5\n2 4 5",
"output": "-1"
},
{
"input": "2 3\n7 10",
"output": "1"
},
{
"input": "3 10\n10 13 17",
"output": "-1"
},
{
"input": "2 3\n1 6",
"output": "-1"
},
{
"input": "1 7\n1000000000",
"output": "0"
},
{
"input": "2 4\n3 7",
"output": "1"
},
{
"input": "2 3\n2 5",
"output": "1"
},
{
"input": "20 1\n1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000",
"output": "0"
},
{
"input": "3 3\n7 8 8",
"output": "-1"
},
{
"input": "4 10\n1 11 100 11",
"output": "-1"
}
] | 1,611,815,204 | 2,147,483,647 | PyPy 3 | OK | TESTS | 88 | 202 | 10,956,800 | import math
n,k=map(int,input().split())
a=list(map(int,input().split()))
a.sort()
r=a[0]%k;t=0
for i in range(1,n):
if a[i]%k!=r:
print(-1)
break
else:
t+=(a[i]-a[0])//k
else:
print(t)
| Title: Oleg and shares
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Oleg the bank client checks share prices every day. There are *n* share prices he is interested in. Today he observed that each second exactly one of these prices decreases by *k* rubles (note that each second exactly one price changes, but at different seconds different prices can change). Prices can become negative. Oleg found this process interesting, and he asked Igor the financial analyst, what is the minimum time needed for all *n* prices to become equal, or it is impossible at all? Igor is busy right now, so he asked you to help Oleg. Can you answer this question?
Input Specification:
The first line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=105,<=1<=≤<=*k*<=≤<=109) — the number of share prices, and the amount of rubles some price decreases each second.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109) — the initial prices.
Output Specification:
Print the only line containing the minimum number of seconds needed for prices to become equal, of «-1» if it is impossible.
Demo Input:
['3 3\n12 9 15\n', '2 2\n10 9\n', '4 1\n1 1000000000 1000000000 1000000000\n']
Demo Output:
['3', '-1', '2999999997']
Note:
Consider the first example.
Suppose the third price decreases in the first second and become equal 12 rubles, then the first price decreases and becomes equal 9 rubles, and in the third second the third price decreases again and becomes equal 9 rubles. In this case all prices become equal 9 rubles in 3 seconds.
There could be other possibilities, but this minimizes the time needed for all prices to become equal. Thus the answer is 3.
In the second example we can notice that parity of first and second price is different and never changes within described process. Thus prices never can become equal.
In the third example following scenario can take place: firstly, the second price drops, then the third price, and then fourth price. It happens 999999999 times, and, since in one second only one price can drop, the whole process takes 999999999 * 3 = 2999999997 seconds. We can note that this is the minimum possible time. | ```python
import math
n,k=map(int,input().split())
a=list(map(int,input().split()))
a.sort()
r=a[0]%k;t=0
for i in range(1,n):
if a[i]%k!=r:
print(-1)
break
else:
t+=(a[i]-a[0])//k
else:
print(t)
``` | 3 |
|
265 | A | Colorful Stones (Simplified Edition) | PROGRAMMING | 800 | [
"implementation"
] | null | null | There is a sequence of colorful stones. The color of each stone is one of red, green, or blue. You are given a string *s*. The *i*-th (1-based) character of *s* represents the color of the *i*-th stone. If the character is "R", "G", or "B", the color of the corresponding stone is red, green, or blue, respectively.
Initially Squirrel Liss is standing on the first stone. You perform instructions one or more times.
Each instruction is one of the three types: "RED", "GREEN", or "BLUE". After an instruction *c*, if Liss is standing on a stone whose colors is *c*, Liss will move one stone forward, else she will not move.
You are given a string *t*. The number of instructions is equal to the length of *t*, and the *i*-th character of *t* represents the *i*-th instruction.
Calculate the final position of Liss (the number of the stone she is going to stand on in the end) after performing all the instructions, and print its 1-based position. It is guaranteed that Liss don't move out of the sequence. | The input contains two lines. The first line contains the string *s* (1<=≤<=|*s*|<=≤<=50). The second line contains the string *t* (1<=≤<=|*t*|<=≤<=50). The characters of each string will be one of "R", "G", or "B". It is guaranteed that Liss don't move out of the sequence. | Print the final 1-based position of Liss in a single line. | [
"RGB\nRRR\n",
"RRRBGBRBBB\nBBBRR\n",
"BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB\n"
] | [
"2\n",
"3\n",
"15\n"
] | none | 500 | [
{
"input": "RGB\nRRR",
"output": "2"
},
{
"input": "RRRBGBRBBB\nBBBRR",
"output": "3"
},
{
"input": "BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB",
"output": "15"
},
{
"input": "G\nRRBBRBRRBR",
"output": "1"
},
{
"input": "RRRRRBRRBRRGRBGGRRRGRBBRBBBBBRGRBGBRRGBBBRBBGBRGBB\nB",
"output": "1"
},
{
"input": "RRGGBRGRBG\nBRRGGBBGGR",
"output": "7"
},
{
"input": "BBRRGBGGRGBRGBRBRBGR\nGGGRBGGGBRRRRGRBGBGRGRRBGRBGBG",
"output": "15"
},
{
"input": "GBRRBGBGBBBBRRRGBGRRRGBGBBBRGR\nRRGBRRGRBBBBBBGRRBBR",
"output": "8"
},
{
"input": "BRGRRGRGRRGBBGBBBRRBBRRBGBBGRGBBGGRGBRBGGGRRRBGGBB\nRGBBGRRBBBRRGRRBRBBRGBBGGGRGBGRRRRBRBGGBRBGGGRGBRR",
"output": "16"
},
{
"input": "GGRGGBRRGRGBRRGGRBBGGRRGBBBGBBBGGRBGGBRBBRGBRRRBRG\nGGRGRRRRRRRRRGBBBBRGBRGRGRRGBBRGGBRBBRBGBRGRRRRGGR",
"output": "18"
},
{
"input": "RBBRBGBBGGGBRRBGBRGRRGGRBBBBGRBGGBRRBGBBRBRGBBGGGG\nBRRGRBGRBGBRGBRBGGBBBGBBRGRBGRGRBGRBGGRRBGBRGRRBBG",
"output": "23"
},
{
"input": "RRGGRRBRGRGBRGBRGBBRGGGBRBGBRGBRGGBRBRGBGRRBBGGRBR\nBRGRBBBGRBGRRGGRRRRRRRRGGGGGGGGBGGGGGGGRGRBBRGRGBR",
"output": "14"
},
{
"input": "RBRBRRRRRGGR\nBBBBRRGGBGRBRGBBRGGGRGGBRRBRBRBGGG",
"output": "12"
},
{
"input": "GGRGGGBRGRGRBBRGGGRBGRRR\nGBBBBGBGBGBBBRGGRGGBGRRGRRRGBGB",
"output": "12"
},
{
"input": "RGRBGBRBBGBRRGGGBBGBRRBGRGBBBBBGRRRGGRBB\nBGR",
"output": "2"
},
{
"input": "R\nB",
"output": "1"
},
{
"input": "RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR\nRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR",
"output": "50"
},
{
"input": "RRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRRR\nGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG",
"output": "1"
},
{
"input": "R\nGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGGG",
"output": "1"
}
] | 1,677,513,194 | 2,147,483,647 | Python 3 | OK | TESTS | 19 | 92 | 0 | input1=list(input())
instructions=list(input())
ans=1
counter1=0
counter2=0
for i in range(len(instructions)):
if instructions[counter1]==input1[counter2]:
ans+=1
counter2+=1
counter1+=1
print(ans) | Title: Colorful Stones (Simplified Edition)
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There is a sequence of colorful stones. The color of each stone is one of red, green, or blue. You are given a string *s*. The *i*-th (1-based) character of *s* represents the color of the *i*-th stone. If the character is "R", "G", or "B", the color of the corresponding stone is red, green, or blue, respectively.
Initially Squirrel Liss is standing on the first stone. You perform instructions one or more times.
Each instruction is one of the three types: "RED", "GREEN", or "BLUE". After an instruction *c*, if Liss is standing on a stone whose colors is *c*, Liss will move one stone forward, else she will not move.
You are given a string *t*. The number of instructions is equal to the length of *t*, and the *i*-th character of *t* represents the *i*-th instruction.
Calculate the final position of Liss (the number of the stone she is going to stand on in the end) after performing all the instructions, and print its 1-based position. It is guaranteed that Liss don't move out of the sequence.
Input Specification:
The input contains two lines. The first line contains the string *s* (1<=≤<=|*s*|<=≤<=50). The second line contains the string *t* (1<=≤<=|*t*|<=≤<=50). The characters of each string will be one of "R", "G", or "B". It is guaranteed that Liss don't move out of the sequence.
Output Specification:
Print the final 1-based position of Liss in a single line.
Demo Input:
['RGB\nRRR\n', 'RRRBGBRBBB\nBBBRR\n', 'BRRBGBRGRBGRGRRGGBGBGBRGBRGRGGGRBRRRBRBBBGRRRGGBBB\nBBRBGGRGRGBBBRBGRBRBBBBRBRRRBGBBGBBRRBBGGRBRRBRGRB\n']
Demo Output:
['2\n', '3\n', '15\n']
Note:
none | ```python
input1=list(input())
instructions=list(input())
ans=1
counter1=0
counter2=0
for i in range(len(instructions)):
if instructions[counter1]==input1[counter2]:
ans+=1
counter2+=1
counter1+=1
print(ans)
``` | 3 |
|
218 | A | Mountain Scenery | PROGRAMMING | 1,100 | [
"brute force",
"constructive algorithms",
"implementation"
] | null | null | Little Bolek has found a picture with *n* mountain peaks painted on it. The *n* painted peaks are represented by a non-closed polyline, consisting of 2*n* segments. The segments go through 2*n*<=+<=1 points with coordinates (1,<=*y*1), (2,<=*y*2), ..., (2*n*<=+<=1,<=*y*2*n*<=+<=1), with the *i*-th segment connecting the point (*i*,<=*y**i*) and the point (*i*<=+<=1,<=*y**i*<=+<=1). For any even *i* (2<=≤<=*i*<=≤<=2*n*) the following condition holds: *y**i*<=-<=1<=<<=*y**i* and *y**i*<=><=*y**i*<=+<=1.
We shall call a vertex of a polyline with an even *x* coordinate a mountain peak.
Bolek fancied a little mischief. He chose exactly *k* mountain peaks, rubbed out the segments that went through those peaks and increased each peak's height by one (that is, he increased the *y* coordinate of the corresponding points). Then he painted the missing segments to get a new picture of mountain peaks. Let us denote the points through which the new polyline passes on Bolek's new picture as (1,<=*r*1), (2,<=*r*2), ..., (2*n*<=+<=1,<=*r*2*n*<=+<=1).
Given Bolek's final picture, restore the initial one. | The first line contains two space-separated integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=100). The next line contains 2*n*<=+<=1 space-separated integers *r*1,<=*r*2,<=...,<=*r*2*n*<=+<=1 (0<=≤<=*r**i*<=≤<=100) — the *y* coordinates of the polyline vertices on Bolek's picture.
It is guaranteed that we can obtain the given picture after performing the described actions on some picture of mountain peaks. | Print 2*n*<=+<=1 integers *y*1,<=*y*2,<=...,<=*y*2*n*<=+<=1 — the *y* coordinates of the vertices of the polyline on the initial picture. If there are multiple answers, output any one of them. | [
"3 2\n0 5 3 5 1 5 2\n",
"1 1\n0 2 0\n"
] | [
"0 5 3 4 1 4 2 \n",
"0 1 0 \n"
] | none | 500 | [
{
"input": "3 2\n0 5 3 5 1 5 2",
"output": "0 5 3 4 1 4 2 "
},
{
"input": "1 1\n0 2 0",
"output": "0 1 0 "
},
{
"input": "1 1\n1 100 0",
"output": "1 99 0 "
},
{
"input": "3 1\n0 1 0 1 0 2 0",
"output": "0 1 0 1 0 1 0 "
},
{
"input": "3 1\n0 1 0 2 0 1 0",
"output": "0 1 0 1 0 1 0 "
},
{
"input": "3 3\n0 100 35 67 40 60 3",
"output": "0 99 35 66 40 59 3 "
},
{
"input": "7 3\n1 2 1 3 1 2 1 2 1 3 1 3 1 2 1",
"output": "1 2 1 2 1 2 1 2 1 2 1 2 1 2 1 "
},
{
"input": "100 100\n1 3 1 3 1 3 0 2 0 3 1 3 1 3 1 3 0 3 1 3 0 2 0 2 0 3 0 2 0 2 0 3 1 3 1 3 1 3 1 3 0 2 0 3 1 3 0 2 0 2 0 2 0 2 0 2 0 3 0 3 0 3 0 3 0 2 0 3 1 3 1 3 1 3 0 3 0 2 0 2 0 2 0 2 0 3 0 3 1 3 0 3 1 3 1 3 0 3 1 3 0 3 1 3 1 3 0 3 1 3 0 3 1 3 0 2 0 3 1 3 0 3 1 3 0 2 0 3 1 3 0 3 0 2 0 3 1 3 0 3 0 3 0 2 0 2 0 2 0 3 0 3 1 3 1 3 0 3 1 3 1 3 1 3 0 2 0 3 0 2 0 3 1 3 0 3 0 3 1 3 0 2 0 3 0 2 0 2 0 2 0 2 0 3 1 3 0 3 1 3 1",
"output": "1 2 1 2 1 2 0 1 0 2 1 2 1 2 1 2 0 2 1 2 0 1 0 1 0 2 0 1 0 1 0 2 1 2 1 2 1 2 1 2 0 1 0 2 1 2 0 1 0 1 0 1 0 1 0 1 0 2 0 2 0 2 0 2 0 1 0 2 1 2 1 2 1 2 0 2 0 1 0 1 0 1 0 1 0 2 0 2 1 2 0 2 1 2 1 2 0 2 1 2 0 2 1 2 1 2 0 2 1 2 0 2 1 2 0 1 0 2 1 2 0 2 1 2 0 1 0 2 1 2 0 2 0 1 0 2 1 2 0 2 0 2 0 1 0 1 0 1 0 2 0 2 1 2 1 2 0 2 1 2 1 2 1 2 0 1 0 2 0 1 0 2 1 2 0 2 0 2 1 2 0 1 0 2 0 1 0 1 0 1 0 1 0 2 1 2 0 2 1 2 1 "
},
{
"input": "30 20\n1 3 1 3 0 2 0 4 1 3 0 3 1 3 1 4 2 3 1 2 0 4 2 4 0 4 1 3 0 4 1 4 2 4 2 4 0 3 1 2 1 4 0 3 0 4 1 3 1 4 1 3 0 1 0 4 0 3 2 3 1",
"output": "1 3 1 3 0 2 0 4 1 2 0 2 1 2 1 3 2 3 1 2 0 3 2 3 0 3 1 2 0 3 1 3 2 3 2 3 0 2 1 2 1 3 0 2 0 3 1 2 1 3 1 2 0 1 0 3 0 3 2 3 1 "
},
{
"input": "10 6\n0 5 2 4 1 5 2 5 2 4 2 5 3 5 0 2 0 1 0 1 0",
"output": "0 5 2 4 1 4 2 4 2 3 2 4 3 4 0 1 0 1 0 1 0 "
},
{
"input": "11 6\n3 5 1 4 3 5 0 2 0 2 0 4 0 3 0 4 1 5 2 4 0 4 0",
"output": "3 5 1 4 3 5 0 2 0 2 0 3 0 2 0 3 1 4 2 3 0 3 0 "
},
{
"input": "12 6\n1 2 1 5 0 2 0 4 1 3 1 4 2 4 0 4 0 4 2 4 0 4 0 5 3",
"output": "1 2 1 5 0 2 0 4 1 3 1 4 2 3 0 3 0 3 2 3 0 3 0 4 3 "
},
{
"input": "13 6\n3 5 2 5 0 3 0 1 0 2 0 1 0 1 0 2 1 4 3 5 1 3 1 3 2 3 1",
"output": "3 4 2 4 0 2 0 1 0 1 0 1 0 1 0 2 1 4 3 4 1 2 1 3 2 3 1 "
},
{
"input": "24 7\n3 4 2 4 1 4 3 4 3 5 1 3 1 3 0 3 0 3 1 4 0 3 0 1 0 1 0 3 2 3 2 3 1 2 1 3 2 5 1 3 0 1 0 2 0 3 1 3 1",
"output": "3 4 2 4 1 4 3 4 3 5 1 3 1 3 0 3 0 3 1 3 0 2 0 1 0 1 0 3 2 3 2 3 1 2 1 3 2 4 1 2 0 1 0 1 0 2 1 2 1 "
},
{
"input": "25 8\n3 5 2 4 2 4 0 1 0 1 0 1 0 2 1 5 2 4 2 4 2 3 1 2 0 1 0 2 0 3 2 5 3 5 0 4 2 3 2 4 1 4 0 4 1 4 0 1 0 4 2",
"output": "3 5 2 4 2 4 0 1 0 1 0 1 0 2 1 5 2 4 2 4 2 3 1 2 0 1 0 2 0 3 2 4 3 4 0 3 2 3 2 3 1 3 0 3 1 3 0 1 0 3 2 "
},
{
"input": "26 9\n3 4 2 3 1 3 1 3 2 4 0 1 0 2 1 3 1 3 0 5 1 4 3 5 0 5 2 3 0 3 1 4 1 3 1 4 2 3 1 4 3 4 1 3 2 4 1 3 2 5 1 2 0",
"output": "3 4 2 3 1 3 1 3 2 4 0 1 0 2 1 3 1 3 0 4 1 4 3 4 0 4 2 3 0 2 1 3 1 2 1 3 2 3 1 4 3 4 1 3 2 3 1 3 2 4 1 2 0 "
},
{
"input": "27 10\n3 5 3 5 3 4 1 3 1 3 1 3 2 3 2 3 2 4 2 3 0 4 2 5 3 4 3 4 1 5 3 4 1 2 1 5 0 3 0 5 0 5 3 4 0 1 0 2 0 2 1 4 0 2 1",
"output": "3 5 3 5 3 4 1 3 1 3 1 3 2 3 2 3 2 3 2 3 0 3 2 4 3 4 3 4 1 4 3 4 1 2 1 4 0 2 0 4 0 4 3 4 0 1 0 1 0 2 1 3 0 2 1 "
},
{
"input": "40 1\n0 2 1 2 0 2 1 2 1 2 1 2 1 2 1 3 0 1 0 1 0 1 0 2 0 2 1 2 0 2 1 2 1 2 1 2 1 2 0 2 1 2 1 2 0 1 0 2 0 2 0 1 0 1 0 1 0 1 0 1 0 2 0 2 0 2 0 1 0 2 0 1 0 2 0 1 0 2 1 2 0",
"output": "0 2 1 2 0 2 1 2 1 2 1 2 1 2 1 3 0 1 0 1 0 1 0 2 0 2 1 2 0 2 1 2 1 2 1 2 1 2 0 2 1 2 1 2 0 1 0 2 0 2 0 1 0 1 0 1 0 1 0 1 0 2 0 2 0 2 0 1 0 2 0 1 0 1 0 1 0 2 1 2 0 "
},
{
"input": "40 2\n0 3 1 2 1 2 0 1 0 2 1 3 0 2 0 3 0 3 0 1 0 2 0 3 1 2 0 2 1 2 0 2 0 1 0 1 0 2 0 2 1 3 0 2 0 1 0 1 0 1 0 3 1 3 1 2 1 2 0 3 0 1 0 3 0 2 1 2 0 1 0 2 0 3 1 2 1 3 1 3 0",
"output": "0 3 1 2 1 2 0 1 0 2 1 3 0 2 0 3 0 3 0 1 0 2 0 3 1 2 0 2 1 2 0 2 0 1 0 1 0 2 0 2 1 3 0 2 0 1 0 1 0 1 0 3 1 3 1 2 1 2 0 3 0 1 0 3 0 2 1 2 0 1 0 2 0 3 1 2 1 2 1 2 0 "
},
{
"input": "40 3\n1 3 1 2 0 4 1 2 0 1 0 1 0 3 0 3 2 3 0 3 1 3 0 4 1 3 2 3 0 2 1 3 0 2 0 1 0 3 1 3 2 3 2 3 0 1 0 2 0 1 0 1 0 3 1 3 0 3 1 3 1 2 0 1 0 3 0 2 0 3 0 1 0 2 0 3 1 2 0 3 0",
"output": "1 3 1 2 0 4 1 2 0 1 0 1 0 3 0 3 2 3 0 3 1 3 0 4 1 3 2 3 0 2 1 3 0 2 0 1 0 3 1 3 2 3 2 3 0 1 0 2 0 1 0 1 0 3 1 3 0 3 1 3 1 2 0 1 0 3 0 2 0 3 0 1 0 1 0 2 1 2 0 2 0 "
},
{
"input": "50 40\n1 4 2 4 1 2 1 4 1 4 2 3 1 2 1 4 1 3 0 2 1 4 0 1 0 3 1 3 1 3 0 4 2 4 2 4 2 4 2 4 2 4 2 4 0 4 1 3 1 3 0 4 1 4 2 3 2 3 0 3 0 3 0 4 1 4 1 3 1 4 1 3 0 4 0 3 0 2 0 2 0 4 1 4 0 2 0 4 1 4 0 3 0 2 1 3 0 2 0 4 0",
"output": "1 4 2 4 1 2 1 3 1 3 2 3 1 2 1 3 1 2 0 2 1 3 0 1 0 2 1 2 1 2 0 3 2 3 2 3 2 3 2 3 2 3 2 3 0 3 1 2 1 2 0 3 1 3 2 3 2 3 0 2 0 2 0 3 1 3 1 2 1 3 1 2 0 3 0 2 0 1 0 1 0 3 1 3 0 1 0 3 1 3 0 2 0 2 1 2 0 1 0 3 0 "
},
{
"input": "100 2\n1 3 1 2 1 3 2 3 1 3 1 3 1 3 1 2 0 3 0 2 0 3 2 3 0 3 1 2 1 2 0 3 0 1 0 1 0 3 2 3 1 2 0 1 0 2 0 1 0 2 1 3 1 2 1 3 2 3 1 3 1 2 0 3 2 3 0 2 1 3 1 2 0 3 2 3 1 3 2 3 0 4 0 3 0 1 0 3 0 1 0 1 0 2 0 2 1 3 1 2 1 2 0 2 0 1 0 2 0 2 1 3 1 3 2 3 0 2 1 2 0 3 0 1 0 2 0 3 2 3 1 3 0 3 1 2 0 1 0 3 0 1 0 1 0 1 0 2 0 1 0 2 1 2 1 2 1 3 0 1 0 2 1 3 0 2 1 3 0 2 1 2 0 3 1 3 1 3 0 2 1 2 1 3 0 2 1 3 2 3 1 2 0 3 1 2 0 3 1 2 0",
"output": "1 3 1 2 1 3 2 3 1 3 1 3 1 3 1 2 0 3 0 2 0 3 2 3 0 3 1 2 1 2 0 3 0 1 0 1 0 3 2 3 1 2 0 1 0 2 0 1 0 2 1 3 1 2 1 3 2 3 1 3 1 2 0 3 2 3 0 2 1 3 1 2 0 3 2 3 1 3 2 3 0 4 0 3 0 1 0 3 0 1 0 1 0 2 0 2 1 3 1 2 1 2 0 2 0 1 0 2 0 2 1 3 1 3 2 3 0 2 1 2 0 3 0 1 0 2 0 3 2 3 1 3 0 3 1 2 0 1 0 3 0 1 0 1 0 1 0 2 0 1 0 2 1 2 1 2 1 3 0 1 0 2 1 3 0 2 1 3 0 2 1 2 0 3 1 3 1 3 0 2 1 2 1 3 0 2 1 3 2 3 1 2 0 2 1 2 0 2 1 2 0 "
},
{
"input": "100 3\n0 2 1 2 0 1 0 1 0 3 0 2 1 3 1 3 2 3 0 2 0 1 0 2 0 1 0 3 2 3 2 3 1 2 1 3 1 2 1 3 2 3 2 3 0 3 2 3 2 3 2 3 0 2 0 3 0 3 2 3 2 3 2 3 2 3 0 3 0 1 0 2 1 3 0 2 1 2 0 3 2 3 2 3 1 3 0 3 1 3 0 3 0 1 0 1 0 2 0 2 1 2 0 3 1 3 0 3 2 3 2 3 2 3 2 3 0 1 0 1 0 1 0 2 1 2 0 2 1 3 2 3 0 1 0 1 0 1 0 1 0 2 0 1 0 3 1 2 1 2 1 3 1 2 0 3 0 2 1 2 1 3 2 3 1 3 2 3 0 1 0 1 0 1 0 1 0 3 0 1 0 2 1 2 0 3 1 3 2 3 0 3 1 2 1 3 1 3 1 3 0",
"output": "0 2 1 2 0 1 0 1 0 3 0 2 1 3 1 3 2 3 0 2 0 1 0 2 0 1 0 3 2 3 2 3 1 2 1 3 1 2 1 3 2 3 2 3 0 3 2 3 2 3 2 3 0 2 0 3 0 3 2 3 2 3 2 3 2 3 0 3 0 1 0 2 1 3 0 2 1 2 0 3 2 3 2 3 1 3 0 3 1 3 0 3 0 1 0 1 0 2 0 2 1 2 0 3 1 3 0 3 2 3 2 3 2 3 2 3 0 1 0 1 0 1 0 2 1 2 0 2 1 3 2 3 0 1 0 1 0 1 0 1 0 2 0 1 0 3 1 2 1 2 1 3 1 2 0 3 0 2 1 2 1 3 2 3 1 3 2 3 0 1 0 1 0 1 0 1 0 3 0 1 0 2 1 2 0 3 1 3 2 3 0 3 1 2 1 2 1 2 1 2 0 "
},
{
"input": "100 20\n0 1 0 3 0 3 2 3 2 4 0 2 0 3 1 3 0 2 0 2 0 3 0 1 0 3 2 4 0 1 0 2 0 2 1 2 1 4 2 4 1 2 0 1 0 2 1 3 0 2 1 3 2 3 1 2 0 2 1 4 0 3 0 2 0 1 0 1 0 1 0 2 1 3 2 3 2 3 2 3 0 1 0 1 0 4 2 3 2 3 0 3 1 2 0 2 0 2 1 3 2 3 1 4 0 1 0 2 1 2 0 2 0 3 2 3 0 2 0 2 1 4 2 3 1 3 0 3 0 2 0 2 1 2 1 3 0 3 1 2 1 3 1 3 1 2 1 2 0 2 1 3 0 2 0 3 0 1 0 3 0 3 0 1 0 4 1 3 0 1 0 1 0 2 1 2 0 2 1 4 1 3 0 2 1 3 1 3 1 3 0 3 0 2 0 1 0 2 1 2 1",
"output": "0 1 0 3 0 3 2 3 2 4 0 2 0 3 1 3 0 2 0 2 0 3 0 1 0 3 2 4 0 1 0 2 0 2 1 2 1 4 2 4 1 2 0 1 0 2 1 3 0 2 1 3 2 3 1 2 0 2 1 4 0 3 0 2 0 1 0 1 0 1 0 2 1 3 2 3 2 3 2 3 0 1 0 1 0 4 2 3 2 3 0 3 1 2 0 2 0 2 1 3 2 3 1 4 0 1 0 2 1 2 0 2 0 3 2 3 0 2 0 2 1 4 2 3 1 3 0 2 0 1 0 2 1 2 1 2 0 2 1 2 1 2 1 2 1 2 1 2 0 2 1 2 0 1 0 2 0 1 0 2 0 2 0 1 0 3 1 2 0 1 0 1 0 2 1 2 0 2 1 3 1 2 0 2 1 2 1 2 1 2 0 2 0 1 0 1 0 2 1 2 1 "
},
{
"input": "100 20\n2 3 0 4 0 1 0 6 3 4 3 6 4 6 0 9 0 6 2 7 3 8 7 10 2 9 3 9 5 6 5 10 3 7 1 5 2 8 3 7 2 3 1 6 0 8 3 8 0 4 1 8 3 7 1 9 5 9 5 8 7 8 5 6 5 8 1 9 8 9 8 10 7 10 5 8 6 10 2 6 3 9 2 6 3 10 5 9 3 10 1 3 2 11 8 9 8 10 1 8 7 11 0 9 5 8 4 5 0 7 3 7 5 9 5 10 1 7 1 9 1 6 3 8 2 4 1 4 2 6 0 4 2 4 2 7 6 9 0 1 0 4 0 4 0 9 2 7 6 7 2 8 0 8 2 7 5 10 1 2 0 2 0 4 3 5 4 7 0 10 2 10 3 6 3 7 1 4 0 9 1 4 3 8 1 10 1 10 0 3 2 5 3 9 0 7 4 5 0 1 0",
"output": "2 3 0 4 0 1 0 6 3 4 3 6 4 6 0 9 0 6 2 7 3 8 7 10 2 9 3 9 5 6 5 10 3 7 1 5 2 8 3 7 2 3 1 6 0 8 3 8 0 4 1 8 3 7 1 9 5 9 5 8 7 8 5 6 5 8 1 9 8 9 8 10 7 10 5 8 6 10 2 6 3 9 2 6 3 10 5 9 3 10 1 3 2 11 8 9 8 10 1 8 7 11 0 9 5 8 4 5 0 7 3 7 5 9 5 10 1 7 1 9 1 6 3 8 2 4 1 4 2 6 0 4 2 4 2 7 6 9 0 1 0 4 0 3 0 8 2 7 6 7 2 7 0 7 2 6 5 9 1 2 0 1 0 4 3 5 4 6 0 9 2 9 3 5 3 6 1 3 0 8 1 4 3 7 1 9 1 9 0 3 2 4 3 8 0 6 4 5 0 1 0 "
},
{
"input": "98 3\n1 2 1 2 0 2 0 2 1 2 0 1 0 2 1 2 0 2 1 2 1 2 0 1 0 2 1 2 1 2 0 2 1 2 0 2 0 2 0 1 0 1 0 1 0 2 1 3 1 2 1 2 1 2 1 2 1 2 1 2 0 2 0 2 1 2 1 2 0 2 1 2 0 1 0 1 0 1 0 1 0 2 0 1 0 2 0 2 1 2 1 2 1 2 0 1 0 1 0 1 0 2 1 2 0 2 1 2 0 2 0 1 0 2 1 2 0 1 0 2 1 2 1 2 1 2 0 2 1 2 1 2 1 2 0 2 1 2 1 2 0 1 0 2 0 2 0 1 0 2 0 2 0 1 0 1 0 1 0 2 0 2 1 2 0 1 0 2 0 2 0 1 0 2 1 2 1 2 1 2 0 2 1 2 1 2 1 2 0 1 0 1 0 2 0 2 0",
"output": "1 2 1 2 0 2 0 2 1 2 0 1 0 2 1 2 0 2 1 2 1 2 0 1 0 2 1 2 1 2 0 2 1 2 0 2 0 2 0 1 0 1 0 1 0 2 1 3 1 2 1 2 1 2 1 2 1 2 1 2 0 2 0 2 1 2 1 2 0 2 1 2 0 1 0 1 0 1 0 1 0 2 0 1 0 2 0 2 1 2 1 2 1 2 0 1 0 1 0 1 0 2 1 2 0 2 1 2 0 2 0 1 0 2 1 2 0 1 0 2 1 2 1 2 1 2 0 2 1 2 1 2 1 2 0 2 1 2 1 2 0 1 0 2 0 2 0 1 0 2 0 2 0 1 0 1 0 1 0 2 0 2 1 2 0 1 0 2 0 1 0 1 0 2 1 2 1 2 1 2 0 2 1 2 1 2 1 2 0 1 0 1 0 1 0 1 0 "
},
{
"input": "2 1\n0 2 1 4 1",
"output": "0 2 1 3 1 "
},
{
"input": "2 1\n0 2 1 5 1",
"output": "0 2 1 4 1 "
},
{
"input": "3 3\n1 12 9 11 6 8 1",
"output": "1 11 9 10 6 7 1 "
},
{
"input": "3 2\n0 7 4 7 1 3 2",
"output": "0 6 4 6 1 3 2 "
},
{
"input": "2 1\n1 3 2 4 1",
"output": "1 3 2 3 1 "
},
{
"input": "4 1\n5 6 5 6 5 6 1 3 1",
"output": "5 6 5 6 5 6 1 2 1 "
},
{
"input": "2 1\n0 2 1 3 0",
"output": "0 2 1 2 0 "
},
{
"input": "2 2\n98 100 1 7 2",
"output": "98 99 1 6 2 "
},
{
"input": "3 1\n8 10 9 10 3 5 1",
"output": "8 10 9 10 3 4 1 "
},
{
"input": "3 2\n0 4 3 5 2 5 2",
"output": "0 4 3 4 2 4 2 "
},
{
"input": "2 1\n4 5 2 4 2",
"output": "4 5 2 3 2 "
},
{
"input": "3 1\n0 2 1 2 0 2 0",
"output": "0 2 1 2 0 1 0 "
},
{
"input": "1 1\n5 7 2",
"output": "5 6 2 "
},
{
"input": "2 1\n3 4 1 3 1",
"output": "3 4 1 2 1 "
},
{
"input": "3 1\n0 4 3 5 0 5 0",
"output": "0 4 3 5 0 4 0 "
},
{
"input": "3 1\n1 3 2 3 1 3 1",
"output": "1 3 2 3 1 2 1 "
},
{
"input": "2 1\n0 8 7 100 0",
"output": "0 8 7 99 0 "
},
{
"input": "2 1\n1 3 2 5 1",
"output": "1 3 2 4 1 "
}
] | 1,593,606,878 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 0 | 216 | 0 |
n,k = map(int,input().split())
t = list(map(int,input().split()))
u=0
for i in range(len(t)):
if u<k:
if t[i]>0:
if i==0:
if t[i]-1!=t[i+1]:
u+=1
t[i]-=1
if u==k:
print(*t)
break
elif i==len(t)-1:
if t[-1]-1!=t[-2]:
u+=1
t[i]-=1
if u==k:
print(*t)
break
else:
if t[i]-1!=t[i-1] and t[i]+1 !=t[i+1]:
u+=1
t[i]-=1
if u==k:
print(*t)
break
| Title: Mountain Scenery
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Bolek has found a picture with *n* mountain peaks painted on it. The *n* painted peaks are represented by a non-closed polyline, consisting of 2*n* segments. The segments go through 2*n*<=+<=1 points with coordinates (1,<=*y*1), (2,<=*y*2), ..., (2*n*<=+<=1,<=*y*2*n*<=+<=1), with the *i*-th segment connecting the point (*i*,<=*y**i*) and the point (*i*<=+<=1,<=*y**i*<=+<=1). For any even *i* (2<=≤<=*i*<=≤<=2*n*) the following condition holds: *y**i*<=-<=1<=<<=*y**i* and *y**i*<=><=*y**i*<=+<=1.
We shall call a vertex of a polyline with an even *x* coordinate a mountain peak.
Bolek fancied a little mischief. He chose exactly *k* mountain peaks, rubbed out the segments that went through those peaks and increased each peak's height by one (that is, he increased the *y* coordinate of the corresponding points). Then he painted the missing segments to get a new picture of mountain peaks. Let us denote the points through which the new polyline passes on Bolek's new picture as (1,<=*r*1), (2,<=*r*2), ..., (2*n*<=+<=1,<=*r*2*n*<=+<=1).
Given Bolek's final picture, restore the initial one.
Input Specification:
The first line contains two space-separated integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=100). The next line contains 2*n*<=+<=1 space-separated integers *r*1,<=*r*2,<=...,<=*r*2*n*<=+<=1 (0<=≤<=*r**i*<=≤<=100) — the *y* coordinates of the polyline vertices on Bolek's picture.
It is guaranteed that we can obtain the given picture after performing the described actions on some picture of mountain peaks.
Output Specification:
Print 2*n*<=+<=1 integers *y*1,<=*y*2,<=...,<=*y*2*n*<=+<=1 — the *y* coordinates of the vertices of the polyline on the initial picture. If there are multiple answers, output any one of them.
Demo Input:
['3 2\n0 5 3 5 1 5 2\n', '1 1\n0 2 0\n']
Demo Output:
['0 5 3 4 1 4 2 \n', '0 1 0 \n']
Note:
none | ```python
n,k = map(int,input().split())
t = list(map(int,input().split()))
u=0
for i in range(len(t)):
if u<k:
if t[i]>0:
if i==0:
if t[i]-1!=t[i+1]:
u+=1
t[i]-=1
if u==k:
print(*t)
break
elif i==len(t)-1:
if t[-1]-1!=t[-2]:
u+=1
t[i]-=1
if u==k:
print(*t)
break
else:
if t[i]-1!=t[i-1] and t[i]+1 !=t[i+1]:
u+=1
t[i]-=1
if u==k:
print(*t)
break
``` | 0 |
|
709 | A | Juicer | PROGRAMMING | 900 | [
"implementation"
] | null | null | Kolya is going to make fresh orange juice. He has *n* oranges of sizes *a*1,<=*a*2,<=...,<=*a**n*. Kolya will put them in the juicer in the fixed order, starting with orange of size *a*1, then orange of size *a*2 and so on. To be put in the juicer the orange must have size not exceeding *b*, so if Kolya sees an orange that is strictly greater he throws it away and continues with the next one.
The juicer has a special section to collect waste. It overflows if Kolya squeezes oranges of the total size strictly greater than *d*. When it happens Kolya empties the waste section (even if there are no more oranges) and continues to squeeze the juice. How many times will he have to empty the waste section? | The first line of the input contains three integers *n*, *b* and *d* (1<=≤<=*n*<=≤<=100<=000, 1<=≤<=*b*<=≤<=*d*<=≤<=1<=000<=000) — the number of oranges, the maximum size of the orange that fits in the juicer and the value *d*, which determines the condition when the waste section should be emptied.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1<=000<=000) — sizes of the oranges listed in the order Kolya is going to try to put them in the juicer. | Print one integer — the number of times Kolya will have to empty the waste section. | [
"2 7 10\n5 6\n",
"1 5 10\n7\n",
"3 10 10\n5 7 7\n",
"1 1 1\n1\n"
] | [
"1\n",
"0\n",
"1\n",
"0\n"
] | In the first sample, Kolya will squeeze the juice from two oranges and empty the waste section afterwards.
In the second sample, the orange won't fit in the juicer so Kolya will have no juice at all. | 500 | [
{
"input": "2 7 10\n5 6",
"output": "1"
},
{
"input": "1 5 10\n7",
"output": "0"
},
{
"input": "3 10 10\n5 7 7",
"output": "1"
},
{
"input": "1 1 1\n1",
"output": "0"
},
{
"input": "2 951637 951638\n44069 951637",
"output": "1"
},
{
"input": "50 100 129\n55 130 91 19 116 3 63 52 104 76 75 27 151 99 149 147 39 148 84 9 132 49 40 112 124 141 144 93 36 32 146 74 48 38 150 55 94 32 107 69 77 81 33 57 62 98 78 127 154 126",
"output": "12"
},
{
"input": "100 1000 1083\n992 616 818 359 609 783 263 989 501 929 362 394 919 1081 870 830 1097 975 62 346 531 367 323 457 707 360 949 334 867 116 478 417 961 963 1029 114 867 1008 988 916 983 1077 959 942 572 961 579 318 721 337 488 717 111 70 416 685 987 130 353 107 61 191 827 849 106 815 211 953 111 398 889 860 801 71 375 320 395 1059 116 222 931 444 582 74 677 655 88 173 686 491 661 186 114 832 615 814 791 464 517 850",
"output": "36"
},
{
"input": "2 6 8\n2 1",
"output": "0"
},
{
"input": "5 15 16\n7 11 5 12 8",
"output": "2"
},
{
"input": "15 759966 759967\n890397 182209 878577 548548 759966 812923 759966 860479 200595 381358 299175 339368 759966 907668 69574",
"output": "4"
},
{
"input": "5 234613 716125\n642626 494941 234613 234613 234613",
"output": "0"
},
{
"input": "50 48547 567054\n529808 597004 242355 559114 78865 537318 631455 733020 655072 645093 309010 855034 306058 625046 524574 834944 27330 664392 443637 821584 338013 490702 289520 675471 885846 258814 134220 571301 84875 94132 200425 928833 375166 521232 317961 175315 947093 89971 322071 174033 48547 998535 954205 704114 943163 438900 48547 538422 48547 48547",
"output": "0"
},
{
"input": "5 10 20\n10 10 10 10 1",
"output": "1"
},
{
"input": "5 10 11\n10 10 10 10 1",
"output": "2"
},
{
"input": "3 10 10\n4 3 3",
"output": "0"
},
{
"input": "3 5 5\n5 5 5",
"output": "1"
},
{
"input": "3 4 14\n5 5 5",
"output": "0"
},
{
"input": "2 7 10\n1234 1234",
"output": "0"
},
{
"input": "1 5 6\n10",
"output": "0"
},
{
"input": "3 4 6\n1 2 3",
"output": "0"
},
{
"input": "5 10 12\n13 13 13 13 13",
"output": "0"
},
{
"input": "3 4 5\n5 7 9",
"output": "0"
},
{
"input": "3 10 100\n5 5 5",
"output": "0"
},
{
"input": "5 1 2\n2 2 2 2 2",
"output": "0"
},
{
"input": "5 5 5\n5 5 5 5 5",
"output": "2"
},
{
"input": "2 2 5\n5 5",
"output": "0"
},
{
"input": "3 1 4\n2 2 2",
"output": "0"
}
] | 1,628,327,562 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 5 | 108 | 14,131,200 | a, b, d = [int(i) for i in input().split()]
n = 0
res = 0
s = [int(i) for i in input().split()]
for i in range(a):
if s[i] < b:
n += s[i]
if n > d:
n = 0
res += 1
print(res) | Title: Juicer
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Kolya is going to make fresh orange juice. He has *n* oranges of sizes *a*1,<=*a*2,<=...,<=*a**n*. Kolya will put them in the juicer in the fixed order, starting with orange of size *a*1, then orange of size *a*2 and so on. To be put in the juicer the orange must have size not exceeding *b*, so if Kolya sees an orange that is strictly greater he throws it away and continues with the next one.
The juicer has a special section to collect waste. It overflows if Kolya squeezes oranges of the total size strictly greater than *d*. When it happens Kolya empties the waste section (even if there are no more oranges) and continues to squeeze the juice. How many times will he have to empty the waste section?
Input Specification:
The first line of the input contains three integers *n*, *b* and *d* (1<=≤<=*n*<=≤<=100<=000, 1<=≤<=*b*<=≤<=*d*<=≤<=1<=000<=000) — the number of oranges, the maximum size of the orange that fits in the juicer and the value *d*, which determines the condition when the waste section should be emptied.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1<=000<=000) — sizes of the oranges listed in the order Kolya is going to try to put them in the juicer.
Output Specification:
Print one integer — the number of times Kolya will have to empty the waste section.
Demo Input:
['2 7 10\n5 6\n', '1 5 10\n7\n', '3 10 10\n5 7 7\n', '1 1 1\n1\n']
Demo Output:
['1\n', '0\n', '1\n', '0\n']
Note:
In the first sample, Kolya will squeeze the juice from two oranges and empty the waste section afterwards.
In the second sample, the orange won't fit in the juicer so Kolya will have no juice at all. | ```python
a, b, d = [int(i) for i in input().split()]
n = 0
res = 0
s = [int(i) for i in input().split()]
for i in range(a):
if s[i] < b:
n += s[i]
if n > d:
n = 0
res += 1
print(res)
``` | 0 |
|
552 | A | Vanya and Table | PROGRAMMING | 1,000 | [
"implementation",
"math"
] | null | null | Vanya has a table consisting of 100 rows, each row contains 100 cells. The rows are numbered by integers from 1 to 100 from bottom to top, the columns are numbered from 1 to 100 from left to right.
In this table, Vanya chose *n* rectangles with sides that go along borders of squares (some rectangles probably occur multiple times). After that for each cell of the table he counted the number of rectangles it belongs to and wrote this number into it. Now he wants to find the sum of values in all cells of the table and as the table is too large, he asks you to help him find the result. | The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of rectangles.
Each of the following *n* lines contains four integers *x*1,<=*y*1,<=*x*2,<=*y*2 (1<=≤<=*x*1<=≤<=*x*2<=≤<=100, 1<=≤<=*y*1<=≤<=*y*2<=≤<=100), where *x*1 and *y*1 are the number of the column and row of the lower left cell and *x*2 and *y*2 are the number of the column and row of the upper right cell of a rectangle. | In a single line print the sum of all values in the cells of the table. | [
"2\n1 1 2 3\n2 2 3 3\n",
"2\n1 1 3 3\n1 1 3 3\n"
] | [
"10\n",
"18\n"
] | Note to the first sample test:
Values of the table in the first three rows and columns will be as follows:
121
121
110
So, the sum of values will be equal to 10.
Note to the second sample test:
Values of the table in the first three rows and columns will be as follows:
222
222
222
So, the sum of values will be equal to 18. | 500 | [
{
"input": "2\n1 1 2 3\n2 2 3 3",
"output": "10"
},
{
"input": "2\n1 1 3 3\n1 1 3 3",
"output": "18"
},
{
"input": "5\n4 11 20 15\n7 5 12 20\n10 8 16 12\n7 5 12 15\n2 2 20 13",
"output": "510"
},
{
"input": "5\n4 11 20 20\n6 11 20 16\n5 2 19 15\n11 3 18 15\n3 2 14 11",
"output": "694"
},
{
"input": "5\n1 1 1 100\n1 1 1 100\n1 1 1 100\n1 1 1 100\n1 1 1 100",
"output": "500"
},
{
"input": "1\n1 1 1 1",
"output": "1"
},
{
"input": "1\n100 100 100 100",
"output": "1"
},
{
"input": "1\n1 1 1 100",
"output": "100"
},
{
"input": "3\n1 1 1 1\n1 2 1 2\n1 3 1 3",
"output": "3"
},
{
"input": "1\n1 1 100 100",
"output": "10000"
}
] | 1,695,059,582 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 26 | 77 | 0 | def solve(x1, y1, x2, y2):
return sum((x2[i] - x1[i] + 1) * (y2[i] - y1[i] + 1) for i in range(len(x1)))
def main():
n = int(input())
x1 = []
y1 = []
x2 = []
y2 = []
for _ in range(n):
x1_i, y1_i, x2_i, y2_i = map(int, input().split())
x1.append(x1_i)
y1.append(y1_i)
x2.append(x2_i)
y2.append(y2_i)
result = solve(x1, y1, x2, y2)
print(result)
if __name__ == "__main__":
main()
| Title: Vanya and Table
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vanya has a table consisting of 100 rows, each row contains 100 cells. The rows are numbered by integers from 1 to 100 from bottom to top, the columns are numbered from 1 to 100 from left to right.
In this table, Vanya chose *n* rectangles with sides that go along borders of squares (some rectangles probably occur multiple times). After that for each cell of the table he counted the number of rectangles it belongs to and wrote this number into it. Now he wants to find the sum of values in all cells of the table and as the table is too large, he asks you to help him find the result.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of rectangles.
Each of the following *n* lines contains four integers *x*1,<=*y*1,<=*x*2,<=*y*2 (1<=≤<=*x*1<=≤<=*x*2<=≤<=100, 1<=≤<=*y*1<=≤<=*y*2<=≤<=100), where *x*1 and *y*1 are the number of the column and row of the lower left cell and *x*2 and *y*2 are the number of the column and row of the upper right cell of a rectangle.
Output Specification:
In a single line print the sum of all values in the cells of the table.
Demo Input:
['2\n1 1 2 3\n2 2 3 3\n', '2\n1 1 3 3\n1 1 3 3\n']
Demo Output:
['10\n', '18\n']
Note:
Note to the first sample test:
Values of the table in the first three rows and columns will be as follows:
121
121
110
So, the sum of values will be equal to 10.
Note to the second sample test:
Values of the table in the first three rows and columns will be as follows:
222
222
222
So, the sum of values will be equal to 18. | ```python
def solve(x1, y1, x2, y2):
return sum((x2[i] - x1[i] + 1) * (y2[i] - y1[i] + 1) for i in range(len(x1)))
def main():
n = int(input())
x1 = []
y1 = []
x2 = []
y2 = []
for _ in range(n):
x1_i, y1_i, x2_i, y2_i = map(int, input().split())
x1.append(x1_i)
y1.append(y1_i)
x2.append(x2_i)
y2.append(y2_i)
result = solve(x1, y1, x2, y2)
print(result)
if __name__ == "__main__":
main()
``` | 3 |
|
155 | A | I_love_\%username\% | PROGRAMMING | 800 | [
"brute force"
] | null | null | Vasya adores sport programming. He can't write programs but he loves to watch the contests' progress. Vasya even has a favorite coder and Vasya pays special attention to him.
One day Vasya decided to collect the results of all contests where his favorite coder participated and track the progress of his coolness. For each contest where this coder participated, he wrote out a single non-negative number — the number of points his favorite coder earned in the contest. Vasya wrote out the points for the contest in the order, in which the contests run (naturally, no two contests ran simultaneously).
Vasya considers a coder's performance in a contest amazing in two situations: he can break either his best or his worst performance record. First, it is amazing if during the contest the coder earns strictly more points that he earned on each past contest. Second, it is amazing if during the contest the coder earns strictly less points that he earned on each past contest. A coder's first contest isn't considered amazing. Now he wants to count the number of amazing performances the coder had throughout his whole history of participating in contests. But the list of earned points turned out long and Vasya can't code... That's why he asks you to help him. | The first line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of contests where the coder participated.
The next line contains *n* space-separated non-negative integer numbers — they are the points which the coder has earned. The points are given in the chronological order. All points do not exceed 10000. | Print the single number — the number of amazing performances the coder has had during his whole history of participating in the contests. | [
"5\n100 50 200 150 200\n",
"10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242\n"
] | [
"2\n",
"4\n"
] | In the first sample the performances number 2 and 3 are amazing.
In the second sample the performances number 2, 4, 9 and 10 are amazing. | 500 | [
{
"input": "5\n100 50 200 150 200",
"output": "2"
},
{
"input": "10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242",
"output": "4"
},
{
"input": "1\n6",
"output": "0"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "5\n100 36 53 7 81",
"output": "2"
},
{
"input": "5\n7 36 53 81 100",
"output": "4"
},
{
"input": "5\n100 81 53 36 7",
"output": "4"
},
{
"input": "10\n8 6 3 4 9 10 7 7 1 3",
"output": "5"
},
{
"input": "10\n1627 1675 1488 1390 1812 1137 1746 1324 1952 1862",
"output": "6"
},
{
"input": "10\n1 3 3 4 6 7 7 8 9 10",
"output": "7"
},
{
"input": "10\n1952 1862 1812 1746 1675 1627 1488 1390 1324 1137",
"output": "9"
},
{
"input": "25\n1448 4549 2310 2725 2091 3509 1565 2475 2232 3989 4231 779 2967 2702 608 3739 721 1552 2767 530 3114 665 1940 48 4198",
"output": "5"
},
{
"input": "33\n1097 1132 1091 1104 1049 1038 1023 1080 1104 1029 1035 1061 1049 1060 1088 1106 1105 1087 1063 1076 1054 1103 1047 1041 1028 1120 1126 1063 1117 1110 1044 1093 1101",
"output": "5"
},
{
"input": "34\n821 5536 2491 6074 7216 9885 764 1603 778 8736 8987 771 617 1587 8943 7922 439 7367 4115 8886 7878 6899 8811 5752 3184 3401 9760 9400 8995 4681 1323 6637 6554 6498",
"output": "7"
},
{
"input": "68\n6764 6877 6950 6768 6839 6755 6726 6778 6699 6805 6777 6985 6821 6801 6791 6805 6940 6761 6677 6999 6911 6699 6959 6933 6903 6843 6972 6717 6997 6756 6789 6668 6735 6852 6735 6880 6723 6834 6810 6694 6780 6679 6698 6857 6826 6896 6979 6968 6957 6988 6960 6700 6919 6892 6984 6685 6813 6678 6715 6857 6976 6902 6780 6686 6777 6686 6842 6679",
"output": "9"
},
{
"input": "60\n9000 9014 9034 9081 9131 9162 9174 9199 9202 9220 9221 9223 9229 9235 9251 9260 9268 9269 9270 9298 9307 9309 9313 9323 9386 9399 9407 9495 9497 9529 9531 9544 9614 9615 9627 9627 9643 9654 9656 9657 9685 9699 9701 9736 9745 9758 9799 9827 9843 9845 9854 9854 9885 9891 9896 9913 9942 9963 9986 9992",
"output": "57"
},
{
"input": "100\n7 61 12 52 41 16 34 99 30 44 48 89 31 54 21 1 48 52 61 15 35 87 21 76 64 92 44 81 16 93 84 92 32 15 68 76 53 39 26 4 11 26 7 4 99 99 61 65 55 85 65 67 47 39 2 74 63 49 98 87 5 94 22 30 25 42 31 84 49 23 89 60 16 26 92 27 9 57 75 61 94 35 83 47 99 100 63 24 91 88 79 10 15 45 22 64 3 11 89 83",
"output": "4"
},
{
"input": "100\n9999 9999 9999 9998 9998 9998 9997 9996 9996 9995 9993 9993 9991 9990 9989 9986 9984 9984 9983 9981 9981 9980 9980 9980 9979 9977 9977 9977 9977 9977 9976 9976 9975 9975 9973 9972 9972 9972 9972 9971 9969 9969 9969 9968 9967 9965 9962 9962 9962 9962 9960 9958 9958 9955 9954 9954 9954 9954 9950 9949 9949 9947 9943 9943 9940 9940 9939 9937 9937 9937 9936 9935 9932 9932 9931 9929 9927 9927 9926 9923 9919 9919 9918 9918 9918 9917 9917 9916 9916 9915 9914 9911 9910 9907 9907 9906 9905 9905 9904 9901",
"output": "57"
},
{
"input": "100\n158 159 157 156 155 154 160 153 161 152 162 163 151 164 150 165 149 148 147 166 146 167 145 144 143 142 168 141 169 170 140 139 138 137 171 136 135 134 172 173 174 133 175 132 177 178 131 179 180 130 129 181 128 127 182 126 183 125 124 184 123 122 121 120 119 118 117 185 186 187 188 189 116 190 115 191 192 193 114 113 112 111 110 109 108 194 195 107 106 105 196 197 104 198 199 103 102 200 101 100",
"output": "99"
},
{
"input": "2\n0 10000",
"output": "1"
},
{
"input": "2\n5 5",
"output": "0"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n10 10",
"output": "0"
},
{
"input": "1\n0",
"output": "0"
}
] | 1,684,257,177 | 2,147,483,647 | Python 3 | OK | TESTS | 37 | 92 | 0 | n = int(input())
m = list(map(int, input().split()))
hitler = 0
maxx = m[0]
minn = m[0]
for i in range(1, n):
if m[i] > maxx:
maxx = m[i]
hitler += 1
elif m[i] < minn:
minn = m[i]
hitler += 1
print(hitler)
| Title: I_love_\%username\%
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya adores sport programming. He can't write programs but he loves to watch the contests' progress. Vasya even has a favorite coder and Vasya pays special attention to him.
One day Vasya decided to collect the results of all contests where his favorite coder participated and track the progress of his coolness. For each contest where this coder participated, he wrote out a single non-negative number — the number of points his favorite coder earned in the contest. Vasya wrote out the points for the contest in the order, in which the contests run (naturally, no two contests ran simultaneously).
Vasya considers a coder's performance in a contest amazing in two situations: he can break either his best or his worst performance record. First, it is amazing if during the contest the coder earns strictly more points that he earned on each past contest. Second, it is amazing if during the contest the coder earns strictly less points that he earned on each past contest. A coder's first contest isn't considered amazing. Now he wants to count the number of amazing performances the coder had throughout his whole history of participating in contests. But the list of earned points turned out long and Vasya can't code... That's why he asks you to help him.
Input Specification:
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of contests where the coder participated.
The next line contains *n* space-separated non-negative integer numbers — they are the points which the coder has earned. The points are given in the chronological order. All points do not exceed 10000.
Output Specification:
Print the single number — the number of amazing performances the coder has had during his whole history of participating in the contests.
Demo Input:
['5\n100 50 200 150 200\n', '10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242\n']
Demo Output:
['2\n', '4\n']
Note:
In the first sample the performances number 2 and 3 are amazing.
In the second sample the performances number 2, 4, 9 and 10 are amazing. | ```python
n = int(input())
m = list(map(int, input().split()))
hitler = 0
maxx = m[0]
minn = m[0]
for i in range(1, n):
if m[i] > maxx:
maxx = m[i]
hitler += 1
elif m[i] < minn:
minn = m[i]
hitler += 1
print(hitler)
``` | 3 |
|
581 | A | Vasya the Hipster | PROGRAMMING | 800 | [
"implementation",
"math"
] | null | null | One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks.
According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot.
Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them.
Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Can you help him? | The single line of the input contains two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100) — the number of red and blue socks that Vasya's got. | Print two space-separated integers — the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day. | [
"3 1\n",
"2 3\n",
"7 3\n"
] | [
"1 1\n",
"2 0\n",
"3 2\n"
] | In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day. | 500 | [
{
"input": "3 1",
"output": "1 1"
},
{
"input": "2 3",
"output": "2 0"
},
{
"input": "7 3",
"output": "3 2"
},
{
"input": "100 100",
"output": "100 0"
},
{
"input": "4 10",
"output": "4 3"
},
{
"input": "6 10",
"output": "6 2"
},
{
"input": "6 11",
"output": "6 2"
},
{
"input": "10 40",
"output": "10 15"
},
{
"input": "11 56",
"output": "11 22"
},
{
"input": "34 30",
"output": "30 2"
},
{
"input": "33 33",
"output": "33 0"
},
{
"input": "100 45",
"output": "45 27"
},
{
"input": "100 23",
"output": "23 38"
},
{
"input": "45 12",
"output": "12 16"
},
{
"input": "1 1",
"output": "1 0"
},
{
"input": "1 100",
"output": "1 49"
},
{
"input": "100 1",
"output": "1 49"
},
{
"input": "68 59",
"output": "59 4"
},
{
"input": "45 99",
"output": "45 27"
},
{
"input": "99 100",
"output": "99 0"
},
{
"input": "100 98",
"output": "98 1"
},
{
"input": "59 12",
"output": "12 23"
},
{
"input": "86 4",
"output": "4 41"
},
{
"input": "68 21",
"output": "21 23"
},
{
"input": "100 11",
"output": "11 44"
},
{
"input": "100 10",
"output": "10 45"
},
{
"input": "15 45",
"output": "15 15"
},
{
"input": "11 32",
"output": "11 10"
},
{
"input": "34 96",
"output": "34 31"
},
{
"input": "89 89",
"output": "89 0"
}
] | 1,687,599,843 | 2,147,483,647 | Python 3 | OK | TESTS | 30 | 31 | 0 | a, b = input().split()
a, b = int(a), int(b)
print(f"{min(a, b)} {abs(a-b)//2}") | Title: Vasya the Hipster
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks.
According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot.
Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them.
Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Can you help him?
Input Specification:
The single line of the input contains two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100) — the number of red and blue socks that Vasya's got.
Output Specification:
Print two space-separated integers — the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day.
Demo Input:
['3 1\n', '2 3\n', '7 3\n']
Demo Output:
['1 1\n', '2 0\n', '3 2\n']
Note:
In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day. | ```python
a, b = input().split()
a, b = int(a), int(b)
print(f"{min(a, b)} {abs(a-b)//2}")
``` | 3 |
|
928 | A | Login Verification | PROGRAMMING | 1,200 | [
"*special",
"strings"
] | null | null | When registering in a social network, users are allowed to create their own convenient login to make it easier to share contacts, print it on business cards, etc.
Login is an arbitrary sequence of lower and uppercase latin letters, digits and underline symbols («_»). However, in order to decrease the number of frauds and user-inattention related issues, it is prohibited to register a login if it is similar with an already existing login. More precisely, two logins *s* and *t* are considered similar if we can transform *s* to *t* via a sequence of operations of the following types:
- transform lowercase letters to uppercase and vice versa; - change letter «O» (uppercase latin letter) to digit «0» and vice versa; - change digit «1» (one) to any letter among «l» (lowercase latin «L»), «I» (uppercase latin «i») and vice versa, or change one of these letters to other.
For example, logins «Codeforces» and «codef0rces» as well as «OO0OOO00O0OOO0O00OOO0OO_lol» and «OO0OOO0O00OOO0O00OO0OOO_1oI» are considered similar whereas «Codeforces» and «Code_forces» are not.
You're given a list of existing logins with no two similar amonst and a newly created user login. Check whether this new login is similar with any of the existing ones. | The first line contains a non-empty string *s* consisting of lower and uppercase latin letters, digits and underline symbols («_») with length not exceeding 50 — the login itself.
The second line contains a single integer *n* (1<=≤<=*n*<=≤<=1<=000) — the number of existing logins.
The next *n* lines describe the existing logins, following the same constraints as the user login (refer to the first line of the input). It's guaranteed that no two existing logins are similar. | Print «Yes» (without quotes), if user can register via this login, i.e. none of the existing logins is similar with it.
Otherwise print «No» (without quotes). | [
"1_wat\n2\n2_wat\nwat_1\n",
"000\n3\n00\nooA\noOo\n",
"_i_\n3\n__i_\n_1_\nI\n",
"La0\n3\n2a0\nLa1\n1a0\n",
"abc\n1\naBc\n",
"0Lil\n2\nLIL0\n0Ril\n"
] | [
"Yes\n",
"No\n",
"No\n",
"No\n",
"No\n",
"Yes\n"
] | In the second sample case the user wants to create a login consisting of three zeros. It's impossible due to collision with the third among the existing.
In the third sample case the new login is similar with the second one. | 500 | [
{
"input": "1_wat\n2\n2_wat\nwat_1",
"output": "Yes"
},
{
"input": "000\n3\n00\nooA\noOo",
"output": "No"
},
{
"input": "_i_\n3\n__i_\n_1_\nI",
"output": "No"
},
{
"input": "La0\n3\n2a0\nLa1\n1a0",
"output": "No"
},
{
"input": "abc\n1\naBc",
"output": "No"
},
{
"input": "0Lil\n2\nLIL0\n0Ril",
"output": "Yes"
},
{
"input": "iloO\n3\niIl0\noIl0\nIooO",
"output": "Yes"
},
{
"input": "L1il0o1L1\n5\niLLoLL\noOI1Io10il\nIoLLoO\nO01ilOoI\nI10l0o",
"output": "Yes"
},
{
"input": "ELioO1lOoOIOiLoooi1iolul1O\n7\nOoEIuOIl1ui1010uiooOoi0Oio001L0EoEolO0\nOLIoOEuoE11u1u1iLOI0oO\nuEOuO0uIOOlO01OlEI0E1Oo0IO1LI0uE0LILO0\nEOo0Il11iIOOOIiuOiIiiLOLEOOII001EE\niOoO0LOulioE0OLIIIulli01OoiuOOOoOlEiI0EiiElIIu0\nlE1LOE1Oil\n1u0EOliIiIOl1u110il0l1O0u",
"output": "Yes"
},
{
"input": "0blo7X\n20\n1oobb6\nXIXIO2X\n2iYI2\n607XXol\n2I6io22\nOl10I\nbXX0Lo\nolOOb7X\n07LlXL\nlXY17\n12iIX2\n7lL70\nbOo11\n17Y6b62\n0O6L7\n1lX2L\n2iYl6lI\n7bXIi1o\niLIY2\n0OIo1X",
"output": "Yes"
},
{
"input": "lkUL\n25\nIIfL\nokl\nfoo\ni0U\noko\niIoU\nUUv\nvli\nv0Uk\n0Of\niill\n1vkl\nUIf\nUfOO\nlvLO\nUUo0\nIOf1\nlovL\nIkk\noIv\nLvfU\n0UI\nkol\n1OO0\n1OOi",
"output": "Yes"
},
{
"input": "L1lo\n3\nOOo1\nL1lo\n0lOl",
"output": "No"
},
{
"input": "LIoooiLO\n5\nLIoooiLO\nl0o01I00\n0OOl0lLO01\nil10i0\noiloi",
"output": "No"
},
{
"input": "1i1lQI\n7\nuLg1uLLigIiOLoggu\nLLLgIuQIQIIloiQuIIoIO0l0o000\n0u1LQu11oIuooIl0OooLg0i0IQu1O1lloI1\nQuQgIQi0LOIliLOuuuioLQou1l\nlLIO00QLi01LogOliOIggII1\no0Ll1uIOQl10IL0IILQ\n1i1lQI",
"output": "No"
},
{
"input": "oIzz1\n20\n1TTl0O\nloF0LT\n1lLzo\noi0Ov\nFlIF1zT\nzoITzx\n0TIFlT\nl1vllil\nOviix1F\nLFvI1lL\nLIl0loz\nixz1v\n1i1vFi\nTIFTol\noIzz1\nIvTl0o\nxv1U0O\niiiioF\n1oiLUlO\nxToxv1",
"output": "No"
},
{
"input": "00L0\n25\n0il\nIlkZ\nL0I\n00L0\nBd0\nZLd\n0d1k\nddk\nIdl\nkBd\nkBOL\nZ1lI\nkBL\nLOko\noZ0i\nZ1lO\nLiOk\niBld\nLO0d\ndIo\nZ10\n1k1i\n0o0L\nIoBd\ni0B0",
"output": "No"
},
{
"input": "Z\n1\nz",
"output": "No"
},
{
"input": "0\n1\no",
"output": "No"
},
{
"input": "0\n1\nO",
"output": "No"
},
{
"input": "o\n1\n0",
"output": "No"
},
{
"input": "o\n1\nO",
"output": "No"
},
{
"input": "o\n1\no",
"output": "No"
},
{
"input": "O\n1\no",
"output": "No"
},
{
"input": "O\n1\n0",
"output": "No"
},
{
"input": "1\n1\nl",
"output": "No"
},
{
"input": "1\n1\nL",
"output": "No"
},
{
"input": "1\n1\ni",
"output": "No"
},
{
"input": "1\n1\nI",
"output": "No"
},
{
"input": "1\n1\no",
"output": "Yes"
},
{
"input": "i\n1\n1",
"output": "No"
},
{
"input": "i\n1\nL",
"output": "No"
},
{
"input": "i\n1\nl",
"output": "No"
},
{
"input": "I\n1\nL",
"output": "No"
},
{
"input": "I\n1\nl",
"output": "No"
},
{
"input": "I\n1\n1",
"output": "No"
},
{
"input": "l\n1\n1",
"output": "No"
},
{
"input": "l\n1\nL",
"output": "No"
},
{
"input": "l\n1\ni",
"output": "No"
},
{
"input": "l\n1\nI",
"output": "No"
},
{
"input": "L\n1\nl",
"output": "No"
},
{
"input": "L\n1\n1",
"output": "No"
},
{
"input": "L\n1\ni",
"output": "No"
},
{
"input": "L\n1\nI",
"output": "No"
}
] | 1,519,504,403 | 17,903 | Python 3 | WRONG_ANSWER | PRETESTS | 0 | 46 | 5,632,000 | import sys
counter = 0
checker = 0 | Title: Login Verification
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
When registering in a social network, users are allowed to create their own convenient login to make it easier to share contacts, print it on business cards, etc.
Login is an arbitrary sequence of lower and uppercase latin letters, digits and underline symbols («_»). However, in order to decrease the number of frauds and user-inattention related issues, it is prohibited to register a login if it is similar with an already existing login. More precisely, two logins *s* and *t* are considered similar if we can transform *s* to *t* via a sequence of operations of the following types:
- transform lowercase letters to uppercase and vice versa; - change letter «O» (uppercase latin letter) to digit «0» and vice versa; - change digit «1» (one) to any letter among «l» (lowercase latin «L»), «I» (uppercase latin «i») and vice versa, or change one of these letters to other.
For example, logins «Codeforces» and «codef0rces» as well as «OO0OOO00O0OOO0O00OOO0OO_lol» and «OO0OOO0O00OOO0O00OO0OOO_1oI» are considered similar whereas «Codeforces» and «Code_forces» are not.
You're given a list of existing logins with no two similar amonst and a newly created user login. Check whether this new login is similar with any of the existing ones.
Input Specification:
The first line contains a non-empty string *s* consisting of lower and uppercase latin letters, digits and underline symbols («_») with length not exceeding 50 — the login itself.
The second line contains a single integer *n* (1<=≤<=*n*<=≤<=1<=000) — the number of existing logins.
The next *n* lines describe the existing logins, following the same constraints as the user login (refer to the first line of the input). It's guaranteed that no two existing logins are similar.
Output Specification:
Print «Yes» (without quotes), if user can register via this login, i.e. none of the existing logins is similar with it.
Otherwise print «No» (without quotes).
Demo Input:
['1_wat\n2\n2_wat\nwat_1\n', '000\n3\n00\nooA\noOo\n', '_i_\n3\n__i_\n_1_\nI\n', 'La0\n3\n2a0\nLa1\n1a0\n', 'abc\n1\naBc\n', '0Lil\n2\nLIL0\n0Ril\n']
Demo Output:
['Yes\n', 'No\n', 'No\n', 'No\n', 'No\n', 'Yes\n']
Note:
In the second sample case the user wants to create a login consisting of three zeros. It's impossible due to collision with the third among the existing.
In the third sample case the new login is similar with the second one. | ```python
import sys
counter = 0
checker = 0
``` | 0 |
|
202 | A | LLPS | PROGRAMMING | 800 | [
"binary search",
"bitmasks",
"brute force",
"greedy",
"implementation",
"strings"
] | null | null | This problem's actual name, "Lexicographically Largest Palindromic Subsequence" is too long to fit into the page headline.
You are given string *s* consisting of lowercase English letters only. Find its lexicographically largest palindromic subsequence.
We'll call a non-empty string *s*[*p*1*p*2... *p**k*] = *s**p*1*s**p*2... *s**p**k* (1 <=≤<= *p*1<=<<=*p*2<=<<=...<=<<=*p**k* <=≤<= |*s*|) a subsequence of string *s* = *s*1*s*2... *s*|*s*|, where |*s*| is the length of string *s*. For example, strings "abcb", "b" and "abacaba" are subsequences of string "abacaba".
String *x* = *x*1*x*2... *x*|*x*| is lexicographically larger than string *y* = *y*1*y*2... *y*|*y*| if either |*x*| > |*y*| and *x*1<==<=*y*1, *x*2<==<=*y*2, ...,<=*x*|*y*|<==<=*y*|*y*|, or there exists such number *r* (*r*<=<<=|*x*|, *r*<=<<=|*y*|) that *x*1<==<=*y*1, *x*2<==<=*y*2, ..., *x**r*<==<=*y**r* and *x**r*<=<=+<=<=1<=><=*y**r*<=<=+<=<=1. Characters in the strings are compared according to their ASCII codes. For example, string "ranger" is lexicographically larger than string "racecar" and string "poster" is lexicographically larger than string "post".
String *s* = *s*1*s*2... *s*|*s*| is a palindrome if it matches string *rev*(*s*) = *s*|*s*|*s*|*s*|<=-<=1... *s*1. In other words, a string is a palindrome if it reads the same way from left to right and from right to left. For example, palindromic strings are "racecar", "refer" and "z". | The only input line contains a non-empty string *s* consisting of lowercase English letters only. Its length does not exceed 10. | Print the lexicographically largest palindromic subsequence of string *s*. | [
"radar\n",
"bowwowwow\n",
"codeforces\n",
"mississipp\n"
] | [
"rr\n",
"wwwww\n",
"s\n",
"ssss\n"
] | Among all distinct subsequences of string "radar" the following ones are palindromes: "a", "d", "r", "aa", "rr", "ada", "rar", "rdr", "raar" and "radar". The lexicographically largest of them is "rr". | 500 | [
{
"input": "radar",
"output": "rr"
},
{
"input": "bowwowwow",
"output": "wwwww"
},
{
"input": "codeforces",
"output": "s"
},
{
"input": "mississipp",
"output": "ssss"
},
{
"input": "tourist",
"output": "u"
},
{
"input": "romka",
"output": "r"
},
{
"input": "helloworld",
"output": "w"
},
{
"input": "zzzzzzzazz",
"output": "zzzzzzzzz"
},
{
"input": "testcase",
"output": "tt"
},
{
"input": "hahahahaha",
"output": "hhhhh"
},
{
"input": "abbbbbbbbb",
"output": "bbbbbbbbb"
},
{
"input": "zaz",
"output": "zz"
},
{
"input": "aza",
"output": "z"
},
{
"input": "dcbaedcba",
"output": "e"
},
{
"input": "abcdeabcd",
"output": "e"
},
{
"input": "edcbabcde",
"output": "ee"
},
{
"input": "aaaaaaaaab",
"output": "b"
},
{
"input": "testzzzzzz",
"output": "zzzzzz"
},
{
"input": "zzzzzzwait",
"output": "zzzzzz"
},
{
"input": "rrrrrqponm",
"output": "rrrrr"
},
{
"input": "zzyzyy",
"output": "zzz"
},
{
"input": "aababb",
"output": "bbb"
},
{
"input": "zanzibar",
"output": "zz"
},
{
"input": "hhgfedcbaa",
"output": "hh"
},
{
"input": "aabcdefghh",
"output": "hh"
},
{
"input": "aruaru",
"output": "uu"
},
{
"input": "uraura",
"output": "uu"
},
{
"input": "aru",
"output": "u"
},
{
"input": "aburvabur",
"output": "v"
},
{
"input": "ura",
"output": "u"
},
{
"input": "eurottat",
"output": "u"
},
{
"input": "referee",
"output": "rr"
},
{
"input": "joking",
"output": "o"
},
{
"input": "seriously",
"output": "y"
},
{
"input": "sets",
"output": "t"
},
{
"input": "test",
"output": "tt"
},
{
"input": "klmgameklm",
"output": "mmm"
},
{
"input": "dfkjafdkdd",
"output": "kk"
},
{
"input": "zzzzzzzzzz",
"output": "zzzzzzzzzz"
},
{
"input": "aaaaaaaaaa",
"output": "aaaaaaaaaa"
},
{
"input": "buzz",
"output": "zz"
},
{
"input": "b",
"output": "b"
},
{
"input": "y",
"output": "y"
},
{
"input": "yy",
"output": "yy"
},
{
"input": "zz",
"output": "zz"
},
{
"input": "bb",
"output": "bb"
},
{
"input": "aa",
"output": "aa"
},
{
"input": "a",
"output": "a"
},
{
"input": "z",
"output": "z"
},
{
"input": "zz",
"output": "zz"
},
{
"input": "zzazazzzaz",
"output": "zzzzzzz"
},
{
"input": "hellhellhe",
"output": "llll"
},
{
"input": "hellohello",
"output": "oo"
},
{
"input": "refer",
"output": "rr"
}
] | 1,622,905,654 | 2,147,483,647 | PyPy 3 | OK | TESTS | 54 | 466 | 2,252,800 | from sys import *
import sys
from math import *
from collections import *
import string
import re
from bisect import *
from functools import reduce
from itertools import permutations, combinations
# import numpy as np
# def arr(): return np.random.randint(1,50,5)
t=stdin.readline
R=range
p=stdout.write
mod = int(1e9)+7
MAX = 9223372036854775808
lower = string.ascii_lowercase
upper = string.ascii_uppercase
numbers = string.digits
def S(): return t().strip()
def I(): return int(t())
def GI(): return map(int, input().strip().split())
def GS(): return map(str, t().strip().split())
def IL(): return list(map(int, t().strip().split()))
def SL(): return list(map(str, t().strip().split()))
def mat(n): return [IL() for i in range(n)]
def sieve(n): return reduce(lambda r, x: r - set(range(x**2, n, x)) if x in r else r,
range(2, int(n**0.5) + 1), set(range(2,n)))
def iSq(x): return (ceil(float(sqrt(x))) == floor(float(sqrt(x))))
def ispow2(x): return ((x!=0) and (x&(x-1))==0)
def d2b(n):return bin(n).replace("0b", "")
def ls(x,y): return x<<y # adding '0' y bits from right and removing last y bits from left i.e floor(x/pow(2,y))
def rs(x,y): return x<<y # adding '0' y bits from left and removing first y bits from right i.e x*pow(2,y)
def powof2(x): return 1<<x
s=sorted(S())[::-1]
prev = s[0]
for i in s:
if prev==i: print(i,end='')
else: break
prev=i | Title: LLPS
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
This problem's actual name, "Lexicographically Largest Palindromic Subsequence" is too long to fit into the page headline.
You are given string *s* consisting of lowercase English letters only. Find its lexicographically largest palindromic subsequence.
We'll call a non-empty string *s*[*p*1*p*2... *p**k*] = *s**p*1*s**p*2... *s**p**k* (1 <=≤<= *p*1<=<<=*p*2<=<<=...<=<<=*p**k* <=≤<= |*s*|) a subsequence of string *s* = *s*1*s*2... *s*|*s*|, where |*s*| is the length of string *s*. For example, strings "abcb", "b" and "abacaba" are subsequences of string "abacaba".
String *x* = *x*1*x*2... *x*|*x*| is lexicographically larger than string *y* = *y*1*y*2... *y*|*y*| if either |*x*| > |*y*| and *x*1<==<=*y*1, *x*2<==<=*y*2, ...,<=*x*|*y*|<==<=*y*|*y*|, or there exists such number *r* (*r*<=<<=|*x*|, *r*<=<<=|*y*|) that *x*1<==<=*y*1, *x*2<==<=*y*2, ..., *x**r*<==<=*y**r* and *x**r*<=<=+<=<=1<=><=*y**r*<=<=+<=<=1. Characters in the strings are compared according to their ASCII codes. For example, string "ranger" is lexicographically larger than string "racecar" and string "poster" is lexicographically larger than string "post".
String *s* = *s*1*s*2... *s*|*s*| is a palindrome if it matches string *rev*(*s*) = *s*|*s*|*s*|*s*|<=-<=1... *s*1. In other words, a string is a palindrome if it reads the same way from left to right and from right to left. For example, palindromic strings are "racecar", "refer" and "z".
Input Specification:
The only input line contains a non-empty string *s* consisting of lowercase English letters only. Its length does not exceed 10.
Output Specification:
Print the lexicographically largest palindromic subsequence of string *s*.
Demo Input:
['radar\n', 'bowwowwow\n', 'codeforces\n', 'mississipp\n']
Demo Output:
['rr\n', 'wwwww\n', 's\n', 'ssss\n']
Note:
Among all distinct subsequences of string "radar" the following ones are palindromes: "a", "d", "r", "aa", "rr", "ada", "rar", "rdr", "raar" and "radar". The lexicographically largest of them is "rr". | ```python
from sys import *
import sys
from math import *
from collections import *
import string
import re
from bisect import *
from functools import reduce
from itertools import permutations, combinations
# import numpy as np
# def arr(): return np.random.randint(1,50,5)
t=stdin.readline
R=range
p=stdout.write
mod = int(1e9)+7
MAX = 9223372036854775808
lower = string.ascii_lowercase
upper = string.ascii_uppercase
numbers = string.digits
def S(): return t().strip()
def I(): return int(t())
def GI(): return map(int, input().strip().split())
def GS(): return map(str, t().strip().split())
def IL(): return list(map(int, t().strip().split()))
def SL(): return list(map(str, t().strip().split()))
def mat(n): return [IL() for i in range(n)]
def sieve(n): return reduce(lambda r, x: r - set(range(x**2, n, x)) if x in r else r,
range(2, int(n**0.5) + 1), set(range(2,n)))
def iSq(x): return (ceil(float(sqrt(x))) == floor(float(sqrt(x))))
def ispow2(x): return ((x!=0) and (x&(x-1))==0)
def d2b(n):return bin(n).replace("0b", "")
def ls(x,y): return x<<y # adding '0' y bits from right and removing last y bits from left i.e floor(x/pow(2,y))
def rs(x,y): return x<<y # adding '0' y bits from left and removing first y bits from right i.e x*pow(2,y)
def powof2(x): return 1<<x
s=sorted(S())[::-1]
prev = s[0]
for i in s:
if prev==i: print(i,end='')
else: break
prev=i
``` | 3 |
|
546 | A | Soldier and Bananas | PROGRAMMING | 800 | [
"brute force",
"implementation",
"math"
] | null | null | A soldier wants to buy *w* bananas in the shop. He has to pay *k* dollars for the first banana, 2*k* dollars for the second one and so on (in other words, he has to pay *i*·*k* dollars for the *i*-th banana).
He has *n* dollars. How many dollars does he have to borrow from his friend soldier to buy *w* bananas? | The first line contains three positive integers *k*,<=*n*,<=*w* (1<=<=≤<=<=*k*,<=*w*<=<=≤<=<=1000, 0<=≤<=*n*<=≤<=109), the cost of the first banana, initial number of dollars the soldier has and number of bananas he wants. | Output one integer — the amount of dollars that the soldier must borrow from his friend. If he doesn't have to borrow money, output 0. | [
"3 17 4\n"
] | [
"13"
] | none | 500 | [
{
"input": "3 17 4",
"output": "13"
},
{
"input": "1 2 1",
"output": "0"
},
{
"input": "1 1 1",
"output": "0"
},
{
"input": "1 5 6",
"output": "16"
},
{
"input": "1 1000000000 1",
"output": "0"
},
{
"input": "1000 0 1000",
"output": "500500000"
},
{
"input": "859 453892 543",
"output": "126416972"
},
{
"input": "1000 1000000000 1000",
"output": "0"
},
{
"input": "1000 500500000 1000",
"output": "0"
},
{
"input": "1000 500500001 1000",
"output": "0"
},
{
"input": "1000 500499999 1000",
"output": "1"
},
{
"input": "634 87973 214",
"output": "14497197"
},
{
"input": "432 10000 241",
"output": "12587552"
},
{
"input": "111 111111111 111",
"output": "0"
},
{
"input": "20 43 3",
"output": "77"
}
] | 1,696,262,388 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 1 | 46 | 0 | k, n, w = list(map(int, input().split()))
ans = [3 for i in range(w + 1)]
for i in range(1, w + 1):
ans[i] = ans[i] * i
print(sum(ans) - n - ans[0])
| Title: Soldier and Bananas
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A soldier wants to buy *w* bananas in the shop. He has to pay *k* dollars for the first banana, 2*k* dollars for the second one and so on (in other words, he has to pay *i*·*k* dollars for the *i*-th banana).
He has *n* dollars. How many dollars does he have to borrow from his friend soldier to buy *w* bananas?
Input Specification:
The first line contains three positive integers *k*,<=*n*,<=*w* (1<=<=≤<=<=*k*,<=*w*<=<=≤<=<=1000, 0<=≤<=*n*<=≤<=109), the cost of the first banana, initial number of dollars the soldier has and number of bananas he wants.
Output Specification:
Output one integer — the amount of dollars that the soldier must borrow from his friend. If he doesn't have to borrow money, output 0.
Demo Input:
['3 17 4\n']
Demo Output:
['13']
Note:
none | ```python
k, n, w = list(map(int, input().split()))
ans = [3 for i in range(w + 1)]
for i in range(1, w + 1):
ans[i] = ans[i] * i
print(sum(ans) - n - ans[0])
``` | 0 |
|
581 | A | Vasya the Hipster | PROGRAMMING | 800 | [
"implementation",
"math"
] | null | null | One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks.
According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot.
Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them.
Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Can you help him? | The single line of the input contains two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100) — the number of red and blue socks that Vasya's got. | Print two space-separated integers — the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day. | [
"3 1\n",
"2 3\n",
"7 3\n"
] | [
"1 1\n",
"2 0\n",
"3 2\n"
] | In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day. | 500 | [
{
"input": "3 1",
"output": "1 1"
},
{
"input": "2 3",
"output": "2 0"
},
{
"input": "7 3",
"output": "3 2"
},
{
"input": "100 100",
"output": "100 0"
},
{
"input": "4 10",
"output": "4 3"
},
{
"input": "6 10",
"output": "6 2"
},
{
"input": "6 11",
"output": "6 2"
},
{
"input": "10 40",
"output": "10 15"
},
{
"input": "11 56",
"output": "11 22"
},
{
"input": "34 30",
"output": "30 2"
},
{
"input": "33 33",
"output": "33 0"
},
{
"input": "100 45",
"output": "45 27"
},
{
"input": "100 23",
"output": "23 38"
},
{
"input": "45 12",
"output": "12 16"
},
{
"input": "1 1",
"output": "1 0"
},
{
"input": "1 100",
"output": "1 49"
},
{
"input": "100 1",
"output": "1 49"
},
{
"input": "68 59",
"output": "59 4"
},
{
"input": "45 99",
"output": "45 27"
},
{
"input": "99 100",
"output": "99 0"
},
{
"input": "100 98",
"output": "98 1"
},
{
"input": "59 12",
"output": "12 23"
},
{
"input": "86 4",
"output": "4 41"
},
{
"input": "68 21",
"output": "21 23"
},
{
"input": "100 11",
"output": "11 44"
},
{
"input": "100 10",
"output": "10 45"
},
{
"input": "15 45",
"output": "15 15"
},
{
"input": "11 32",
"output": "11 10"
},
{
"input": "34 96",
"output": "34 31"
},
{
"input": "89 89",
"output": "89 0"
}
] | 1,697,625,577 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 15 | 0 | def vasyahisper(a, b):
p = min(a, b)
s = ((a - p) // 2) + ((b - p) // 2)
print(f'{p} {s}')
vasyahisper(int(input()), int(input()))
| Title: Vasya the Hipster
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks.
According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot.
Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them.
Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Can you help him?
Input Specification:
The single line of the input contains two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100) — the number of red and blue socks that Vasya's got.
Output Specification:
Print two space-separated integers — the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day.
Demo Input:
['3 1\n', '2 3\n', '7 3\n']
Demo Output:
['1 1\n', '2 0\n', '3 2\n']
Note:
In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day. | ```python
def vasyahisper(a, b):
p = min(a, b)
s = ((a - p) // 2) + ((b - p) // 2)
print(f'{p} {s}')
vasyahisper(int(input()), int(input()))
``` | -1 |
|
339 | A | Helpful Maths | PROGRAMMING | 800 | [
"greedy",
"implementation",
"sortings",
"strings"
] | null | null | Xenia the beginner mathematician is a third year student at elementary school. She is now learning the addition operation.
The teacher has written down the sum of multiple numbers. Pupils should calculate the sum. To make the calculation easier, the sum only contains numbers 1, 2 and 3. Still, that isn't enough for Xenia. She is only beginning to count, so she can calculate a sum only if the summands follow in non-decreasing order. For example, she can't calculate sum 1+3+2+1 but she can calculate sums 1+1+2 and 3+3.
You've got the sum that was written on the board. Rearrange the summans and print the sum in such a way that Xenia can calculate the sum. | The first line contains a non-empty string *s* — the sum Xenia needs to count. String *s* contains no spaces. It only contains digits and characters "+". Besides, string *s* is a correct sum of numbers 1, 2 and 3. String *s* is at most 100 characters long. | Print the new sum that Xenia can count. | [
"3+2+1\n",
"1+1+3+1+3\n",
"2\n"
] | [
"1+2+3\n",
"1+1+1+3+3\n",
"2\n"
] | none | 500 | [
{
"input": "3+2+1",
"output": "1+2+3"
},
{
"input": "1+1+3+1+3",
"output": "1+1+1+3+3"
},
{
"input": "2",
"output": "2"
},
{
"input": "2+2+1+1+3",
"output": "1+1+2+2+3"
},
{
"input": "2+1+2+2+2+3+1+3+1+2",
"output": "1+1+1+2+2+2+2+2+3+3"
},
{
"input": "1+2+1+2+2+2+2+1+3+3",
"output": "1+1+1+2+2+2+2+2+3+3"
},
{
"input": "2+3+3+1+2+2+2+1+1+2+1+3+2+2+3+3+2+2+3+3+3+1+1+1+3+3+3+2+1+3+2+3+2+1+1+3+3+3+1+2+2+1+2+2+1+2+1+3+1+1",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "1",
"output": "1"
},
{
"input": "2+1+2+2+1+3+2+3+1+1+2+1+2+2+3+1+1+3+3+3+2+2+3+2+2+2+1+2+1+2+3+2+2+2+1+3+1+3+3+3+1+2+1+2+2+2+2+3+1+1",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "2+2+1+1+1+3+1+1+3+3+2+3+1+3+1+1+3+1+1+2+2+2+2+1+2+1+2+1+1+1+3+1+3+2+3+2+3+3+1+1+1+2+3+2+1+3+1+3+2+2",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "3+2+3+3+2+2+1+2+1+2+3+1+2+3+2+3+2+1+2+2+1+1+2+2+3+2+1+3+1+1+3+2+2+2+2+3+3+2+2+3+3+1+1+2+3+3+2+3+3+3",
"output": "1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "3",
"output": "3"
},
{
"input": "1+1",
"output": "1+1"
},
{
"input": "1+2",
"output": "1+2"
},
{
"input": "1+3",
"output": "1+3"
},
{
"input": "2+1",
"output": "1+2"
},
{
"input": "2+2",
"output": "2+2"
},
{
"input": "2+3",
"output": "2+3"
},
{
"input": "3+1",
"output": "1+3"
},
{
"input": "3+2",
"output": "2+3"
},
{
"input": "3+3",
"output": "3+3"
}
] | 1,695,137,693 | 2,147,483,647 | Python 3 | OK | TESTS | 21 | 92 | 0 | s = str(input())
s1 = s.split('+')
print('+'.join(sorted(s1))) | Title: Helpful Maths
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Xenia the beginner mathematician is a third year student at elementary school. She is now learning the addition operation.
The teacher has written down the sum of multiple numbers. Pupils should calculate the sum. To make the calculation easier, the sum only contains numbers 1, 2 and 3. Still, that isn't enough for Xenia. She is only beginning to count, so she can calculate a sum only if the summands follow in non-decreasing order. For example, she can't calculate sum 1+3+2+1 but she can calculate sums 1+1+2 and 3+3.
You've got the sum that was written on the board. Rearrange the summans and print the sum in such a way that Xenia can calculate the sum.
Input Specification:
The first line contains a non-empty string *s* — the sum Xenia needs to count. String *s* contains no spaces. It only contains digits and characters "+". Besides, string *s* is a correct sum of numbers 1, 2 and 3. String *s* is at most 100 characters long.
Output Specification:
Print the new sum that Xenia can count.
Demo Input:
['3+2+1\n', '1+1+3+1+3\n', '2\n']
Demo Output:
['1+2+3\n', '1+1+1+3+3\n', '2\n']
Note:
none | ```python
s = str(input())
s1 = s.split('+')
print('+'.join(sorted(s1)))
``` | 3 |
|
231 | A | Team | PROGRAMMING | 800 | [
"brute force",
"greedy"
] | null | null | One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution.
This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution. | The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces. | Print a single integer — the number of problems the friends will implement on the contest. | [
"3\n1 1 0\n1 1 1\n1 0 0\n",
"2\n1 0 0\n0 1 1\n"
] | [
"2\n",
"1\n"
] | In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it.
In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution. | 500 | [
{
"input": "3\n1 1 0\n1 1 1\n1 0 0",
"output": "2"
},
{
"input": "2\n1 0 0\n0 1 1",
"output": "1"
},
{
"input": "1\n1 0 0",
"output": "0"
},
{
"input": "2\n1 0 0\n1 1 1",
"output": "1"
},
{
"input": "5\n1 0 0\n0 1 0\n1 1 1\n0 0 1\n0 0 0",
"output": "1"
},
{
"input": "10\n0 1 0\n0 1 0\n1 1 0\n1 0 0\n0 0 1\n0 1 1\n1 1 1\n1 1 0\n0 0 0\n0 0 0",
"output": "4"
},
{
"input": "15\n0 1 0\n1 0 0\n1 1 0\n1 1 1\n0 1 0\n0 0 1\n1 0 1\n1 0 1\n1 0 1\n0 0 0\n1 1 1\n1 1 0\n0 1 1\n1 1 0\n1 1 1",
"output": "10"
},
{
"input": "50\n0 0 0\n0 1 1\n1 1 1\n0 1 0\n1 0 1\n1 1 1\n0 0 1\n1 0 0\n1 1 0\n1 0 1\n0 1 0\n0 0 1\n1 1 0\n0 1 0\n1 1 0\n0 0 0\n1 1 1\n1 0 1\n0 0 1\n1 1 0\n1 1 1\n0 1 1\n1 1 0\n0 0 0\n0 0 0\n1 1 1\n0 0 0\n1 1 1\n0 1 1\n0 0 1\n0 0 0\n0 0 0\n1 1 0\n1 1 0\n1 0 1\n1 0 0\n1 0 1\n1 0 1\n0 1 1\n1 1 0\n1 1 0\n0 1 0\n1 0 1\n0 0 0\n0 0 0\n0 0 0\n0 0 1\n1 1 1\n0 1 1\n1 0 1",
"output": "29"
},
{
"input": "1\n1 1 1",
"output": "1"
},
{
"input": "8\n0 0 0\n0 0 1\n0 0 0\n0 1 1\n1 0 0\n1 0 1\n1 1 0\n1 1 1",
"output": "4"
},
{
"input": "16\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1",
"output": "16"
}
] | 1,697,995,058 | 2,147,483,647 | Python 3 | OK | TESTS | 21 | 92 | 0 | #!/usr/bin/python3
n = int(input())
votes = []
for i in range(n):
a, b, c = [int(char) for char in input().split(" ")]
if sum([a, b, c]) >= 2:
votes.append(1)
print(len(votes))
| Title: Team
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution.
This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution.
Input Specification:
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces.
Output Specification:
Print a single integer — the number of problems the friends will implement on the contest.
Demo Input:
['3\n1 1 0\n1 1 1\n1 0 0\n', '2\n1 0 0\n0 1 1\n']
Demo Output:
['2\n', '1\n']
Note:
In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it.
In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution. | ```python
#!/usr/bin/python3
n = int(input())
votes = []
for i in range(n):
a, b, c = [int(char) for char in input().split(" ")]
if sum([a, b, c]) >= 2:
votes.append(1)
print(len(votes))
``` | 3 |
|
686 | A | Free Ice Cream | PROGRAMMING | 800 | [
"constructive algorithms",
"implementation"
] | null | null | After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer.
At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue).
If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress.
Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids. | The first line contains two space-separated integers *n* and *x* (1<=≤<=*n*<=≤<=1000, 0<=≤<=*x*<=≤<=109).
Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=≤<=*d**i*<=≤<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place. | Print two space-separated integers — number of ice cream packs left after all operations, and number of kids that left the house in distress. | [
"5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n",
"5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n"
] | [
"22 1\n",
"3 2\n"
] | Consider the first sample.
1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining. | 500 | [
{
"input": "5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20",
"output": "22 1"
},
{
"input": "5 17\n- 16\n- 2\n- 98\n+ 100\n- 98",
"output": "3 2"
},
{
"input": "6 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000\n+ 1000000000",
"output": "7000000000 0"
},
{
"input": "5 12\n- 12\n+ 7\n- 6\n- 1\n+ 46",
"output": "46 0"
},
{
"input": "11 1000\n- 100\n+ 100\n+ 100\n+ 100\n+ 100\n- 100\n- 100\n- 100\n- 100\n- 100\n- 100",
"output": "700 0"
},
{
"input": "1 0\n- 526403222",
"output": "0 1"
},
{
"input": "1 897986543\n- 371188251",
"output": "526798292 0"
},
{
"input": "1 0\n+ 1",
"output": "1 0"
},
{
"input": "1 0\n- 1",
"output": "0 1"
},
{
"input": "1 10\n+ 10",
"output": "20 0"
},
{
"input": "1 3\n- 5",
"output": "3 1"
},
{
"input": "1 0\n- 5",
"output": "0 1"
},
{
"input": "1 0\n+ 5",
"output": "5 0"
}
] | 1,675,424,104 | 2,147,483,647 | Python 3 | OK | TESTS | 34 | 46 | 0 | x = list(map(int, input().split()))
s = 0
for i in range(x[0]):
y = list(map(str, input().split()))
y[1] = int(y[1])
if y[0] == '+':
x[1] = x[1] + y[1]
elif y[0] == '-':
if x[1] >= y[1]:
x[1] = x[1] - y[1]
else:
s = s+1
m = [str(x[1]),str(s)]
z = ' '.join(m)
print(z) | Title: Free Ice Cream
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
After their adventure with the magic mirror Kay and Gerda have returned home and sometimes give free ice cream to kids in the summer.
At the start of the day they have *x* ice cream packs. Since the ice cream is free, people start standing in the queue before Kay and Gerda's house even in the night. Each person in the queue wants either to take several ice cream packs for himself and his friends or to give several ice cream packs to Kay and Gerda (carriers that bring ice cream have to stand in the same queue).
If a carrier with *d* ice cream packs comes to the house, then Kay and Gerda take all his packs. If a child who wants to take *d* ice cream packs comes to the house, then Kay and Gerda will give him *d* packs if they have enough ice cream, otherwise the child will get no ice cream at all and will leave in distress.
Kay wants to find the amount of ice cream they will have after all people will leave from the queue, and Gerda wants to find the number of distressed kids.
Input Specification:
The first line contains two space-separated integers *n* and *x* (1<=≤<=*n*<=≤<=1000, 0<=≤<=*x*<=≤<=109).
Each of the next *n* lines contains a character '+' or '-', and an integer *d**i*, separated by a space (1<=≤<=*d**i*<=≤<=109). Record "+ *d**i*" in *i*-th line means that a carrier with *d**i* ice cream packs occupies *i*-th place from the start of the queue, and record "- *d**i*" means that a child who wants to take *d**i* packs stands in *i*-th place.
Output Specification:
Print two space-separated integers — number of ice cream packs left after all operations, and number of kids that left the house in distress.
Demo Input:
['5 7\n+ 5\n- 10\n- 20\n+ 40\n- 20\n', '5 17\n- 16\n- 2\n- 98\n+ 100\n- 98\n']
Demo Output:
['22 1\n', '3 2\n']
Note:
Consider the first sample.
1. Initially Kay and Gerda have 7 packs of ice cream. 1. Carrier brings 5 more, so now they have 12 packs. 1. A kid asks for 10 packs and receives them. There are only 2 packs remaining. 1. Another kid asks for 20 packs. Kay and Gerda do not have them, so the kid goes away distressed. 1. Carrier bring 40 packs, now Kay and Gerda have 42 packs. 1. Kid asks for 20 packs and receives them. There are 22 packs remaining. | ```python
x = list(map(int, input().split()))
s = 0
for i in range(x[0]):
y = list(map(str, input().split()))
y[1] = int(y[1])
if y[0] == '+':
x[1] = x[1] + y[1]
elif y[0] == '-':
if x[1] >= y[1]:
x[1] = x[1] - y[1]
else:
s = s+1
m = [str(x[1]),str(s)]
z = ' '.join(m)
print(z)
``` | 3 |
|
332 | A | Down the Hatch! | PROGRAMMING | 1,300 | [
"implementation"
] | null | null | Everybody knows that the Berland citizens are keen on health, especially students. Berland students are so tough that all they drink is orange juice!
Yesterday one student, Vasya and his mates made some barbecue and they drank this healthy drink only. After they ran out of the first barrel of juice, they decided to play a simple game. All *n* people who came to the barbecue sat in a circle (thus each person received a unique index *b**i* from 0 to *n*<=-<=1). The person number 0 started the game (this time it was Vasya). All turns in the game were numbered by integers starting from 1. If the *j*-th turn was made by the person with index *b**i*, then this person acted like that:
1. he pointed at the person with index (*b**i*<=+<=1) *mod* *n* either with an elbow or with a nod (*x* *mod* *y* is the remainder after dividing *x* by *y*); 1. if *j*<=≥<=4 and the players who had turns number *j*<=-<=1, *j*<=-<=2, *j*<=-<=3, made during their turns the same moves as player *b**i* on the current turn, then he had drunk a glass of juice; 1. the turn went to person number (*b**i*<=+<=1) *mod* *n*.
The person who was pointed on the last turn did not make any actions.
The problem was, Vasya's drunk too much juice and can't remember the goal of the game. However, Vasya's got the recorded sequence of all the participants' actions (including himself). Now Vasya wants to find out the maximum amount of juice he could drink if he played optimally well (the other players' actions do not change). Help him.
You can assume that in any scenario, there is enough juice for everybody. | The first line contains a single integer *n* (4<=≤<=*n*<=≤<=2000) — the number of participants in the game. The second line describes the actual game: the *i*-th character of this line equals 'a', if the participant who moved *i*-th pointed at the next person with his elbow, and 'b', if the participant pointed with a nod. The game continued for at least 1 and at most 2000 turns. | Print a single integer — the number of glasses of juice Vasya could have drunk if he had played optimally well. | [
"4\nabbba\n",
"4\nabbab\n"
] | [
"1\n",
"0\n"
] | In both samples Vasya has got two turns — 1 and 5. In the first sample, Vasya could have drunk a glass of juice during the fifth turn if he had pointed at the next person with a nod. In this case, the sequence of moves would look like "abbbb". In the second sample Vasya wouldn't drink a single glass of juice as the moves performed during turns 3 and 4 are different. | 500 | [
{
"input": "4\nabbba",
"output": "1"
},
{
"input": "4\nabbab",
"output": "0"
},
{
"input": "4\naaa",
"output": "0"
},
{
"input": "4\naab",
"output": "0"
},
{
"input": "4\naabaabbba",
"output": "1"
},
{
"input": "6\naaaaaaaaaaaaaaaa",
"output": "2"
},
{
"input": "7\nabbbaaabbbaaaab",
"output": "2"
},
{
"input": "9\naaaabaaaaa",
"output": "1"
},
{
"input": "4\na",
"output": "0"
},
{
"input": "4\nb",
"output": "0"
},
{
"input": "4\nab",
"output": "0"
},
{
"input": "4\nbb",
"output": "0"
},
{
"input": "4\naba",
"output": "0"
},
{
"input": "4\nbbb",
"output": "0"
},
{
"input": "4\nabab",
"output": "0"
},
{
"input": "4\nabaa",
"output": "0"
},
{
"input": "4\nabbbaaabba",
"output": "1"
},
{
"input": "4\nababba",
"output": "0"
},
{
"input": "4\naaaaaa",
"output": "1"
},
{
"input": "5\nbbbbaabaaa",
"output": "0"
},
{
"input": "2000\na",
"output": "0"
},
{
"input": "2000\naabaaabaabababbbbbbabbbbb",
"output": "0"
},
{
"input": "4\nabbb",
"output": "0"
},
{
"input": "5\nbbbbb",
"output": "0"
}
] | 1,689,603,446 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 0 | 60 | 0 | print("_RANDOM_GUESS_1689603446.3714156")# 1689603446.371438 | Title: Down the Hatch!
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Everybody knows that the Berland citizens are keen on health, especially students. Berland students are so tough that all they drink is orange juice!
Yesterday one student, Vasya and his mates made some barbecue and they drank this healthy drink only. After they ran out of the first barrel of juice, they decided to play a simple game. All *n* people who came to the barbecue sat in a circle (thus each person received a unique index *b**i* from 0 to *n*<=-<=1). The person number 0 started the game (this time it was Vasya). All turns in the game were numbered by integers starting from 1. If the *j*-th turn was made by the person with index *b**i*, then this person acted like that:
1. he pointed at the person with index (*b**i*<=+<=1) *mod* *n* either with an elbow or with a nod (*x* *mod* *y* is the remainder after dividing *x* by *y*); 1. if *j*<=≥<=4 and the players who had turns number *j*<=-<=1, *j*<=-<=2, *j*<=-<=3, made during their turns the same moves as player *b**i* on the current turn, then he had drunk a glass of juice; 1. the turn went to person number (*b**i*<=+<=1) *mod* *n*.
The person who was pointed on the last turn did not make any actions.
The problem was, Vasya's drunk too much juice and can't remember the goal of the game. However, Vasya's got the recorded sequence of all the participants' actions (including himself). Now Vasya wants to find out the maximum amount of juice he could drink if he played optimally well (the other players' actions do not change). Help him.
You can assume that in any scenario, there is enough juice for everybody.
Input Specification:
The first line contains a single integer *n* (4<=≤<=*n*<=≤<=2000) — the number of participants in the game. The second line describes the actual game: the *i*-th character of this line equals 'a', if the participant who moved *i*-th pointed at the next person with his elbow, and 'b', if the participant pointed with a nod. The game continued for at least 1 and at most 2000 turns.
Output Specification:
Print a single integer — the number of glasses of juice Vasya could have drunk if he had played optimally well.
Demo Input:
['4\nabbba\n', '4\nabbab\n']
Demo Output:
['1\n', '0\n']
Note:
In both samples Vasya has got two turns — 1 and 5. In the first sample, Vasya could have drunk a glass of juice during the fifth turn if he had pointed at the next person with a nod. In this case, the sequence of moves would look like "abbbb". In the second sample Vasya wouldn't drink a single glass of juice as the moves performed during turns 3 and 4 are different. | ```python
print("_RANDOM_GUESS_1689603446.3714156")# 1689603446.371438
``` | 0 |
|
622 | F | The Sum of the k-th Powers | PROGRAMMING | 2,600 | [
"math"
] | null | null | There are well-known formulas: , , . Also mathematicians found similar formulas for higher degrees.
Find the value of the sum modulo 109<=+<=7 (so you should find the remainder after dividing the answer by the value 109<=+<=7). | The only line contains two integers *n*,<=*k* (1<=≤<=*n*<=≤<=109,<=0<=≤<=*k*<=≤<=106). | Print the only integer *a* — the remainder after dividing the value of the sum by the value 109<=+<=7. | [
"4 1\n",
"4 2\n",
"4 3\n",
"4 0\n"
] | [
"10\n",
"30\n",
"100\n",
"4\n"
] | none | 0 | [
{
"input": "4 1",
"output": "10"
},
{
"input": "4 2",
"output": "30"
},
{
"input": "4 3",
"output": "100"
},
{
"input": "4 0",
"output": "4"
},
{
"input": "10 0",
"output": "10"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1 0",
"output": "1"
},
{
"input": "1 1000000",
"output": "1"
},
{
"input": "1000000000 0",
"output": "1000000000"
},
{
"input": "100 100",
"output": "568830579"
},
{
"input": "10000 100",
"output": "352711099"
},
{
"input": "100 10000",
"output": "859998022"
},
{
"input": "1000000000 1000000",
"output": "617381606"
},
{
"input": "1000000 1000000",
"output": "997878755"
},
{
"input": "999999 1000000",
"output": "504760730"
},
{
"input": "77674473 447444",
"output": "838207299"
},
{
"input": "333312494 795258",
"output": "393290476"
},
{
"input": "761637147 673329",
"output": "223778667"
},
{
"input": "335185991 514401",
"output": "412595240"
},
{
"input": "203702132 355473",
"output": "229710810"
},
{
"input": "1000000000 999935",
"output": "729344740"
}
] | 1,675,458,104 | 2,147,483,647 | PyPy 3 | TIME_LIMIT_EXCEEDED | TESTS | 7 | 2,000 | 171,929,600 | def lagrange_interpolation(n, y, T, mod):
# f(i)=y_i (i=0,1,...,n) となる f について f(T) を O(n) で求める
finv = [0]*(n+1)
fac = 1
for i in range(1, n+1):
fac = fac*i % mod
finv[n] = pow(fac, mod-2, mod)
for i in range(n-1, -1, -1):
finv[i] = finv[i+1]*(i+1) % mod
T %= mod
L = [1]*(n+1)
for i in range(n):
L[i+1] = L[i]*(T-i) % mod
R = [1]*(n+1)
for i in range(n, 0, -1):
R[i-1] = R[i]*(T-i) % mod
res = 0
for i in range(n+1):
tmp = y[i]*L[i] % mod*R[i] % mod*finv[i] % mod*finv[n-i] % mod
if (n-i) % 2 == 0:
res += tmp
else:
res -= tmp
return res % mod
def fpow(x, k):
res = 1
while k:
if k & 1:
res = res*x % mod
x = x*x % mod
k >>= 1
return res
mod = 10**9+7
n, k = map(int, input().split())
s = k+1
dp = [0]*(s+1)
res = 0
for i in range(1, s+1):
res = (res+fpow(i, k)) % mod
dp[i] = res
print(lagrange_interpolation(s, dp, n, mod))
| Title: The Sum of the k-th Powers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are well-known formulas: , , . Also mathematicians found similar formulas for higher degrees.
Find the value of the sum modulo 109<=+<=7 (so you should find the remainder after dividing the answer by the value 109<=+<=7).
Input Specification:
The only line contains two integers *n*,<=*k* (1<=≤<=*n*<=≤<=109,<=0<=≤<=*k*<=≤<=106).
Output Specification:
Print the only integer *a* — the remainder after dividing the value of the sum by the value 109<=+<=7.
Demo Input:
['4 1\n', '4 2\n', '4 3\n', '4 0\n']
Demo Output:
['10\n', '30\n', '100\n', '4\n']
Note:
none | ```python
def lagrange_interpolation(n, y, T, mod):
# f(i)=y_i (i=0,1,...,n) となる f について f(T) を O(n) で求める
finv = [0]*(n+1)
fac = 1
for i in range(1, n+1):
fac = fac*i % mod
finv[n] = pow(fac, mod-2, mod)
for i in range(n-1, -1, -1):
finv[i] = finv[i+1]*(i+1) % mod
T %= mod
L = [1]*(n+1)
for i in range(n):
L[i+1] = L[i]*(T-i) % mod
R = [1]*(n+1)
for i in range(n, 0, -1):
R[i-1] = R[i]*(T-i) % mod
res = 0
for i in range(n+1):
tmp = y[i]*L[i] % mod*R[i] % mod*finv[i] % mod*finv[n-i] % mod
if (n-i) % 2 == 0:
res += tmp
else:
res -= tmp
return res % mod
def fpow(x, k):
res = 1
while k:
if k & 1:
res = res*x % mod
x = x*x % mod
k >>= 1
return res
mod = 10**9+7
n, k = map(int, input().split())
s = k+1
dp = [0]*(s+1)
res = 0
for i in range(1, s+1):
res = (res+fpow(i, k)) % mod
dp[i] = res
print(lagrange_interpolation(s, dp, n, mod))
``` | 0 |
|
673 | A | Bear and Game | PROGRAMMING | 800 | [
"implementation"
] | null | null | Bear Limak likes watching sports on TV. He is going to watch a game today. The game lasts 90 minutes and there are no breaks.
Each minute can be either interesting or boring. If 15 consecutive minutes are boring then Limak immediately turns TV off.
You know that there will be *n* interesting minutes *t*1,<=*t*2,<=...,<=*t**n*. Your task is to calculate for how many minutes Limak will watch the game. | The first line of the input contains one integer *n* (1<=≤<=*n*<=≤<=90) — the number of interesting minutes.
The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t*1<=<<=*t*2<=<<=... *t**n*<=≤<=90), given in the increasing order. | Print the number of minutes Limak will watch the game. | [
"3\n7 20 88\n",
"9\n16 20 30 40 50 60 70 80 90\n",
"9\n15 20 30 40 50 60 70 80 90\n"
] | [
"35\n",
"15\n",
"90\n"
] | In the first sample, minutes 21, 22, ..., 35 are all boring and thus Limak will turn TV off immediately after the 35-th minute. So, he would watch the game for 35 minutes.
In the second sample, the first 15 minutes are boring.
In the third sample, there are no consecutive 15 boring minutes. So, Limak will watch the whole game. | 500 | [
{
"input": "3\n7 20 88",
"output": "35"
},
{
"input": "9\n16 20 30 40 50 60 70 80 90",
"output": "15"
},
{
"input": "9\n15 20 30 40 50 60 70 80 90",
"output": "90"
},
{
"input": "30\n6 11 12 15 22 24 30 31 32 33 34 35 40 42 44 45 47 50 53 54 57 58 63 67 75 77 79 81 83 88",
"output": "90"
},
{
"input": "60\n1 2 4 5 6 7 11 14 16 18 20 21 22 23 24 25 26 33 34 35 36 37 38 39 41 42 43 44 46 47 48 49 52 55 56 57 58 59 60 61 63 64 65 67 68 70 71 72 73 74 75 77 78 80 82 83 84 85 86 88",
"output": "90"
},
{
"input": "90\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90",
"output": "90"
},
{
"input": "1\n1",
"output": "16"
},
{
"input": "5\n15 30 45 60 75",
"output": "90"
},
{
"input": "6\n14 29 43 59 70 74",
"output": "58"
},
{
"input": "1\n15",
"output": "30"
},
{
"input": "1\n16",
"output": "15"
},
{
"input": "14\n14 22 27 31 35 44 46 61 62 69 74 79 88 89",
"output": "90"
},
{
"input": "76\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90",
"output": "90"
},
{
"input": "1\n90",
"output": "15"
},
{
"input": "6\n13 17 32 47 60 66",
"output": "81"
},
{
"input": "84\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84",
"output": "90"
},
{
"input": "9\n6 20 27 28 40 53 59 70 85",
"output": "90"
},
{
"input": "12\n14 22 27 31 35 44 62 69 74 79 88 89",
"output": "59"
},
{
"input": "5\n15 30 45 60 74",
"output": "89"
},
{
"input": "72\n3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89",
"output": "54"
},
{
"input": "8\n1 16 30 31 32 33 34 50",
"output": "49"
},
{
"input": "12\n1 3 6 10 15 21 28 36 45 55 66 78",
"output": "90"
},
{
"input": "25\n1 2 3 4 5 6 7 8 9 10 11 23 36 50 65 81 82 83 84 85 86 87 88 89 90",
"output": "80"
},
{
"input": "8\n5 17 20 35 42 53 67 76",
"output": "90"
},
{
"input": "9\n15 28 39 48 55 60 63 64 74",
"output": "89"
},
{
"input": "10\n15 28 39 48 55 60 63 64 74 82",
"output": "90"
},
{
"input": "2\n1 18",
"output": "16"
},
{
"input": "9\n10 20 30 40 50 60 70 80 84",
"output": "90"
},
{
"input": "2\n16 50",
"output": "15"
},
{
"input": "6\n15 30 45 60 75 84",
"output": "90"
},
{
"input": "8\n15 20 30 40 50 60 73 83",
"output": "90"
},
{
"input": "8\n10 20 30 40 50 60 70 80",
"output": "90"
},
{
"input": "3\n1 20 90",
"output": "16"
},
{
"input": "6\n15 30 45 60 74 89",
"output": "90"
}
] | 1,559,803,233 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 3 | 93 | 0 |
n = int(input())
arr = list(map(int, input().split(' ')))
last = 0
end = False
for i in arr:
if i - last > 15:
print(last + 15)
end = True
last = i
if not end:
print(last) | Title: Bear and Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bear Limak likes watching sports on TV. He is going to watch a game today. The game lasts 90 minutes and there are no breaks.
Each minute can be either interesting or boring. If 15 consecutive minutes are boring then Limak immediately turns TV off.
You know that there will be *n* interesting minutes *t*1,<=*t*2,<=...,<=*t**n*. Your task is to calculate for how many minutes Limak will watch the game.
Input Specification:
The first line of the input contains one integer *n* (1<=≤<=*n*<=≤<=90) — the number of interesting minutes.
The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t*1<=<<=*t*2<=<<=... *t**n*<=≤<=90), given in the increasing order.
Output Specification:
Print the number of minutes Limak will watch the game.
Demo Input:
['3\n7 20 88\n', '9\n16 20 30 40 50 60 70 80 90\n', '9\n15 20 30 40 50 60 70 80 90\n']
Demo Output:
['35\n', '15\n', '90\n']
Note:
In the first sample, minutes 21, 22, ..., 35 are all boring and thus Limak will turn TV off immediately after the 35-th minute. So, he would watch the game for 35 minutes.
In the second sample, the first 15 minutes are boring.
In the third sample, there are no consecutive 15 boring minutes. So, Limak will watch the whole game. | ```python
n = int(input())
arr = list(map(int, input().split(' ')))
last = 0
end = False
for i in arr:
if i - last > 15:
print(last + 15)
end = True
last = i
if not end:
print(last)
``` | 0 |
|
548 | A | Mike and Fax | PROGRAMMING | 1,100 | [
"brute force",
"implementation",
"strings"
] | null | null | While Mike was walking in the subway, all the stuff in his back-bag dropped on the ground. There were several fax messages among them. He concatenated these strings in some order and now he has string *s*.
He is not sure if this is his own back-bag or someone else's. He remembered that there were exactly *k* messages in his own bag, each was a palindrome string and all those strings had the same length.
He asked you to help him and tell him if he has worn his own back-bag. Check if the given string *s* is a concatenation of *k* palindromes of the same length. | The first line of input contains string *s* containing lowercase English letters (1<=≤<=|*s*|<=≤<=1000).
The second line contains integer *k* (1<=≤<=*k*<=≤<=1000). | Print "YES"(without quotes) if he has worn his own back-bag or "NO"(without quotes) otherwise. | [
"saba\n2\n",
"saddastavvat\n2\n"
] | [
"NO\n",
"YES\n"
] | Palindrome is a string reading the same forward and backward.
In the second sample, the faxes in his back-bag can be "saddas" and "tavvat". | 500 | [
{
"input": "saba\n2",
"output": "NO"
},
{
"input": "saddastavvat\n2",
"output": "YES"
},
{
"input": "aaaaaaaaaa\n3",
"output": "NO"
},
{
"input": "aaaaaa\n3",
"output": "YES"
},
{
"input": "abaacca\n2",
"output": "NO"
},
{
"input": "a\n1",
"output": "YES"
},
{
"input": "princeofpersia\n1",
"output": "NO"
},
{
"input": "xhwbdoryfiaxglripavycmxmcejbcpzidrqsqvikfzjyfnmedxrvlnusavyhillaxrblkynwdrlhthtqzjktzkullgrqsolqssocpfwcaizhovajlhmeibhiuwtxpljkyyiwykzpmazkkzampzkywiyykjlpxtwuihbiemhljavohziacwfpcossqlosqrgllukztkjzqththlrdwnyklbrxallihyvasunlvrxdemnfyjzfkivqsqrdizpcbjecmxmcyvapirlgxaifyrodbwhx\n1",
"output": "YES"
},
{
"input": "yfhqnbzaqeqmcvtsbcdn\n456",
"output": "NO"
},
{
"input": "lgsdfiforlqrohhjyzrigewkigiiffvbyrapzmjvtkklndeyuqpuukajgtguhlarjdqlxksyekbjgrmhuyiqdlzjqqzlxufffpelyptodwhvkfbalxbufrlcsjgxmfxeqsszqghcustqrqjljattgvzynyvfbjgbuynbcguqtyfowgtcbbaywvcrgzrulqpghwoflutswu\n584",
"output": "NO"
},
{
"input": "awlrhmxxivqbntvtapwkdkunamcqoerfncfmookhdnuxtttlxmejojpwbdyxirdsjippzjhdrpjepremruczbedxrjpodlyyldopjrxdebzcurmerpejprdhjzppijsdrixydbwpjojemxltttxundhkoomfcnfreoqcmanukdkwpatvtnbqvixxmhrlwa\n1",
"output": "YES"
},
{
"input": "kafzpsglcpzludxojtdhzynpbekzssvhzizfrboxbhqvojiqtjitrackqccxgenwwnegxccqkcartijtqijovqhbxobrfzizhvsszkebpnyzhdtjoxdulzpclgspzfakvcbbjejeubvrrzlvjjgrcprntbyuakoxowoybbxgdugjffgbtfwrfiobifrshyaqqayhsrfiboifrwftbgffjgudgxbbyowoxokauybtnrpcrgjjvlzrrvbuejejbbcv\n2",
"output": "YES"
},
{
"input": "zieqwmmbrtoxysvavwdemmdeatfrolsqvvlgphhhmojjfxfurtuiqdiilhlcwwqedlhblrzmvuoaczcwrqzyymiggpvbpkycibsvkhytrzhguksxyykkkvfljbbnjblylftmqxkojithwsegzsaexlpuicexbdzpwesrkzbqltxhifwqcehzsjgsqbwkujvjbjpqxdpmlimsusumizizpyigmkxwuberthdghnepyrxzvvidxeafwylegschhtywvqsxuqmsddhkzgkdiekodqpnftdyhnpicsnbhfxemxllvaurkmjvtrmqkulerxtaolmokiqqvqgechkqxmendpmgxwiaffcajmqjmvrwryzxujmiasuqtosuisiclnv\n8",
"output": "NO"
},
{
"input": "syghzncbi\n829",
"output": "NO"
},
{
"input": "ljpdpstntznciejqqtpysskztdfawuncqzwwfefrfsihyrdopwawowshquqnjhesxszuywezpebpzhtopgngrnqgwnoqhyrykojguybvdbjpfpmvkxscocywzsxcivysfrrzsonayztzzuybrkiombhqcfkszyscykzistiobrpavezedgobowjszfadcccmxyqehmkgywiwxffibzetb\n137",
"output": "NO"
},
{
"input": "eytuqriplfczwsqlsnjetfpzehzvzayickkbnfqddaisfpasvigwtnvbybwultsgrtjbaebktvubwofysgidpufzteuhuaaqkhmhguockoczlrmlrrzouvqtwbcchxxiydbohnvrmtqjzhkfmvdulojhdvgwudvidpausvfujkjprxsobliuauxleqvsmz\n253",
"output": "NO"
},
{
"input": "xkaqgwabuilhuqwhnrdtyattmqcjfbiqodjlwzgcyvghqncklbhnlmagvjvwysrfryrlmclninogumjfmyenkmydlmifxpkvlaapgnfarejaowftxxztshsesjtsgommaeslrhronruqdurvjesydrzmxirmxumrcqezznqltngsgdcthivdnjnshjfujtiqsltpttgbljfcbqsfwbzokciqlavrthgaqbzikpwwsebzwddlvdwrmztwmhcxdinwlbklwmteeybbdbzevfbsrtldapulwgusuvnreiflkytonzmervyrlbqhzapgxepwauaiwygpxarfeyqhimzlxntjuaaigeisgrvwgbhqemqetzyallzaoqprhzpjibkutgwrodruqu\n857",
"output": "NO"
},
{
"input": "rbehjxpblnzfgeebpkvzznwtzszghjuuxovreapmwehqyjymrkmksffbdpbdyegulabsmjiykeeqtuvqqyxlitpxjdpwmqtlmudqsksgwqekvwfjdsggzajcpsyserkctpbajgzdbiqaekfaepnecezdzamqszpwfvhlannszgaiewvcdnnvzhblmuzjtqeyjcqjqoxatavavokyxokuxwuqueskktxnxraihnqovrfykpzsyjmrhqsvbobzsnfqwvdwatvjxaubtiwhgvrqwjhgfnauqegqmcwnaruinplmtmxhvohhqgvcatsdqiwkvslhqzqevdgdhpijjevuyuitnixdjhwlmjsstmugownjdhvxueg\n677",
"output": "NO"
},
{
"input": "a\n3",
"output": "NO"
},
{
"input": "aa\n2",
"output": "YES"
},
{
"input": "abcaabca\n2",
"output": "NO"
},
{
"input": "aaaaaaaaab\n5",
"output": "NO"
},
{
"input": "aabbb\n3",
"output": "NO"
},
{
"input": "abcde\n5",
"output": "YES"
},
{
"input": "aabc\n2",
"output": "NO"
},
{
"input": "aabcaa\n3",
"output": "NO"
}
] | 1,600,822,233 | 2,147,483,647 | PyPy 3 | OK | TESTS | 56 | 140 | 0 |
n = input()
a = int(input())
if len(n)%a!=0:
print('NO')
else:
g = len(n)//a
p=0
if g%2==0:
for k in range(0,len(n),g):
u= n[k:k+g]
if u[:g//2]!=u[g//2:][::-1]:
print('NO')
p+=1
break
else:
for k in range(0,len(n),g):
u= n[k:k+g]
if u[:g//2]!=u[g//2+1:][::-1]:
print('NO')
p+=1
break
if p==0:
print('YES')
| Title: Mike and Fax
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
While Mike was walking in the subway, all the stuff in his back-bag dropped on the ground. There were several fax messages among them. He concatenated these strings in some order and now he has string *s*.
He is not sure if this is his own back-bag or someone else's. He remembered that there were exactly *k* messages in his own bag, each was a palindrome string and all those strings had the same length.
He asked you to help him and tell him if he has worn his own back-bag. Check if the given string *s* is a concatenation of *k* palindromes of the same length.
Input Specification:
The first line of input contains string *s* containing lowercase English letters (1<=≤<=|*s*|<=≤<=1000).
The second line contains integer *k* (1<=≤<=*k*<=≤<=1000).
Output Specification:
Print "YES"(without quotes) if he has worn his own back-bag or "NO"(without quotes) otherwise.
Demo Input:
['saba\n2\n', 'saddastavvat\n2\n']
Demo Output:
['NO\n', 'YES\n']
Note:
Palindrome is a string reading the same forward and backward.
In the second sample, the faxes in his back-bag can be "saddas" and "tavvat". | ```python
n = input()
a = int(input())
if len(n)%a!=0:
print('NO')
else:
g = len(n)//a
p=0
if g%2==0:
for k in range(0,len(n),g):
u= n[k:k+g]
if u[:g//2]!=u[g//2:][::-1]:
print('NO')
p+=1
break
else:
for k in range(0,len(n),g):
u= n[k:k+g]
if u[:g//2]!=u[g//2+1:][::-1]:
print('NO')
p+=1
break
if p==0:
print('YES')
``` | 3 |
|
400 | B | Inna and New Matrix of Candies | PROGRAMMING | 1,200 | [
"brute force",
"implementation",
"schedules"
] | null | null | Inna likes sweets and a game called the "Candy Matrix". Today, she came up with the new game "Candy Matrix 2: Reload".
The field for the new game is a rectangle table of size *n*<=×<=*m*. Each line of the table contains one cell with a dwarf figurine, one cell with a candy, the other cells of the line are empty. The game lasts for several moves. During each move the player should choose all lines of the matrix where dwarf is not on the cell with candy and shout "Let's go!". After that, all the dwarves from the chosen lines start to simultaneously move to the right. During each second, each dwarf goes to the adjacent cell that is located to the right of its current cell. The movement continues until one of the following events occurs:
- some dwarf in one of the chosen lines is located in the rightmost cell of his row; - some dwarf in the chosen lines is located in the cell with the candy.
The point of the game is to transport all the dwarves to the candy cells.
Inna is fabulous, as she came up with such an interesting game. But what about you? Your task is to play this game optimally well. Specifically, you should say by the given game field what minimum number of moves the player needs to reach the goal of the game. | The first line of the input contains two integers *n* and *m* (1<=≤<=*n*<=≤<=1000; 2<=≤<=*m*<=≤<=1000).
Next *n* lines each contain *m* characters — the game field for the "Candy Martix 2: Reload". Character "*" represents an empty cell of the field, character "G" represents a dwarf and character "S" represents a candy. The matrix doesn't contain other characters. It is guaranteed that each line contains exactly one character "G" and one character "S". | In a single line print a single integer — either the minimum number of moves needed to achieve the aim of the game, or -1, if the aim cannot be achieved on the given game field. | [
"3 4\n*G*S\nG**S\n*G*S\n",
"1 3\nS*G\n"
] | [
"2\n",
"-1\n"
] | none | 1,000 | [
{
"input": "3 4\n*G*S\nG**S\n*G*S",
"output": "2"
},
{
"input": "1 3\nS*G",
"output": "-1"
},
{
"input": "10 10\nG********S\n*G*******S\n**G******S\n***G*****S\n****G****S\n*****G***S\n******G**S\n*******G*S\n********GS\nG********S",
"output": "9"
},
{
"input": "5 10\nG***S*****\nG****S****\n***GS*****\nG*S*******\nG***S*****",
"output": "4"
},
{
"input": "4 8\nG*S*****\n****G*S*\nG*****S*\n**G***S*",
"output": "3"
},
{
"input": "4 10\n***G****S*\n*****GS***\nG****S****\nG*******S*",
"output": "3"
},
{
"input": "1 2\nSG",
"output": "-1"
},
{
"input": "1 2\nGS",
"output": "1"
},
{
"input": "1 4\nSG**",
"output": "-1"
}
] | 1,545,236,944 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 93 | 0 | n,m=map(int,input().split())
s=-1
l=[]
for i in range(n):
k=list(input())
for j in range(m):
if k[j]=="G":
for a in range(j+1,m):
if k[a]=="S":
s=abs(j-a)
l.append(s)
print(min(l))
| Title: Inna and New Matrix of Candies
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Inna likes sweets and a game called the "Candy Matrix". Today, she came up with the new game "Candy Matrix 2: Reload".
The field for the new game is a rectangle table of size *n*<=×<=*m*. Each line of the table contains one cell with a dwarf figurine, one cell with a candy, the other cells of the line are empty. The game lasts for several moves. During each move the player should choose all lines of the matrix where dwarf is not on the cell with candy and shout "Let's go!". After that, all the dwarves from the chosen lines start to simultaneously move to the right. During each second, each dwarf goes to the adjacent cell that is located to the right of its current cell. The movement continues until one of the following events occurs:
- some dwarf in one of the chosen lines is located in the rightmost cell of his row; - some dwarf in the chosen lines is located in the cell with the candy.
The point of the game is to transport all the dwarves to the candy cells.
Inna is fabulous, as she came up with such an interesting game. But what about you? Your task is to play this game optimally well. Specifically, you should say by the given game field what minimum number of moves the player needs to reach the goal of the game.
Input Specification:
The first line of the input contains two integers *n* and *m* (1<=≤<=*n*<=≤<=1000; 2<=≤<=*m*<=≤<=1000).
Next *n* lines each contain *m* characters — the game field for the "Candy Martix 2: Reload". Character "*" represents an empty cell of the field, character "G" represents a dwarf and character "S" represents a candy. The matrix doesn't contain other characters. It is guaranteed that each line contains exactly one character "G" and one character "S".
Output Specification:
In a single line print a single integer — either the minimum number of moves needed to achieve the aim of the game, or -1, if the aim cannot be achieved on the given game field.
Demo Input:
['3 4\n*G*S\nG**S\n*G*S\n', '1 3\nS*G\n']
Demo Output:
['2\n', '-1\n']
Note:
none | ```python
n,m=map(int,input().split())
s=-1
l=[]
for i in range(n):
k=list(input())
for j in range(m):
if k[j]=="G":
for a in range(j+1,m):
if k[a]=="S":
s=abs(j-a)
l.append(s)
print(min(l))
``` | 0 |
|
356 | A | Knight Tournament | PROGRAMMING | 1,500 | [
"data structures",
"dsu"
] | null | null | Hooray! Berl II, the king of Berland is making a knight tournament. The king has already sent the message to all knights in the kingdom and they in turn agreed to participate in this grand event.
As for you, you're just a simple peasant. There's no surprise that you slept in this morning and were late for the tournament (it was a weekend, after all). Now you are really curious about the results of the tournament. This time the tournament in Berland went as follows:
- There are *n* knights participating in the tournament. Each knight was assigned his unique number — an integer from 1 to *n*. - The tournament consisted of *m* fights, in the *i*-th fight the knights that were still in the game with numbers at least *l**i* and at most *r**i* have fought for the right to continue taking part in the tournament. - After the *i*-th fight among all participants of the fight only one knight won — the knight number *x**i*, he continued participating in the tournament. Other knights left the tournament. - The winner of the last (the *m*-th) fight (the knight number *x**m*) became the winner of the tournament.
You fished out all the information about the fights from your friends. Now for each knight you want to know the name of the knight he was conquered by. We think that the knight number *b* was conquered by the knight number *a*, if there was a fight with both of these knights present and the winner was the knight number *a*.
Write the code that calculates for each knight, the name of the knight that beat him. | The first line contains two integers *n*, *m* (2<=≤<=*n*<=≤<=3·105; 1<=≤<=*m*<=≤<=3·105) — the number of knights and the number of fights. Each of the following *m* lines contains three integers *l**i*,<=*r**i*,<=*x**i* (1<=≤<=*l**i*<=<<=*r**i*<=≤<=*n*; *l**i*<=≤<=*x**i*<=≤<=*r**i*) — the description of the *i*-th fight.
It is guaranteed that the input is correct and matches the problem statement. It is guaranteed that at least two knights took part in each battle. | Print *n* integers. If the *i*-th knight lost, then the *i*-th number should equal the number of the knight that beat the knight number *i*. If the *i*-th knight is the winner, then the *i*-th number must equal 0. | [
"4 3\n1 2 1\n1 3 3\n1 4 4\n",
"8 4\n3 5 4\n3 7 6\n2 8 8\n1 8 1\n"
] | [
"3 1 4 0 ",
"0 8 4 6 4 8 6 1 "
] | Consider the first test case. Knights 1 and 2 fought the first fight and knight 1 won. Knights 1 and 3 fought the second fight and knight 3 won. The last fight was between knights 3 and 4, knight 4 won. | 500 | [
{
"input": "4 3\n1 2 1\n1 3 3\n1 4 4",
"output": "3 1 4 0 "
},
{
"input": "8 4\n3 5 4\n3 7 6\n2 8 8\n1 8 1",
"output": "0 8 4 6 4 8 6 1 "
},
{
"input": "2 1\n1 2 1",
"output": "0 1 "
},
{
"input": "2 1\n1 2 2",
"output": "2 0 "
},
{
"input": "3 1\n1 3 1",
"output": "0 1 1 "
},
{
"input": "3 1\n1 3 2",
"output": "2 0 2 "
},
{
"input": "3 1\n1 3 3",
"output": "3 3 0 "
},
{
"input": "3 2\n1 2 1\n1 3 3",
"output": "3 1 0 "
},
{
"input": "3 2\n1 2 2\n1 3 2",
"output": "2 0 2 "
},
{
"input": "3 2\n2 3 3\n1 3 3",
"output": "3 3 0 "
},
{
"input": "11 6\n1 2 2\n7 8 7\n3 4 4\n6 9 6\n5 10 10\n2 11 11",
"output": "2 11 4 11 10 10 6 7 6 11 0 "
},
{
"input": "10 6\n9 10 10\n6 7 7\n2 4 2\n2 5 5\n1 7 5\n4 10 8",
"output": "5 5 2 2 8 7 5 0 10 8 "
},
{
"input": "11 8\n3 5 5\n8 9 9\n4 6 6\n8 10 10\n5 7 7\n2 7 2\n10 11 11\n1 11 1",
"output": "0 1 5 5 6 7 2 9 10 11 1 "
},
{
"input": "10 7\n7 8 7\n7 9 9\n5 9 5\n5 10 10\n1 2 2\n3 4 4\n2 10 4",
"output": "2 4 4 0 10 5 9 7 5 4 "
},
{
"input": "11 5\n8 10 9\n6 10 7\n6 11 11\n3 5 5\n1 11 1",
"output": "0 1 5 5 1 7 11 9 7 9 1 "
},
{
"input": "10 6\n6 7 6\n5 7 5\n3 7 4\n2 8 2\n2 10 10\n1 10 10",
"output": "10 10 4 2 4 5 6 2 10 0 "
},
{
"input": "11 7\n7 8 8\n5 6 5\n1 3 3\n7 9 9\n5 10 10\n10 11 11\n1 11 4",
"output": "3 3 4 0 10 5 8 9 10 11 4 "
},
{
"input": "10 7\n8 9 9\n3 4 3\n2 3 2\n1 5 2\n6 7 6\n6 10 10\n1 10 10",
"output": "2 10 2 3 2 10 6 9 10 0 "
},
{
"input": "11 6\n1 2 1\n8 9 9\n3 5 5\n3 6 6\n9 10 10\n1 11 10",
"output": "10 1 5 5 6 10 10 9 10 0 10 "
},
{
"input": "10 5\n1 2 1\n8 10 8\n3 6 4\n4 7 7\n1 8 7",
"output": "7 1 4 7 4 4 0 7 8 8 "
},
{
"input": "4 3\n1 2 2\n1 3 3\n1 4 4",
"output": "2 3 4 0 "
}
] | 1,660,393,703 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 31 | 0 | # 4 3
# k = [1, 2, 3, 4]
# 1 2 1
# [1, 2], 1
# ans = [0, 1, 0, 0]
# [1, 3, 4]
# 1 3 3
# [1, 3], 3
# ans = [3, 1, 0, 0]
# [3, 4]
# 1 4 4
# [3, 4], 4
# ans = [3, 1, 4, 0]
# [4]
# 8 4
# k = {1, 2, 3, 4, 5, 6, 7, 8}
# 3 5 4
# [3, 4, 5], 4
# ans = [0, 0, 4, 0, 4, 0, 0, 0]
# [1, 2, 4, 6, 7, 8]
# 3 7 6
# [4, 6, 7], 6
# ans = [0, 0, 4, 6, 4, 0, 6, 0]
# [1, 2, 6, 8]
# 2 8 8
# [2, 6, 8], 8
# ans = [0, 8, 4, 6, 4, 8, 6, 0]
# [1, 8]
# 1 8 1
# [1, 8], 1
# # ans = [0, 8, 4, 6, 4, 8, 6, 1]
# [1]
# n = 4, m = 3
[n, m] = map(int, input().split(" "))
# k = [1, 2, 3, 4, 5, 6, 7, 8]
k = []
for i in range(n):
k.append(i+1)
# print(k)
# ans = [0, 0, 0, 0, 0, 0, 0, 0]
ans = [0] * n
for i in range(m):
# 3 5 4
# l = 3, r = 5, x = 4
[l, r, x] = map(int, input().split(" "))
# f = [3, 5]
f = []
for i in range(k.index(l), k.index(r)+1):
if k[i] != x:
f.append(k[i])
# ans = [0, 0, 4, 0, 4, 0, 0, 0]
for i in f:
if ans[i-1] == 0:
ans[i-1] = x
# print(f)
print(ans)
| Title: Knight Tournament
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Hooray! Berl II, the king of Berland is making a knight tournament. The king has already sent the message to all knights in the kingdom and they in turn agreed to participate in this grand event.
As for you, you're just a simple peasant. There's no surprise that you slept in this morning and were late for the tournament (it was a weekend, after all). Now you are really curious about the results of the tournament. This time the tournament in Berland went as follows:
- There are *n* knights participating in the tournament. Each knight was assigned his unique number — an integer from 1 to *n*. - The tournament consisted of *m* fights, in the *i*-th fight the knights that were still in the game with numbers at least *l**i* and at most *r**i* have fought for the right to continue taking part in the tournament. - After the *i*-th fight among all participants of the fight only one knight won — the knight number *x**i*, he continued participating in the tournament. Other knights left the tournament. - The winner of the last (the *m*-th) fight (the knight number *x**m*) became the winner of the tournament.
You fished out all the information about the fights from your friends. Now for each knight you want to know the name of the knight he was conquered by. We think that the knight number *b* was conquered by the knight number *a*, if there was a fight with both of these knights present and the winner was the knight number *a*.
Write the code that calculates for each knight, the name of the knight that beat him.
Input Specification:
The first line contains two integers *n*, *m* (2<=≤<=*n*<=≤<=3·105; 1<=≤<=*m*<=≤<=3·105) — the number of knights and the number of fights. Each of the following *m* lines contains three integers *l**i*,<=*r**i*,<=*x**i* (1<=≤<=*l**i*<=<<=*r**i*<=≤<=*n*; *l**i*<=≤<=*x**i*<=≤<=*r**i*) — the description of the *i*-th fight.
It is guaranteed that the input is correct and matches the problem statement. It is guaranteed that at least two knights took part in each battle.
Output Specification:
Print *n* integers. If the *i*-th knight lost, then the *i*-th number should equal the number of the knight that beat the knight number *i*. If the *i*-th knight is the winner, then the *i*-th number must equal 0.
Demo Input:
['4 3\n1 2 1\n1 3 3\n1 4 4\n', '8 4\n3 5 4\n3 7 6\n2 8 8\n1 8 1\n']
Demo Output:
['3 1 4 0 ', '0 8 4 6 4 8 6 1 ']
Note:
Consider the first test case. Knights 1 and 2 fought the first fight and knight 1 won. Knights 1 and 3 fought the second fight and knight 3 won. The last fight was between knights 3 and 4, knight 4 won. | ```python
# 4 3
# k = [1, 2, 3, 4]
# 1 2 1
# [1, 2], 1
# ans = [0, 1, 0, 0]
# [1, 3, 4]
# 1 3 3
# [1, 3], 3
# ans = [3, 1, 0, 0]
# [3, 4]
# 1 4 4
# [3, 4], 4
# ans = [3, 1, 4, 0]
# [4]
# 8 4
# k = {1, 2, 3, 4, 5, 6, 7, 8}
# 3 5 4
# [3, 4, 5], 4
# ans = [0, 0, 4, 0, 4, 0, 0, 0]
# [1, 2, 4, 6, 7, 8]
# 3 7 6
# [4, 6, 7], 6
# ans = [0, 0, 4, 6, 4, 0, 6, 0]
# [1, 2, 6, 8]
# 2 8 8
# [2, 6, 8], 8
# ans = [0, 8, 4, 6, 4, 8, 6, 0]
# [1, 8]
# 1 8 1
# [1, 8], 1
# # ans = [0, 8, 4, 6, 4, 8, 6, 1]
# [1]
# n = 4, m = 3
[n, m] = map(int, input().split(" "))
# k = [1, 2, 3, 4, 5, 6, 7, 8]
k = []
for i in range(n):
k.append(i+1)
# print(k)
# ans = [0, 0, 0, 0, 0, 0, 0, 0]
ans = [0] * n
for i in range(m):
# 3 5 4
# l = 3, r = 5, x = 4
[l, r, x] = map(int, input().split(" "))
# f = [3, 5]
f = []
for i in range(k.index(l), k.index(r)+1):
if k[i] != x:
f.append(k[i])
# ans = [0, 0, 4, 0, 4, 0, 0, 0]
for i in f:
if ans[i-1] == 0:
ans[i-1] = x
# print(f)
print(ans)
``` | 0 |
|
259 | A | Little Elephant and Chess | PROGRAMMING | 1,000 | [
"brute force",
"strings"
] | null | null | The Little Elephant loves chess very much.
One day the Little Elephant and his friend decided to play chess. They've got the chess pieces but the board is a problem. They've got an 8<=×<=8 checkered board, each square is painted either black or white. The Little Elephant and his friend know that a proper chessboard doesn't have any side-adjacent cells with the same color and the upper left cell is white. To play chess, they want to make the board they have a proper chessboard. For that the friends can choose any row of the board and cyclically shift the cells of the chosen row, that is, put the last (rightmost) square on the first place in the row and shift the others one position to the right. You can run the described operation multiple times (or not run it at all).
For example, if the first line of the board looks like that "BBBBBBWW" (the white cells of the line are marked with character "W", the black cells are marked with character "B"), then after one cyclic shift it will look like that "WBBBBBBW".
Help the Little Elephant and his friend to find out whether they can use any number of the described operations to turn the board they have into a proper chessboard. | The input consists of exactly eight lines. Each line contains exactly eight characters "W" or "B" without any spaces: the *j*-th character in the *i*-th line stands for the color of the *j*-th cell of the *i*-th row of the elephants' board. Character "W" stands for the white color, character "B" stands for the black color.
Consider the rows of the board numbered from 1 to 8 from top to bottom, and the columns — from 1 to 8 from left to right. The given board can initially be a proper chessboard. | In a single line print "YES" (without the quotes), if we can make the board a proper chessboard and "NO" (without the quotes) otherwise. | [
"WBWBWBWB\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\n",
"WBWBWBWB\nWBWBWBWB\nBBWBWWWB\nBWBWBWBW\nBWBWBWBW\nBWBWBWWW\nBWBWBWBW\nBWBWBWBW\n"
] | [
"YES\n",
"NO\n"
] | In the first sample you should shift the following lines one position to the right: the 3-rd, the 6-th, the 7-th and the 8-th.
In the second sample there is no way you can achieve the goal. | 500 | [
{
"input": "WBWBWBWB\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB",
"output": "YES"
},
{
"input": "WBWBWBWB\nWBWBWBWB\nBBWBWWWB\nBWBWBWBW\nBWBWBWBW\nBWBWBWWW\nBWBWBWBW\nBWBWBWBW",
"output": "NO"
},
{
"input": "BWBWBWBW\nWBWBWBWB\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nWBWBWBWB\nWBWBWBWB",
"output": "YES"
},
{
"input": "BWBWBWBW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nWBWBWBWB",
"output": "YES"
},
{
"input": "WBWBWBWB\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW",
"output": "YES"
},
{
"input": "WBWBWBWB\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nWBWBWBWB\nWBWBWBWB\nBWWWBWBW",
"output": "NO"
},
{
"input": "BBBBBWWW\nWBBWBWWB\nWWWWWBWW\nBWBWWBWW\nBBBWWBWW\nBBBBBWBW\nWBBBWBWB\nWBWBWWWB",
"output": "NO"
},
{
"input": "BWBWBWBW\nBWBWBWBW\nBWWWWWBB\nBBWBWBWB\nWBWBWBWB\nWWBWWBWW\nBWBWBWBW\nWBWWBBBB",
"output": "NO"
},
{
"input": "WBWBWBWB\nWBWBWBWB\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nWBWWBWBB",
"output": "NO"
},
{
"input": "WBWBWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nBWBWBWBW\nBWBWBWBW",
"output": "YES"
},
{
"input": "WBWBWBWB\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nBWBWBWBW",
"output": "YES"
},
{
"input": "WWWWBWWB\nBWBWBWBW\nBWBWBWBW\nWWBWBBBB\nBBWWBBBB\nBBBWWBBW\nBWWWWWWB\nBWWBBBWW",
"output": "NO"
},
{
"input": "WBBWWBWB\nBBWBWBWB\nBWBWBWBW\nBWBWBWBW\nWBWBWBBW\nWBWBBBBW\nBWWWWBWB\nBBBBBBBW",
"output": "NO"
},
{
"input": "BWBWBWBW\nBWBWBWBW\nBBWWWBBB\nWBBBBBWW\nWBBBBWBB\nWBWBWBWB\nWBWWBWWB\nWBBWBBWW",
"output": "NO"
},
{
"input": "WBBBBBWB\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nBBBBBWBB\nWBBWWBWB\nBWBWBWBW",
"output": "NO"
},
{
"input": "BWBWBWBW\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nBWBWBWBW\nBWBWBWBW\nWBBWWBWB",
"output": "NO"
},
{
"input": "BWBWBWBW\nWBWBWBWB\nBWBWBWBW\nBWWWBWBW\nWBWBWBWB\nWBWBWBWB\nBWBWBWBW\nWBWBWBBW",
"output": "NO"
},
{
"input": "WBWBWBWB\nWBWBWBWB\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW",
"output": "YES"
},
{
"input": "BWBWBWBW\nWBWBWBWB\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW",
"output": "YES"
},
{
"input": "BWBWBWBW\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW",
"output": "YES"
},
{
"input": "WWBBWWBB\nBWWBBWWB\nBWBWBWBW\nWWBBWWWB\nWBWWWWBB\nWBWWBBWB\nBWBBWBWW\nBWBWWWWW",
"output": "NO"
},
{
"input": "WBWBWBWB\nWBWBWBWB\nWWBBWBBB\nWBWBWBWB\nWWWWBWWB\nWBBBBWWW\nBWBWWWBW\nWWWBWBBB",
"output": "NO"
},
{
"input": "WBWBWBWB\nBWWBWWWW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nWWBBBBBW\nWWWBWWBW\nWWBBBBWW",
"output": "NO"
},
{
"input": "BWBWBWBW\nBWBBBWWB\nWBWBWBWB\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW",
"output": "NO"
},
{
"input": "BWBWBWBW\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW",
"output": "YES"
},
{
"input": "BBBBBBBB\nBBBBBBBB\nBBBBBBBB\nBBBBBBBB\nWWWWWWWW\nWWWWWWWW\nWWWWWWWW\nWWWWWWWW",
"output": "NO"
},
{
"input": "BBBBBBBB\nBBBBBBBB\nBBBBBBBB\nBBBBBBBB\nBBBBBBBB\nBBBBBBBB\nBBBBBBBB\nBBBBBBBB",
"output": "NO"
},
{
"input": "BWBWBWBB\nBWBWBWBB\nBWBWBWBB\nBWBWBWBB\nBWBWBWBB\nBWBWBWBB\nBWBWBWBB\nBWBWBWBB",
"output": "NO"
},
{
"input": "WWBWWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW",
"output": "NO"
},
{
"input": "WWWWWWWW\nBBBBBBBB\nWWWWWWWW\nBBBBBBBB\nWWWWWWWW\nBBBBBBBB\nWWWWWWWW\nBBBBBBBB",
"output": "NO"
},
{
"input": "BBBBBBBB\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB",
"output": "NO"
},
{
"input": "BBBBBBBW\nBBBBBBBW\nBBBBBBBW\nBBBBBBBW\nBBBBBBBW\nBBBBBBBW\nBBBBBBBW\nBBBBBBBW",
"output": "NO"
},
{
"input": "BBBWWWWW\nWWWBBBBB\nBBBWWWWW\nWWWBBBBB\nBWBWBWBW\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB",
"output": "NO"
}
] | 1,664,383,513 | 2,147,483,647 | Python 3 | OK | TESTS | 33 | 92 | 0 | ans = 'YES'
for _ in range(8):
line = input()
for i in range(7):
if line[i] == line[i+1]:
ans = 'NO'
break
print(ans) | Title: Little Elephant and Chess
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Little Elephant loves chess very much.
One day the Little Elephant and his friend decided to play chess. They've got the chess pieces but the board is a problem. They've got an 8<=×<=8 checkered board, each square is painted either black or white. The Little Elephant and his friend know that a proper chessboard doesn't have any side-adjacent cells with the same color and the upper left cell is white. To play chess, they want to make the board they have a proper chessboard. For that the friends can choose any row of the board and cyclically shift the cells of the chosen row, that is, put the last (rightmost) square on the first place in the row and shift the others one position to the right. You can run the described operation multiple times (or not run it at all).
For example, if the first line of the board looks like that "BBBBBBWW" (the white cells of the line are marked with character "W", the black cells are marked with character "B"), then after one cyclic shift it will look like that "WBBBBBBW".
Help the Little Elephant and his friend to find out whether they can use any number of the described operations to turn the board they have into a proper chessboard.
Input Specification:
The input consists of exactly eight lines. Each line contains exactly eight characters "W" or "B" without any spaces: the *j*-th character in the *i*-th line stands for the color of the *j*-th cell of the *i*-th row of the elephants' board. Character "W" stands for the white color, character "B" stands for the black color.
Consider the rows of the board numbered from 1 to 8 from top to bottom, and the columns — from 1 to 8 from left to right. The given board can initially be a proper chessboard.
Output Specification:
In a single line print "YES" (without the quotes), if we can make the board a proper chessboard and "NO" (without the quotes) otherwise.
Demo Input:
['WBWBWBWB\nBWBWBWBW\nBWBWBWBW\nBWBWBWBW\nWBWBWBWB\nWBWBWBWB\nBWBWBWBW\nWBWBWBWB\n', 'WBWBWBWB\nWBWBWBWB\nBBWBWWWB\nBWBWBWBW\nBWBWBWBW\nBWBWBWWW\nBWBWBWBW\nBWBWBWBW\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first sample you should shift the following lines one position to the right: the 3-rd, the 6-th, the 7-th and the 8-th.
In the second sample there is no way you can achieve the goal. | ```python
ans = 'YES'
for _ in range(8):
line = input()
for i in range(7):
if line[i] == line[i+1]:
ans = 'NO'
break
print(ans)
``` | 3 |
|
1,003 | A | Polycarp's Pockets | PROGRAMMING | 800 | [
"implementation"
] | null | null | Polycarp has $n$ coins, the value of the $i$-th coin is $a_i$. Polycarp wants to distribute all the coins between his pockets, but he cannot put two coins with the same value into the same pocket.
For example, if Polycarp has got six coins represented as an array $a = [1, 2, 4, 3, 3, 2]$, he can distribute the coins into two pockets as follows: $[1, 2, 3], [2, 3, 4]$.
Polycarp wants to distribute all the coins with the minimum number of used pockets. Help him to do that. | The first line of the input contains one integer $n$ ($1 \le n \le 100$) — the number of coins.
The second line of the input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$) — values of coins. | Print only one integer — the minimum number of pockets Polycarp needs to distribute all the coins so no two coins with the same value are put into the same pocket. | [
"6\n1 2 4 3 3 2\n",
"1\n100\n"
] | [
"2\n",
"1\n"
] | none | 0 | [
{
"input": "6\n1 2 4 3 3 2",
"output": "2"
},
{
"input": "1\n100",
"output": "1"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "100"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "100"
},
{
"input": "100\n59 47 39 47 47 71 47 28 58 47 35 79 58 47 38 47 47 47 47 27 47 43 29 95 47 49 46 71 47 74 79 47 47 32 45 67 47 47 30 37 47 47 16 67 22 76 47 86 84 10 5 47 47 47 47 47 1 51 47 54 47 8 47 47 9 47 47 47 47 28 47 47 26 47 47 47 47 47 47 92 47 47 77 47 47 24 45 47 10 47 47 89 47 27 47 89 47 67 24 71",
"output": "51"
},
{
"input": "100\n45 99 10 27 16 85 39 38 17 32 15 23 67 48 50 97 42 70 62 30 44 81 64 73 34 22 46 5 83 52 58 60 33 74 47 88 18 61 78 53 25 95 94 31 3 75 1 57 20 54 59 9 68 7 77 43 21 87 86 24 4 80 11 49 2 72 36 84 71 8 65 55 79 100 41 14 35 89 66 69 93 37 56 82 90 91 51 19 26 92 6 96 13 98 12 28 76 40 63 29",
"output": "1"
},
{
"input": "100\n45 29 5 2 6 50 22 36 14 15 9 48 46 20 8 37 7 47 12 50 21 38 18 27 33 19 40 10 5 49 38 42 34 37 27 30 35 24 10 3 40 49 41 3 4 44 13 25 28 31 46 36 23 1 1 23 7 22 35 26 21 16 48 42 32 8 11 16 34 11 39 32 47 28 43 41 39 4 14 19 26 45 13 18 15 25 2 44 17 29 17 33 43 6 12 30 9 20 31 24",
"output": "2"
},
{
"input": "50\n7 7 3 3 7 4 5 6 4 3 7 5 6 4 5 4 4 5 6 7 7 7 4 5 5 5 3 7 6 3 4 6 3 6 4 4 5 4 6 6 3 5 6 3 5 3 3 7 7 6",
"output": "10"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 99 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "99"
},
{
"input": "7\n1 2 3 3 3 1 2",
"output": "3"
},
{
"input": "5\n1 2 3 4 5",
"output": "1"
},
{
"input": "7\n1 2 3 4 5 6 7",
"output": "1"
},
{
"input": "8\n1 2 3 4 5 6 7 8",
"output": "1"
},
{
"input": "9\n1 2 3 4 5 6 7 8 9",
"output": "1"
},
{
"input": "10\n1 2 3 4 5 6 7 8 9 10",
"output": "1"
},
{
"input": "3\n2 1 1",
"output": "2"
},
{
"input": "11\n1 2 3 4 5 6 7 8 9 1 1",
"output": "3"
},
{
"input": "12\n1 2 1 1 1 1 1 1 1 1 1 1",
"output": "11"
},
{
"input": "13\n1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "13"
},
{
"input": "14\n1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "14"
},
{
"input": "15\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "15"
},
{
"input": "16\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "16"
},
{
"input": "3\n1 1 1",
"output": "3"
},
{
"input": "3\n1 2 3",
"output": "1"
},
{
"input": "10\n1 1 1 1 2 2 1 1 9 10",
"output": "6"
},
{
"input": "2\n1 1",
"output": "2"
},
{
"input": "56\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "56"
},
{
"input": "99\n35 96 73 72 70 83 22 93 98 75 45 32 81 82 45 54 25 7 53 72 29 2 94 19 21 98 34 28 39 99 55 85 44 23 6 47 98 2 33 34 19 57 49 35 67 4 60 4 4 23 55 6 57 66 16 68 34 45 84 79 48 63 4 9 46 88 98 13 19 27 83 12 4 63 57 22 44 77 44 62 28 52 44 64 9 24 55 22 48 4 2 9 80 76 45 1 56 22 92",
"output": "6"
},
{
"input": "10\n1 2 2 3 3 3 4 4 4 4",
"output": "4"
},
{
"input": "99\n97 44 33 56 42 10 61 85 64 26 40 39 82 34 75 9 51 51 39 73 58 38 74 31 13 99 58 1 28 89 76 19 52 7 40 56 12 27 72 72 67 75 62 46 22 55 35 16 18 39 60 63 92 42 85 69 34 61 73 50 57 95 30 4 45 63 76 58 32 35 48 81 10 78 95 79 55 97 21 21 22 94 30 17 78 57 89 93 100 44 16 89 68 55 19 46 42 73 21",
"output": "3"
},
{
"input": "5\n5 5 5 5 1",
"output": "4"
},
{
"input": "6\n2 3 2 5 2 6",
"output": "3"
},
{
"input": "3\n58 59 58",
"output": "2"
},
{
"input": "9\n1 2 3 4 5 6 7 8 8",
"output": "2"
},
{
"input": "97\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "97"
},
{
"input": "3\n95 95 4",
"output": "2"
},
{
"input": "3\n2 2 5",
"output": "2"
}
] | 1,646,440,758 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 1 | 77 | 0 | n = int(input())
a = list(map(int, input().split()))
dp = [a.count(i + 1) for i in range(n)]
print(max(dp)) | Title: Polycarp's Pockets
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp has $n$ coins, the value of the $i$-th coin is $a_i$. Polycarp wants to distribute all the coins between his pockets, but he cannot put two coins with the same value into the same pocket.
For example, if Polycarp has got six coins represented as an array $a = [1, 2, 4, 3, 3, 2]$, he can distribute the coins into two pockets as follows: $[1, 2, 3], [2, 3, 4]$.
Polycarp wants to distribute all the coins with the minimum number of used pockets. Help him to do that.
Input Specification:
The first line of the input contains one integer $n$ ($1 \le n \le 100$) — the number of coins.
The second line of the input contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$) — values of coins.
Output Specification:
Print only one integer — the minimum number of pockets Polycarp needs to distribute all the coins so no two coins with the same value are put into the same pocket.
Demo Input:
['6\n1 2 4 3 3 2\n', '1\n100\n']
Demo Output:
['2\n', '1\n']
Note:
none | ```python
n = int(input())
a = list(map(int, input().split()))
dp = [a.count(i + 1) for i in range(n)]
print(max(dp))
``` | 0 |
|
334 | A | Candy Bags | PROGRAMMING | 1,000 | [
"implementation"
] | null | null | Gerald has *n* younger brothers and their number happens to be even. One day he bought *n*2 candy bags. One bag has one candy, one bag has two candies, one bag has three candies and so on. In fact, for each integer *k* from 1 to *n*2 he has exactly one bag with *k* candies.
Help him give *n* bags of candies to each brother so that all brothers got the same number of candies. | The single line contains a single integer *n* (*n* is even, 2<=≤<=*n*<=≤<=100) — the number of Gerald's brothers. | Let's assume that Gerald indexes his brothers with numbers from 1 to *n*. You need to print *n* lines, on the *i*-th line print *n* integers — the numbers of candies in the bags for the *i*-th brother. Naturally, all these numbers should be distinct and be within limits from 1 to *n*2. You can print the numbers in the lines in any order.
It is guaranteed that the solution exists at the given limits. | [
"2\n"
] | [
"1 4\n2 3\n"
] | The sample shows Gerald's actions if he has two brothers. In this case, his bags contain 1, 2, 3 and 4 candies. He can give the bags with 1 and 4 candies to one brother and the bags with 2 and 3 to the other brother. | 500 | [
{
"input": "2",
"output": "1 4\n2 3"
},
{
"input": "4",
"output": "1 16 2 15\n3 14 4 13\n5 12 6 11\n7 10 8 9"
},
{
"input": "6",
"output": "1 36 2 35 3 34\n4 33 5 32 6 31\n7 30 8 29 9 28\n10 27 11 26 12 25\n13 24 14 23 15 22\n16 21 17 20 18 19"
},
{
"input": "8",
"output": "1 64 2 63 3 62 4 61\n5 60 6 59 7 58 8 57\n9 56 10 55 11 54 12 53\n13 52 14 51 15 50 16 49\n17 48 18 47 19 46 20 45\n21 44 22 43 23 42 24 41\n25 40 26 39 27 38 28 37\n29 36 30 35 31 34 32 33"
},
{
"input": "10",
"output": "1 100 2 99 3 98 4 97 5 96\n6 95 7 94 8 93 9 92 10 91\n11 90 12 89 13 88 14 87 15 86\n16 85 17 84 18 83 19 82 20 81\n21 80 22 79 23 78 24 77 25 76\n26 75 27 74 28 73 29 72 30 71\n31 70 32 69 33 68 34 67 35 66\n36 65 37 64 38 63 39 62 40 61\n41 60 42 59 43 58 44 57 45 56\n46 55 47 54 48 53 49 52 50 51"
},
{
"input": "100",
"output": "1 10000 2 9999 3 9998 4 9997 5 9996 6 9995 7 9994 8 9993 9 9992 10 9991 11 9990 12 9989 13 9988 14 9987 15 9986 16 9985 17 9984 18 9983 19 9982 20 9981 21 9980 22 9979 23 9978 24 9977 25 9976 26 9975 27 9974 28 9973 29 9972 30 9971 31 9970 32 9969 33 9968 34 9967 35 9966 36 9965 37 9964 38 9963 39 9962 40 9961 41 9960 42 9959 43 9958 44 9957 45 9956 46 9955 47 9954 48 9953 49 9952 50 9951\n51 9950 52 9949 53 9948 54 9947 55 9946 56 9945 57 9944 58 9943 59 9942 60 9941 61 9940 62 9939 63 9938 64 9937 65 993..."
},
{
"input": "62",
"output": "1 3844 2 3843 3 3842 4 3841 5 3840 6 3839 7 3838 8 3837 9 3836 10 3835 11 3834 12 3833 13 3832 14 3831 15 3830 16 3829 17 3828 18 3827 19 3826 20 3825 21 3824 22 3823 23 3822 24 3821 25 3820 26 3819 27 3818 28 3817 29 3816 30 3815 31 3814\n32 3813 33 3812 34 3811 35 3810 36 3809 37 3808 38 3807 39 3806 40 3805 41 3804 42 3803 43 3802 44 3801 45 3800 46 3799 47 3798 48 3797 49 3796 50 3795 51 3794 52 3793 53 3792 54 3791 55 3790 56 3789 57 3788 58 3787 59 3786 60 3785 61 3784 62 3783\n63 3782 64 3781 65 378..."
},
{
"input": "66",
"output": "1 4356 2 4355 3 4354 4 4353 5 4352 6 4351 7 4350 8 4349 9 4348 10 4347 11 4346 12 4345 13 4344 14 4343 15 4342 16 4341 17 4340 18 4339 19 4338 20 4337 21 4336 22 4335 23 4334 24 4333 25 4332 26 4331 27 4330 28 4329 29 4328 30 4327 31 4326 32 4325 33 4324\n34 4323 35 4322 36 4321 37 4320 38 4319 39 4318 40 4317 41 4316 42 4315 43 4314 44 4313 45 4312 46 4311 47 4310 48 4309 49 4308 50 4307 51 4306 52 4305 53 4304 54 4303 55 4302 56 4301 57 4300 58 4299 59 4298 60 4297 61 4296 62 4295 63 4294 64 4293 65 4292..."
},
{
"input": "18",
"output": "1 324 2 323 3 322 4 321 5 320 6 319 7 318 8 317 9 316\n10 315 11 314 12 313 13 312 14 311 15 310 16 309 17 308 18 307\n19 306 20 305 21 304 22 303 23 302 24 301 25 300 26 299 27 298\n28 297 29 296 30 295 31 294 32 293 33 292 34 291 35 290 36 289\n37 288 38 287 39 286 40 285 41 284 42 283 43 282 44 281 45 280\n46 279 47 278 48 277 49 276 50 275 51 274 52 273 53 272 54 271\n55 270 56 269 57 268 58 267 59 266 60 265 61 264 62 263 63 262\n64 261 65 260 66 259 67 258 68 257 69 256 70 255 71 254 72 253\n73 252 7..."
},
{
"input": "68",
"output": "1 4624 2 4623 3 4622 4 4621 5 4620 6 4619 7 4618 8 4617 9 4616 10 4615 11 4614 12 4613 13 4612 14 4611 15 4610 16 4609 17 4608 18 4607 19 4606 20 4605 21 4604 22 4603 23 4602 24 4601 25 4600 26 4599 27 4598 28 4597 29 4596 30 4595 31 4594 32 4593 33 4592 34 4591\n35 4590 36 4589 37 4588 38 4587 39 4586 40 4585 41 4584 42 4583 43 4582 44 4581 45 4580 46 4579 47 4578 48 4577 49 4576 50 4575 51 4574 52 4573 53 4572 54 4571 55 4570 56 4569 57 4568 58 4567 59 4566 60 4565 61 4564 62 4563 63 4562 64 4561 65 4560..."
},
{
"input": "86",
"output": "1 7396 2 7395 3 7394 4 7393 5 7392 6 7391 7 7390 8 7389 9 7388 10 7387 11 7386 12 7385 13 7384 14 7383 15 7382 16 7381 17 7380 18 7379 19 7378 20 7377 21 7376 22 7375 23 7374 24 7373 25 7372 26 7371 27 7370 28 7369 29 7368 30 7367 31 7366 32 7365 33 7364 34 7363 35 7362 36 7361 37 7360 38 7359 39 7358 40 7357 41 7356 42 7355 43 7354\n44 7353 45 7352 46 7351 47 7350 48 7349 49 7348 50 7347 51 7346 52 7345 53 7344 54 7343 55 7342 56 7341 57 7340 58 7339 59 7338 60 7337 61 7336 62 7335 63 7334 64 7333 65 7332..."
},
{
"input": "96",
"output": "1 9216 2 9215 3 9214 4 9213 5 9212 6 9211 7 9210 8 9209 9 9208 10 9207 11 9206 12 9205 13 9204 14 9203 15 9202 16 9201 17 9200 18 9199 19 9198 20 9197 21 9196 22 9195 23 9194 24 9193 25 9192 26 9191 27 9190 28 9189 29 9188 30 9187 31 9186 32 9185 33 9184 34 9183 35 9182 36 9181 37 9180 38 9179 39 9178 40 9177 41 9176 42 9175 43 9174 44 9173 45 9172 46 9171 47 9170 48 9169\n49 9168 50 9167 51 9166 52 9165 53 9164 54 9163 55 9162 56 9161 57 9160 58 9159 59 9158 60 9157 61 9156 62 9155 63 9154 64 9153 65 9152..."
},
{
"input": "12",
"output": "1 144 2 143 3 142 4 141 5 140 6 139\n7 138 8 137 9 136 10 135 11 134 12 133\n13 132 14 131 15 130 16 129 17 128 18 127\n19 126 20 125 21 124 22 123 23 122 24 121\n25 120 26 119 27 118 28 117 29 116 30 115\n31 114 32 113 33 112 34 111 35 110 36 109\n37 108 38 107 39 106 40 105 41 104 42 103\n43 102 44 101 45 100 46 99 47 98 48 97\n49 96 50 95 51 94 52 93 53 92 54 91\n55 90 56 89 57 88 58 87 59 86 60 85\n61 84 62 83 63 82 64 81 65 80 66 79\n67 78 68 77 69 76 70 75 71 74 72 73"
},
{
"input": "88",
"output": "1 7744 2 7743 3 7742 4 7741 5 7740 6 7739 7 7738 8 7737 9 7736 10 7735 11 7734 12 7733 13 7732 14 7731 15 7730 16 7729 17 7728 18 7727 19 7726 20 7725 21 7724 22 7723 23 7722 24 7721 25 7720 26 7719 27 7718 28 7717 29 7716 30 7715 31 7714 32 7713 33 7712 34 7711 35 7710 36 7709 37 7708 38 7707 39 7706 40 7705 41 7704 42 7703 43 7702 44 7701\n45 7700 46 7699 47 7698 48 7697 49 7696 50 7695 51 7694 52 7693 53 7692 54 7691 55 7690 56 7689 57 7688 58 7687 59 7686 60 7685 61 7684 62 7683 63 7682 64 7681 65 7680..."
},
{
"input": "28",
"output": "1 784 2 783 3 782 4 781 5 780 6 779 7 778 8 777 9 776 10 775 11 774 12 773 13 772 14 771\n15 770 16 769 17 768 18 767 19 766 20 765 21 764 22 763 23 762 24 761 25 760 26 759 27 758 28 757\n29 756 30 755 31 754 32 753 33 752 34 751 35 750 36 749 37 748 38 747 39 746 40 745 41 744 42 743\n43 742 44 741 45 740 46 739 47 738 48 737 49 736 50 735 51 734 52 733 53 732 54 731 55 730 56 729\n57 728 58 727 59 726 60 725 61 724 62 723 63 722 64 721 65 720 66 719 67 718 68 717 69 716 70 715\n71 714 72 713 73 712 74 7..."
},
{
"input": "80",
"output": "1 6400 2 6399 3 6398 4 6397 5 6396 6 6395 7 6394 8 6393 9 6392 10 6391 11 6390 12 6389 13 6388 14 6387 15 6386 16 6385 17 6384 18 6383 19 6382 20 6381 21 6380 22 6379 23 6378 24 6377 25 6376 26 6375 27 6374 28 6373 29 6372 30 6371 31 6370 32 6369 33 6368 34 6367 35 6366 36 6365 37 6364 38 6363 39 6362 40 6361\n41 6360 42 6359 43 6358 44 6357 45 6356 46 6355 47 6354 48 6353 49 6352 50 6351 51 6350 52 6349 53 6348 54 6347 55 6346 56 6345 57 6344 58 6343 59 6342 60 6341 61 6340 62 6339 63 6338 64 6337 65 6336..."
},
{
"input": "48",
"output": "1 2304 2 2303 3 2302 4 2301 5 2300 6 2299 7 2298 8 2297 9 2296 10 2295 11 2294 12 2293 13 2292 14 2291 15 2290 16 2289 17 2288 18 2287 19 2286 20 2285 21 2284 22 2283 23 2282 24 2281\n25 2280 26 2279 27 2278 28 2277 29 2276 30 2275 31 2274 32 2273 33 2272 34 2271 35 2270 36 2269 37 2268 38 2267 39 2266 40 2265 41 2264 42 2263 43 2262 44 2261 45 2260 46 2259 47 2258 48 2257\n49 2256 50 2255 51 2254 52 2253 53 2252 54 2251 55 2250 56 2249 57 2248 58 2247 59 2246 60 2245 61 2244 62 2243 63 2242 64 2241 65 224..."
},
{
"input": "54",
"output": "1 2916 2 2915 3 2914 4 2913 5 2912 6 2911 7 2910 8 2909 9 2908 10 2907 11 2906 12 2905 13 2904 14 2903 15 2902 16 2901 17 2900 18 2899 19 2898 20 2897 21 2896 22 2895 23 2894 24 2893 25 2892 26 2891 27 2890\n28 2889 29 2888 30 2887 31 2886 32 2885 33 2884 34 2883 35 2882 36 2881 37 2880 38 2879 39 2878 40 2877 41 2876 42 2875 43 2874 44 2873 45 2872 46 2871 47 2870 48 2869 49 2868 50 2867 51 2866 52 2865 53 2864 54 2863\n55 2862 56 2861 57 2860 58 2859 59 2858 60 2857 61 2856 62 2855 63 2854 64 2853 65 285..."
},
{
"input": "58",
"output": "1 3364 2 3363 3 3362 4 3361 5 3360 6 3359 7 3358 8 3357 9 3356 10 3355 11 3354 12 3353 13 3352 14 3351 15 3350 16 3349 17 3348 18 3347 19 3346 20 3345 21 3344 22 3343 23 3342 24 3341 25 3340 26 3339 27 3338 28 3337 29 3336\n30 3335 31 3334 32 3333 33 3332 34 3331 35 3330 36 3329 37 3328 38 3327 39 3326 40 3325 41 3324 42 3323 43 3322 44 3321 45 3320 46 3319 47 3318 48 3317 49 3316 50 3315 51 3314 52 3313 53 3312 54 3311 55 3310 56 3309 57 3308 58 3307\n59 3306 60 3305 61 3304 62 3303 63 3302 64 3301 65 330..."
},
{
"input": "64",
"output": "1 4096 2 4095 3 4094 4 4093 5 4092 6 4091 7 4090 8 4089 9 4088 10 4087 11 4086 12 4085 13 4084 14 4083 15 4082 16 4081 17 4080 18 4079 19 4078 20 4077 21 4076 22 4075 23 4074 24 4073 25 4072 26 4071 27 4070 28 4069 29 4068 30 4067 31 4066 32 4065\n33 4064 34 4063 35 4062 36 4061 37 4060 38 4059 39 4058 40 4057 41 4056 42 4055 43 4054 44 4053 45 4052 46 4051 47 4050 48 4049 49 4048 50 4047 51 4046 52 4045 53 4044 54 4043 55 4042 56 4041 57 4040 58 4039 59 4038 60 4037 61 4036 62 4035 63 4034 64 4033\n65 403..."
},
{
"input": "44",
"output": "1 1936 2 1935 3 1934 4 1933 5 1932 6 1931 7 1930 8 1929 9 1928 10 1927 11 1926 12 1925 13 1924 14 1923 15 1922 16 1921 17 1920 18 1919 19 1918 20 1917 21 1916 22 1915\n23 1914 24 1913 25 1912 26 1911 27 1910 28 1909 29 1908 30 1907 31 1906 32 1905 33 1904 34 1903 35 1902 36 1901 37 1900 38 1899 39 1898 40 1897 41 1896 42 1895 43 1894 44 1893\n45 1892 46 1891 47 1890 48 1889 49 1888 50 1887 51 1886 52 1885 53 1884 54 1883 55 1882 56 1881 57 1880 58 1879 59 1878 60 1877 61 1876 62 1875 63 1874 64 1873 65 187..."
}
] | 1,506,868,091 | 2,147,483,647 | Python 3 | OK | TESTS | 21 | 124 | 204,800 | import math
n = int(input())
bags = int(math.pow(n,2))
#candies = math.factorial(bags)
n_bags = []
for j in range (n):
n_bags.append("")
for i in range(int(n/2)):
n_bags[j] += str((i*n)+j+1)
n_bags[j] += " "
n_bags[j] += str(bags-(j+(i*n)))
n_bags[j] += " "
#n_bags[j].append((i*n)+j+1)
#n_bags[j].append(bags-(j+(i*n)))
print (n_bags[j])
| Title: Candy Bags
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Gerald has *n* younger brothers and their number happens to be even. One day he bought *n*2 candy bags. One bag has one candy, one bag has two candies, one bag has three candies and so on. In fact, for each integer *k* from 1 to *n*2 he has exactly one bag with *k* candies.
Help him give *n* bags of candies to each brother so that all brothers got the same number of candies.
Input Specification:
The single line contains a single integer *n* (*n* is even, 2<=≤<=*n*<=≤<=100) — the number of Gerald's brothers.
Output Specification:
Let's assume that Gerald indexes his brothers with numbers from 1 to *n*. You need to print *n* lines, on the *i*-th line print *n* integers — the numbers of candies in the bags for the *i*-th brother. Naturally, all these numbers should be distinct and be within limits from 1 to *n*2. You can print the numbers in the lines in any order.
It is guaranteed that the solution exists at the given limits.
Demo Input:
['2\n']
Demo Output:
['1 4\n2 3\n']
Note:
The sample shows Gerald's actions if he has two brothers. In this case, his bags contain 1, 2, 3 and 4 candies. He can give the bags with 1 and 4 candies to one brother and the bags with 2 and 3 to the other brother. | ```python
import math
n = int(input())
bags = int(math.pow(n,2))
#candies = math.factorial(bags)
n_bags = []
for j in range (n):
n_bags.append("")
for i in range(int(n/2)):
n_bags[j] += str((i*n)+j+1)
n_bags[j] += " "
n_bags[j] += str(bags-(j+(i*n)))
n_bags[j] += " "
#n_bags[j].append((i*n)+j+1)
#n_bags[j].append(bags-(j+(i*n)))
print (n_bags[j])
``` | 3 |
|
225 | A | Dice Tower | PROGRAMMING | 1,100 | [
"constructive algorithms",
"greedy"
] | null | null | A dice is a cube, its faces contain distinct integers from 1 to 6 as black points. The sum of numbers at the opposite dice faces always equals 7. Please note that there are only two dice (these dices are mirror of each other) that satisfy the given constraints (both of them are shown on the picture on the left).
Alice and Bob play dice. Alice has built a tower from *n* dice. We know that in this tower the adjacent dice contact with faces with distinct numbers. Bob wants to uniquely identify the numbers written on the faces of all dice, from which the tower is built. Unfortunately, Bob is looking at the tower from the face, and so he does not see all the numbers on the faces. Bob sees the number on the top of the tower and the numbers on the two adjacent sides (on the right side of the picture shown what Bob sees).
Help Bob, tell whether it is possible to uniquely identify the numbers on the faces of all the dice in the tower, or not. | The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of dice in the tower.
The second line contains an integer *x* (1<=≤<=*x*<=≤<=6) — the number Bob sees at the top of the tower. Next *n* lines contain two space-separated integers each: the *i*-th line contains numbers *a**i*,<=*b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=6; *a**i*<=≠<=*b**i*) — the numbers Bob sees on the two sidelong faces of the *i*-th dice in the tower.
Consider the dice in the tower indexed from top to bottom from 1 to *n*. That is, the topmost dice has index 1 (the dice whose top face Bob can see). It is guaranteed that it is possible to make a dice tower that will look as described in the input. | Print "YES" (without the quotes), if it is possible to to uniquely identify the numbers on the faces of all the dice in the tower. If it is impossible, print "NO" (without the quotes). | [
"3\n6\n3 2\n5 4\n2 4\n",
"3\n3\n2 6\n4 1\n5 3\n"
] | [
"YES",
"NO"
] | none | 500 | [
{
"input": "3\n6\n3 2\n5 4\n2 4",
"output": "YES"
},
{
"input": "3\n3\n2 6\n4 1\n5 3",
"output": "NO"
},
{
"input": "1\n3\n2 1",
"output": "YES"
},
{
"input": "2\n2\n3 1\n1 5",
"output": "NO"
},
{
"input": "3\n2\n1 4\n5 3\n6 4",
"output": "NO"
},
{
"input": "4\n3\n5 6\n1 3\n1 5\n4 1",
"output": "NO"
},
{
"input": "2\n2\n3 1\n1 3",
"output": "YES"
},
{
"input": "3\n2\n1 4\n3 1\n4 6",
"output": "YES"
},
{
"input": "4\n3\n5 6\n1 5\n5 1\n1 5",
"output": "YES"
},
{
"input": "5\n1\n2 3\n5 3\n5 4\n5 1\n3 5",
"output": "NO"
},
{
"input": "10\n5\n1 3\n2 3\n6 5\n6 5\n4 5\n1 3\n1 2\n3 2\n4 2\n1 2",
"output": "NO"
},
{
"input": "15\n4\n2 1\n2 4\n6 4\n5 3\n4 1\n4 2\n6 3\n4 5\n3 5\n2 6\n5 6\n1 5\n3 5\n6 4\n3 2",
"output": "NO"
},
{
"input": "20\n6\n3 2\n4 6\n3 6\n6 4\n5 1\n1 5\n2 6\n1 2\n1 4\n5 3\n2 3\n6 2\n5 4\n2 6\n1 3\n4 6\n4 5\n6 3\n3 1\n6 2",
"output": "NO"
},
{
"input": "25\n4\n1 2\n4 1\n3 5\n2 1\n3 5\n6 5\n3 5\n5 6\n1 2\n2 4\n6 2\n2 3\n2 4\n6 5\n2 3\n6 3\n2 3\n1 3\n2 1\n3 1\n5 6\n3 1\n6 4\n3 6\n2 3",
"output": "NO"
},
{
"input": "100\n3\n6 5\n5 1\n3 2\n1 5\n3 6\n5 4\n2 6\n4 1\n6 3\n4 5\n1 5\n1 4\n4 2\n2 6\n5 4\n4 1\n1 3\n6 5\n5 1\n2 1\n2 4\n2 1\n3 6\n4 1\n6 3\n2 3\n5 1\n2 6\n6 4\n3 5\n4 1\n6 5\n1 5\n1 5\n2 3\n4 1\n5 3\n6 4\n1 3\n5 3\n4 1\n1 4\n2 1\n6 2\n1 5\n6 2\n6 2\n4 5\n4 2\n5 6\n6 3\n1 3\n2 3\n5 4\n6 5\n3 1\n1 2\n4 1\n1 3\n1 3\n6 5\n4 6\n3 1\n2 1\n2 3\n3 2\n4 1\n1 5\n4 1\n6 3\n1 5\n4 5\n4 2\n4 5\n2 6\n2 1\n3 5\n4 6\n4 2\n4 5\n2 4\n3 1\n6 4\n5 6\n3 1\n1 4\n4 5\n6 3\n6 3\n2 1\n5 1\n3 6\n3 5\n2 1\n4 6\n4 2\n5 6\n3 1\n3 5\n3 6",
"output": "NO"
},
{
"input": "99\n3\n2 1\n6 2\n3 6\n1 3\n5 1\n2 6\n4 6\n6 4\n6 4\n6 5\n3 6\n2 6\n1 5\n2 3\n4 6\n1 4\n4 1\n2 3\n4 5\n4 1\n5 1\n1 2\n6 5\n4 6\n6 5\n6 2\n3 6\n6 4\n2 1\n3 1\n2 1\n6 2\n3 5\n4 1\n5 3\n3 1\n1 5\n3 6\n6 2\n1 5\n2 1\n5 1\n4 1\n2 6\n5 4\n4 2\n2 1\n1 5\n1 3\n4 6\n4 6\n4 5\n2 3\n6 2\n3 2\n2 1\n4 6\n6 2\n3 5\n3 6\n3 1\n2 3\n2 1\n3 6\n6 5\n6 3\n1 2\n5 1\n1 4\n6 2\n5 3\n1 3\n5 4\n2 3\n6 3\n1 5\n1 2\n2 6\n5 6\n5 6\n3 5\n3 1\n4 6\n3 1\n4 5\n4 2\n3 5\n6 2\n2 4\n4 6\n6 2\n4 2\n2 3\n2 4\n1 5\n1 4\n3 5\n1 2\n4 5",
"output": "NO"
},
{
"input": "98\n6\n4 2\n1 2\n3 2\n2 1\n2 1\n3 2\n2 3\n6 5\n4 6\n1 5\n4 5\n5 1\n6 5\n1 4\n1 2\n2 4\n6 5\n4 5\n4 6\n3 1\n2 3\n4 1\n4 2\n6 5\n3 2\n4 2\n5 1\n2 4\n1 3\n4 5\n3 2\n1 2\n3 1\n3 2\n3 6\n6 4\n3 6\n3 5\n4 6\n6 5\n3 5\n3 2\n4 2\n6 4\n1 3\n2 4\n5 3\n2 3\n1 3\n5 6\n5 3\n5 3\n4 6\n4 6\n3 6\n4 1\n6 5\n6 2\n1 5\n2 1\n6 2\n5 4\n6 3\n1 5\n2 3\n2 6\n5 6\n2 6\n5 1\n3 2\n6 2\n6 2\n1 2\n2 1\n3 5\n2 1\n4 6\n1 4\n4 5\n3 2\n3 2\n5 4\n1 3\n5 1\n2 3\n6 2\n2 6\n1 5\n5 1\n5 4\n5 1\n5 4\n2 1\n6 5\n1 4\n6 5\n1 2\n3 5",
"output": "NO"
},
{
"input": "97\n3\n2 1\n6 5\n4 1\n6 5\n3 2\n1 2\n6 3\n6 4\n6 3\n1 3\n1 3\n3 1\n3 6\n3 2\n5 6\n4 2\n3 6\n1 5\n2 6\n3 2\n6 2\n2 1\n2 4\n1 3\n3 1\n2 6\n3 6\n4 6\n6 2\n5 1\n6 3\n2 6\n3 6\n2 4\n4 5\n6 5\n4 1\n5 6\n6 2\n5 4\n5 1\n6 5\n1 4\n2 1\n4 5\n4 5\n4 1\n5 4\n1 4\n2 6\n2 6\n1 5\n5 6\n3 2\n2 3\n1 4\n4 1\n3 6\n6 2\n5 3\n6 2\n4 5\n6 2\n2 6\n6 5\n1 4\n2 6\n3 5\n2 6\n4 1\n4 5\n1 3\n4 2\n3 2\n1 2\n5 6\n1 5\n3 5\n2 1\n1 2\n1 2\n6 4\n5 1\n1 2\n2 4\n6 3\n4 5\n1 5\n4 2\n5 1\n3 1\n6 4\n4 2\n1 5\n4 6\n2 1\n2 6",
"output": "NO"
},
{
"input": "96\n4\n1 5\n1 5\n4 6\n1 2\n4 2\n3 2\n4 6\n6 4\n6 3\n6 2\n4 1\n6 4\n5 1\n2 4\n5 6\n6 5\n3 2\n6 2\n3 1\n1 4\n3 2\n6 2\n2 4\n1 3\n5 4\n1 3\n6 2\n6 2\n5 6\n1 4\n4 2\n6 2\n3 1\n6 5\n3 1\n4 2\n6 3\n3 2\n3 6\n1 3\n5 6\n6 4\n1 4\n5 4\n2 6\n3 5\n5 4\n5 1\n2 4\n1 5\n1 3\n1 2\n1 3\n6 4\n6 3\n4 5\n4 1\n3 6\n1 2\n6 4\n1 2\n2 3\n2 1\n4 6\n1 3\n5 1\n4 5\n5 4\n6 3\n2 6\n5 1\n6 2\n3 1\n3 1\n5 4\n3 1\n5 6\n2 6\n5 6\n4 2\n6 5\n3 2\n6 5\n2 3\n6 4\n6 2\n1 2\n4 1\n1 2\n6 3\n2 1\n5 1\n6 5\n5 4\n4 5\n1 2",
"output": "NO"
},
{
"input": "5\n1\n2 3\n3 5\n4 5\n5 4\n5 3",
"output": "YES"
},
{
"input": "10\n5\n1 3\n3 1\n6 3\n6 3\n4 6\n3 1\n1 4\n3 1\n4 6\n1 3",
"output": "YES"
},
{
"input": "15\n4\n2 1\n2 6\n6 5\n5 1\n1 5\n2 1\n6 5\n5 1\n5 1\n6 2\n6 5\n5 1\n5 1\n6 5\n2 6",
"output": "YES"
},
{
"input": "20\n6\n3 2\n4 2\n3 5\n4 2\n5 3\n5 4\n2 3\n2 3\n4 5\n3 5\n3 2\n2 4\n4 5\n2 4\n3 2\n4 2\n5 4\n3 2\n3 5\n2 4",
"output": "YES"
},
{
"input": "25\n4\n1 2\n1 5\n5 6\n1 2\n5 1\n5 6\n5 1\n6 5\n2 1\n2 6\n2 6\n2 6\n2 6\n5 6\n2 6\n6 5\n2 1\n1 5\n1 2\n1 2\n6 5\n1 2\n6 5\n6 2\n2 6",
"output": "YES"
},
{
"input": "100\n3\n6 5\n1 5\n2 1\n5 1\n6 5\n5 1\n6 2\n1 2\n6 5\n5 1\n5 1\n1 5\n2 6\n6 2\n5 6\n1 2\n1 5\n5 6\n1 5\n1 2\n2 6\n1 2\n6 2\n1 5\n6 2\n2 6\n1 5\n6 2\n6 5\n5 6\n1 5\n5 6\n5 1\n5 1\n2 1\n1 2\n5 6\n6 5\n1 5\n5 1\n1 2\n1 5\n1 2\n2 6\n5 1\n2 6\n2 6\n5 6\n2 6\n6 5\n6 5\n1 5\n2 1\n5 6\n5 6\n1 2\n2 1\n1 2\n1 2\n1 2\n5 6\n6 2\n1 5\n1 2\n2 1\n2 6\n1 2\n5 1\n1 5\n6 5\n5 1\n5 1\n2 6\n5 6\n6 2\n1 2\n5 1\n6 2\n2 1\n5 6\n2 1\n1 5\n6 5\n6 5\n1 2\n1 2\n5 1\n6 2\n6 2\n1 2\n1 5\n6 5\n5 6\n1 2\n6 5\n2 1\n6 5\n1 5\n5 6\n6 5",
"output": "YES"
},
{
"input": "99\n3\n2 1\n2 6\n6 2\n1 5\n1 5\n6 2\n6 5\n6 5\n6 2\n5 6\n6 5\n6 2\n5 1\n2 6\n6 5\n1 5\n1 5\n2 6\n5 1\n1 5\n1 5\n2 1\n5 6\n6 5\n5 6\n2 6\n6 2\n6 5\n1 2\n1 2\n1 2\n2 6\n5 6\n1 2\n5 6\n1 2\n5 1\n6 5\n2 6\n5 1\n1 2\n1 5\n1 5\n6 2\n5 1\n2 6\n1 2\n5 1\n1 5\n6 5\n6 5\n5 6\n2 1\n2 6\n2 6\n1 2\n6 2\n2 6\n5 6\n6 5\n1 5\n2 1\n1 2\n6 2\n5 6\n6 5\n2 1\n1 5\n1 5\n2 6\n5 1\n1 2\n5 6\n2 1\n6 5\n5 1\n2 1\n6 2\n6 5\n6 5\n5 6\n1 2\n6 5\n1 2\n5 1\n2 1\n5 1\n2 6\n2 1\n6 2\n2 6\n2 6\n2 1\n2 1\n5 1\n1 5\n5 6\n2 1\n5 6",
"output": "YES"
},
{
"input": "98\n6\n4 2\n2 3\n2 3\n2 3\n2 3\n2 3\n3 2\n5 4\n4 2\n5 4\n5 4\n5 4\n5 3\n4 5\n2 3\n4 2\n5 3\n5 4\n4 5\n3 5\n3 2\n4 2\n2 4\n5 4\n2 3\n2 4\n5 4\n4 2\n3 5\n5 4\n2 3\n2 4\n3 5\n2 3\n3 5\n4 2\n3 5\n5 3\n4 2\n5 3\n5 3\n2 3\n2 4\n4 5\n3 2\n4 2\n3 5\n3 2\n3 5\n5 4\n3 5\n3 5\n4 2\n4 2\n3 2\n4 5\n5 4\n2 3\n5 4\n2 4\n2 3\n4 5\n3 5\n5 4\n3 2\n2 3\n5 3\n2 3\n5 3\n2 3\n2 3\n2 4\n2 3\n2 3\n5 3\n2 3\n4 2\n4 2\n5 4\n2 3\n2 3\n4 5\n3 2\n5 3\n3 2\n2 4\n2 4\n5 3\n5 4\n4 5\n5 3\n4 5\n2 4\n5 3\n4 2\n5 4\n2 4\n5 3",
"output": "YES"
},
{
"input": "97\n3\n2 1\n5 6\n1 2\n5 6\n2 6\n2 1\n6 2\n6 5\n6 2\n1 5\n1 2\n1 2\n6 2\n2 6\n6 5\n2 6\n6 5\n5 1\n6 2\n2 6\n2 6\n1 2\n2 6\n1 2\n1 5\n6 2\n6 5\n6 5\n2 6\n1 5\n6 5\n6 2\n6 2\n2 6\n5 6\n5 6\n1 5\n6 5\n2 6\n5 6\n1 5\n5 6\n1 5\n1 2\n5 1\n5 1\n1 5\n5 1\n1 5\n6 2\n6 2\n5 1\n6 5\n2 1\n2 6\n1 5\n1 5\n6 2\n2 6\n5 6\n2 6\n5 6\n2 6\n6 2\n5 6\n1 2\n6 2\n5 6\n6 2\n1 5\n5 6\n1 5\n2 6\n2 6\n2 1\n6 5\n5 1\n5 1\n1 2\n2 1\n2 1\n6 2\n1 5\n2 1\n2 1\n6 2\n5 1\n5 1\n2 6\n1 5\n1 2\n6 2\n2 6\n5 1\n6 5\n1 2\n6 2",
"output": "YES"
},
{
"input": "96\n4\n1 5\n5 1\n6 5\n2 1\n2 1\n2 6\n6 5\n6 5\n6 2\n2 6\n1 5\n6 5\n1 5\n2 6\n6 5\n5 6\n2 1\n2 6\n1 2\n1 5\n2 6\n2 6\n2 1\n1 5\n5 1\n1 2\n2 6\n2 6\n6 5\n1 5\n2 1\n2 6\n1 2\n5 6\n1 5\n2 6\n6 2\n2 6\n6 5\n1 5\n6 5\n6 5\n1 5\n5 1\n6 2\n5 1\n5 1\n1 5\n2 6\n5 1\n1 5\n2 1\n1 2\n6 2\n6 2\n5 6\n1 5\n6 5\n2 1\n6 5\n2 1\n2 1\n1 2\n6 2\n1 2\n1 5\n5 1\n5 6\n6 5\n6 2\n1 5\n2 6\n1 2\n1 2\n5 1\n1 5\n6 5\n6 2\n6 5\n2 6\n5 6\n2 1\n5 6\n2 1\n6 5\n2 6\n2 1\n1 5\n2 1\n6 2\n1 2\n1 5\n5 6\n5 1\n5 6\n2 1",
"output": "YES"
},
{
"input": "3\n6\n3 2\n5 4\n2 6",
"output": "NO"
},
{
"input": "4\n1\n2 3\n2 3\n2 3\n1 3",
"output": "NO"
},
{
"input": "2\n6\n3 2\n6 4",
"output": "NO"
},
{
"input": "3\n6\n3 2\n5 6\n2 4",
"output": "NO"
},
{
"input": "2\n5\n6 3\n4 5",
"output": "NO"
},
{
"input": "2\n6\n3 2\n6 5",
"output": "NO"
},
{
"input": "2\n1\n3 2\n1 2",
"output": "NO"
},
{
"input": "2\n3\n5 1\n3 5",
"output": "NO"
},
{
"input": "2\n1\n2 3\n1 2",
"output": "NO"
},
{
"input": "2\n1\n2 3\n2 1",
"output": "NO"
},
{
"input": "3\n1\n4 5\n4 1\n4 5",
"output": "NO"
},
{
"input": "2\n4\n2 6\n5 4",
"output": "NO"
},
{
"input": "2\n6\n3 2\n6 2",
"output": "NO"
},
{
"input": "2\n3\n2 1\n3 5",
"output": "NO"
},
{
"input": "2\n3\n1 2\n3 1",
"output": "NO"
},
{
"input": "2\n3\n2 6\n5 3",
"output": "NO"
},
{
"input": "3\n3\n1 2\n3 2\n3 1",
"output": "NO"
},
{
"input": "3\n5\n3 1\n1 3\n2 3",
"output": "NO"
},
{
"input": "2\n6\n2 4\n6 5",
"output": "NO"
},
{
"input": "2\n6\n4 5\n6 5",
"output": "NO"
},
{
"input": "2\n6\n3 5\n3 6",
"output": "NO"
},
{
"input": "2\n4\n1 2\n4 5",
"output": "NO"
},
{
"input": "2\n3\n2 6\n3 1",
"output": "NO"
}
] | 1,697,995,328 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 30 | 0 | n = int(input())
x = int(input())
prev_faces = [7 - x] # Initialize the previous top face as the opposite of x
for _ in range(n):
a, b = map(int, input().split())
if a == prev_faces[-1] or b == prev_faces[-1] or a + b == 7:
print("NO")
break
prev_faces.append(b)
else:
print("YES") | Title: Dice Tower
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A dice is a cube, its faces contain distinct integers from 1 to 6 as black points. The sum of numbers at the opposite dice faces always equals 7. Please note that there are only two dice (these dices are mirror of each other) that satisfy the given constraints (both of them are shown on the picture on the left).
Alice and Bob play dice. Alice has built a tower from *n* dice. We know that in this tower the adjacent dice contact with faces with distinct numbers. Bob wants to uniquely identify the numbers written on the faces of all dice, from which the tower is built. Unfortunately, Bob is looking at the tower from the face, and so he does not see all the numbers on the faces. Bob sees the number on the top of the tower and the numbers on the two adjacent sides (on the right side of the picture shown what Bob sees).
Help Bob, tell whether it is possible to uniquely identify the numbers on the faces of all the dice in the tower, or not.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of dice in the tower.
The second line contains an integer *x* (1<=≤<=*x*<=≤<=6) — the number Bob sees at the top of the tower. Next *n* lines contain two space-separated integers each: the *i*-th line contains numbers *a**i*,<=*b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=6; *a**i*<=≠<=*b**i*) — the numbers Bob sees on the two sidelong faces of the *i*-th dice in the tower.
Consider the dice in the tower indexed from top to bottom from 1 to *n*. That is, the topmost dice has index 1 (the dice whose top face Bob can see). It is guaranteed that it is possible to make a dice tower that will look as described in the input.
Output Specification:
Print "YES" (without the quotes), if it is possible to to uniquely identify the numbers on the faces of all the dice in the tower. If it is impossible, print "NO" (without the quotes).
Demo Input:
['3\n6\n3 2\n5 4\n2 4\n', '3\n3\n2 6\n4 1\n5 3\n']
Demo Output:
['YES', 'NO']
Note:
none | ```python
n = int(input())
x = int(input())
prev_faces = [7 - x] # Initialize the previous top face as the opposite of x
for _ in range(n):
a, b = map(int, input().split())
if a == prev_faces[-1] or b == prev_faces[-1] or a + b == 7:
print("NO")
break
prev_faces.append(b)
else:
print("YES")
``` | 0 |
|
508 | A | Pasha and Pixels | PROGRAMMING | 1,100 | [
"brute force"
] | null | null | Pasha loves his phone and also putting his hair up... But the hair is now irrelevant.
Pasha has installed a new game to his phone. The goal of the game is following. There is a rectangular field consisting of *n* row with *m* pixels in each row. Initially, all the pixels are colored white. In one move, Pasha can choose any pixel and color it black. In particular, he can choose the pixel that is already black, then after the boy's move the pixel does not change, that is, it remains black. Pasha loses the game when a 2<=×<=2 square consisting of black pixels is formed.
Pasha has made a plan of *k* moves, according to which he will paint pixels. Each turn in his plan is represented as a pair of numbers *i* and *j*, denoting respectively the row and the column of the pixel to be colored on the current move.
Determine whether Pasha loses if he acts in accordance with his plan, and if he does, on what move the 2<=×<=2 square consisting of black pixels is formed. | The first line of the input contains three integers *n*,<=*m*,<=*k* (1<=≤<=*n*,<=*m*<=≤<=1000, 1<=≤<=*k*<=≤<=105) — the number of rows, the number of columns and the number of moves that Pasha is going to perform.
The next *k* lines contain Pasha's moves in the order he makes them. Each line contains two integers *i* and *j* (1<=≤<=*i*<=≤<=*n*, 1<=≤<=*j*<=≤<=*m*), representing the row number and column number of the pixel that was painted during a move. | If Pasha loses, print the number of the move when the 2<=×<=2 square consisting of black pixels is formed.
If Pasha doesn't lose, that is, no 2<=×<=2 square consisting of black pixels is formed during the given *k* moves, print 0. | [
"2 2 4\n1 1\n1 2\n2 1\n2 2\n",
"2 3 6\n2 3\n2 2\n1 3\n2 2\n1 2\n1 1\n",
"5 3 7\n2 3\n1 2\n1 1\n4 1\n3 1\n5 3\n3 2\n"
] | [
"4\n",
"5\n",
"0\n"
] | none | 500 | [
{
"input": "2 2 4\n1 1\n1 2\n2 1\n2 2",
"output": "4"
},
{
"input": "2 3 6\n2 3\n2 2\n1 3\n2 2\n1 2\n1 1",
"output": "5"
},
{
"input": "5 3 7\n2 3\n1 2\n1 1\n4 1\n3 1\n5 3\n3 2",
"output": "0"
},
{
"input": "3 3 11\n2 1\n3 1\n1 1\n1 3\n1 2\n2 3\n3 3\n3 2\n2 2\n1 3\n3 3",
"output": "9"
},
{
"input": "2 2 5\n1 1\n2 1\n2 1\n1 2\n2 2",
"output": "5"
},
{
"input": "518 518 10\n37 97\n47 278\n17 467\n158 66\n483 351\n83 123\n285 219\n513 187\n380 75\n304 352",
"output": "0"
},
{
"input": "1 1 5\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "0"
},
{
"input": "1 5 5\n1 1\n1 2\n1 3\n1 4\n1 5",
"output": "0"
},
{
"input": "5 1 5\n1 1\n2 1\n3 1\n4 1\n5 1",
"output": "0"
},
{
"input": "1 1 1\n1 1",
"output": "0"
},
{
"input": "10 10 4\n5 9\n6 9\n6 10\n5 10",
"output": "4"
},
{
"input": "1000 1000 4\n999 999\n999 1000\n1000 999\n1000 1000",
"output": "4"
},
{
"input": "2 3 5\n2 3\n1 3\n1 2\n1 1\n2 2",
"output": "5"
},
{
"input": "1000 1000 4\n1000 1000\n999 999\n1000 999\n999 1000",
"output": "4"
}
] | 1,697,557,211 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 30 | 307,200 | from collections import defaultdict
di = [(0, 1), (1, 0), (1, 1), (0, 0)]
n, m, k = map(int, input().split())
plan = defaultdict(lambda: float('inf'))
for i in range(k):
plan[tuple(map(int, input().split()))] = min(plan[tuple(map(int, input().split()))], i)
for x, y in plan.keys():
if all((x + dx, y + dy) in plan.keys() for dx, dy in di):
print(max(plan[(x + dx, y + dy)] for dx, dy in di) + 1)
break
else:
print(0)
| Title: Pasha and Pixels
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pasha loves his phone and also putting his hair up... But the hair is now irrelevant.
Pasha has installed a new game to his phone. The goal of the game is following. There is a rectangular field consisting of *n* row with *m* pixels in each row. Initially, all the pixels are colored white. In one move, Pasha can choose any pixel and color it black. In particular, he can choose the pixel that is already black, then after the boy's move the pixel does not change, that is, it remains black. Pasha loses the game when a 2<=×<=2 square consisting of black pixels is formed.
Pasha has made a plan of *k* moves, according to which he will paint pixels. Each turn in his plan is represented as a pair of numbers *i* and *j*, denoting respectively the row and the column of the pixel to be colored on the current move.
Determine whether Pasha loses if he acts in accordance with his plan, and if he does, on what move the 2<=×<=2 square consisting of black pixels is formed.
Input Specification:
The first line of the input contains three integers *n*,<=*m*,<=*k* (1<=≤<=*n*,<=*m*<=≤<=1000, 1<=≤<=*k*<=≤<=105) — the number of rows, the number of columns and the number of moves that Pasha is going to perform.
The next *k* lines contain Pasha's moves in the order he makes them. Each line contains two integers *i* and *j* (1<=≤<=*i*<=≤<=*n*, 1<=≤<=*j*<=≤<=*m*), representing the row number and column number of the pixel that was painted during a move.
Output Specification:
If Pasha loses, print the number of the move when the 2<=×<=2 square consisting of black pixels is formed.
If Pasha doesn't lose, that is, no 2<=×<=2 square consisting of black pixels is formed during the given *k* moves, print 0.
Demo Input:
['2 2 4\n1 1\n1 2\n2 1\n2 2\n', '2 3 6\n2 3\n2 2\n1 3\n2 2\n1 2\n1 1\n', '5 3 7\n2 3\n1 2\n1 1\n4 1\n3 1\n5 3\n3 2\n']
Demo Output:
['4\n', '5\n', '0\n']
Note:
none | ```python
from collections import defaultdict
di = [(0, 1), (1, 0), (1, 1), (0, 0)]
n, m, k = map(int, input().split())
plan = defaultdict(lambda: float('inf'))
for i in range(k):
plan[tuple(map(int, input().split()))] = min(plan[tuple(map(int, input().split()))], i)
for x, y in plan.keys():
if all((x + dx, y + dy) in plan.keys() for dx, dy in di):
print(max(plan[(x + dx, y + dy)] for dx, dy in di) + 1)
break
else:
print(0)
``` | -1 |
|
899 | A | Splitting in Teams | PROGRAMMING | 800 | [
"constructive algorithms",
"greedy",
"math"
] | null | null | There were *n* groups of students which came to write a training contest. A group is either one person who can write the contest with anyone else, or two people who want to write the contest in the same team.
The coach decided to form teams of exactly three people for this training. Determine the maximum number of teams of three people he can form. It is possible that he can't use all groups to form teams. For groups of two, either both students should write the contest, or both should not. If two students from a group of two will write the contest, they should be in the same team. | The first line contains single integer *n* (2<=≤<=*n*<=≤<=2·105) — the number of groups.
The second line contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2), where *a**i* is the number of people in group *i*. | Print the maximum number of teams of three people the coach can form. | [
"4\n1 1 2 1\n",
"2\n2 2\n",
"7\n2 2 2 1 1 1 1\n",
"3\n1 1 1\n"
] | [
"1\n",
"0\n",
"3\n",
"1\n"
] | In the first example the coach can form one team. For example, he can take students from the first, second and fourth groups.
In the second example he can't make a single team.
In the third example the coach can form three teams. For example, he can do this in the following way:
- The first group (of two people) and the seventh group (of one person), - The second group (of two people) and the sixth group (of one person), - The third group (of two people) and the fourth group (of one person). | 500 | [
{
"input": "4\n1 1 2 1",
"output": "1"
},
{
"input": "2\n2 2",
"output": "0"
},
{
"input": "7\n2 2 2 1 1 1 1",
"output": "3"
},
{
"input": "3\n1 1 1",
"output": "1"
},
{
"input": "3\n2 2 2",
"output": "0"
},
{
"input": "3\n1 2 1",
"output": "1"
},
{
"input": "5\n2 2 1 1 1",
"output": "2"
},
{
"input": "7\n1 1 2 2 1 2 1",
"output": "3"
},
{
"input": "10\n1 2 2 1 2 2 1 2 1 1",
"output": "5"
},
{
"input": "5\n2 2 2 1 2",
"output": "1"
},
{
"input": "43\n1 2 2 2 1 1 2 2 1 1 2 2 2 2 1 2 2 2 2 2 1 2 1 2 1 2 2 2 2 2 2 2 2 1 2 2 2 2 2 2 2 2 2",
"output": "10"
},
{
"input": "72\n1 2 1 2 2 1 2 1 1 1 1 2 2 1 2 1 2 1 2 2 2 2 1 2 2 2 2 1 2 1 1 2 2 1 1 2 2 2 2 2 1 1 1 1 2 2 1 1 2 1 1 1 1 2 2 1 2 2 1 2 1 1 2 1 2 2 1 1 1 2 2 2",
"output": "34"
},
{
"input": "64\n2 2 1 1 1 2 1 1 1 2 2 1 2 2 2 1 2 2 2 1 1 1 1 2 1 2 1 2 1 1 2 2 1 1 2 2 1 1 1 1 2 2 1 1 1 2 1 2 2 2 2 2 2 2 1 1 2 1 1 1 2 2 1 2",
"output": "32"
},
{
"input": "20\n1 1 1 1 2 1 2 2 2 1 2 1 2 1 2 1 1 2 1 2",
"output": "9"
},
{
"input": "23\n1 1 1 1 2 1 2 1 1 1 2 2 2 2 2 2 1 2 1 2 2 1 1",
"output": "11"
},
{
"input": "201\n1 1 2 2 2 2 1 1 1 2 2 1 2 1 2 1 2 2 2 1 1 2 1 1 1 2 1 2 1 1 1 2 1 1 2 1 2 2 1 1 1 1 2 1 1 2 1 1 1 2 2 2 2 1 2 1 2 2 2 2 2 2 1 1 1 2 2 1 1 1 1 2 2 1 2 1 1 2 2 1 1 2 2 2 1 1 1 2 1 1 2 1 2 2 1 2 2 2 2 1 1 1 2 1 2 2 2 2 2 1 2 1 1 1 2 2 2 2 2 1 2 1 1 2 2 2 1 1 2 2 1 2 2 2 1 1 1 2 1 1 1 2 1 1 2 2 2 1 2 1 1 1 2 2 1 1 2 2 2 2 2 2 1 2 2 1 2 2 2 1 1 2 2 1 1 2 1 1 1 1 2 1 1 1 2 2 1 2 1 1 2 2 1 1 2 1 2 1 1 1 2",
"output": "100"
},
{
"input": "247\n2 2 1 2 1 2 2 2 2 2 2 1 1 2 2 1 2 1 1 1 2 1 1 1 1 2 1 1 2 2 1 2 1 1 1 2 2 2 1 1 2 1 1 2 1 1 1 2 1 2 1 2 2 1 1 2 1 2 2 1 2 1 2 1 1 2 1 1 1 2 2 1 1 2 2 1 1 2 1 1 1 2 2 2 2 1 2 2 2 2 2 2 1 2 2 2 2 1 1 1 1 1 1 1 1 1 2 1 2 2 1 2 1 2 2 2 1 2 2 2 1 1 2 2 1 1 1 2 1 1 1 1 2 2 1 2 2 1 1 1 2 1 2 2 1 2 1 1 1 2 2 2 2 2 1 2 2 2 1 1 1 2 1 2 1 1 2 2 2 2 1 1 2 2 2 1 2 2 2 1 2 1 1 2 2 2 2 1 2 2 1 1 1 2 1 2 1 1 1 2 2 1 1 2 1 1 2 1 2 1 1 2 1 1 1 1 2 1 1 1 1 2 2 1 2 1 1 2 1 2 2 1 2 2 2 1 2 2 1 2 2 1 1 1 2 2 2",
"output": "123"
},
{
"input": "4\n2 2 2 2",
"output": "0"
},
{
"input": "4\n1 1 1 1",
"output": "1"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "2\n1 2",
"output": "1"
},
{
"input": "3\n1 1 2",
"output": "1"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n2 1 1",
"output": "1"
},
{
"input": "3\n2 1 2",
"output": "1"
},
{
"input": "3\n2 2 1",
"output": "1"
},
{
"input": "4\n1 1 1 2",
"output": "1"
},
{
"input": "4\n1 1 2 2",
"output": "2"
},
{
"input": "4\n1 2 2 2",
"output": "1"
},
{
"input": "4\n2 1 1 1",
"output": "1"
},
{
"input": "5\n1 1 1 1 2",
"output": "2"
},
{
"input": "14\n1 2 2 2 2 2 2 2 2 2 2 2 2 2",
"output": "1"
},
{
"input": "38\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1",
"output": "1"
},
{
"input": "30\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1",
"output": "1"
},
{
"input": "20\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1",
"output": "1"
},
{
"input": "26\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 1 2 2 2 2",
"output": "1"
},
{
"input": "6\n1 1 1 2 2 2",
"output": "3"
},
{
"input": "5\n2 1 1 1 1",
"output": "2"
},
{
"input": "9\n1 1 1 1 1 1 2 2 2",
"output": "4"
},
{
"input": "10\n2 2 1 1 1 1 1 1 1 1",
"output": "4"
},
{
"input": "6\n1 1 1 1 1 1",
"output": "2"
}
] | 1,561,187,507 | 2,147,483,647 | PyPy 3 | OK | TESTS | 67 | 202 | 14,540,800 | n = int(input())
l = list(map(int,input().split()))
k = l.count(1)
h = l.count(2)
if k>h:
print(h+(k-h)//3)
else:
print(k) | Title: Splitting in Teams
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There were *n* groups of students which came to write a training contest. A group is either one person who can write the contest with anyone else, or two people who want to write the contest in the same team.
The coach decided to form teams of exactly three people for this training. Determine the maximum number of teams of three people he can form. It is possible that he can't use all groups to form teams. For groups of two, either both students should write the contest, or both should not. If two students from a group of two will write the contest, they should be in the same team.
Input Specification:
The first line contains single integer *n* (2<=≤<=*n*<=≤<=2·105) — the number of groups.
The second line contains a sequence of integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=2), where *a**i* is the number of people in group *i*.
Output Specification:
Print the maximum number of teams of three people the coach can form.
Demo Input:
['4\n1 1 2 1\n', '2\n2 2\n', '7\n2 2 2 1 1 1 1\n', '3\n1 1 1\n']
Demo Output:
['1\n', '0\n', '3\n', '1\n']
Note:
In the first example the coach can form one team. For example, he can take students from the first, second and fourth groups.
In the second example he can't make a single team.
In the third example the coach can form three teams. For example, he can do this in the following way:
- The first group (of two people) and the seventh group (of one person), - The second group (of two people) and the sixth group (of one person), - The third group (of two people) and the fourth group (of one person). | ```python
n = int(input())
l = list(map(int,input().split()))
k = l.count(1)
h = l.count(2)
if k>h:
print(h+(k-h)//3)
else:
print(k)
``` | 3 |
|
5 | B | Center Alignment | PROGRAMMING | 1,200 | [
"implementation",
"strings"
] | B. Center Alignment | 1 | 64 | Almost every text editor has a built-in function of center text alignment. The developers of the popular in Berland text editor «Textpad» decided to introduce this functionality into the fourth release of the product.
You are to implement the alignment in the shortest possible time. Good luck! | The input file consists of one or more lines, each of the lines contains Latin letters, digits and/or spaces. The lines cannot start or end with a space. It is guaranteed that at least one of the lines has positive length. The length of each line and the total amount of the lines do not exceed 1000. | Format the given text, aligning it center. Frame the whole text with characters «*» of the minimum size. If a line cannot be aligned perfectly (for example, the line has even length, while the width of the block is uneven), you should place such lines rounding down the distance to the left or to the right edge and bringing them closer left or right alternatively (you should start with bringing left). Study the sample tests carefully to understand the output format better. | [
"This is\n\nCodeforces\nBeta\nRound\n5\n",
"welcome to the\nCodeforces\nBeta\nRound 5\n\nand\ngood luck\n"
] | [
"************\n* This is *\n* *\n*Codeforces*\n* Beta *\n* Round *\n* 5 *\n************\n",
"****************\n*welcome to the*\n* Codeforces *\n* Beta *\n* Round 5 *\n* *\n* and *\n* good luck *\n****************\n"
] | none | 0 | [
{
"input": "This is\n\nCodeforces\nBeta\nRound\n5",
"output": "************\n* This is *\n* *\n*Codeforces*\n* Beta *\n* Round *\n* 5 *\n************"
},
{
"input": "welcome to the\nCodeforces\nBeta\nRound 5\n\nand\ngood luck",
"output": "****************\n*welcome to the*\n* Codeforces *\n* Beta *\n* Round 5 *\n* *\n* and *\n* good luck *\n****************"
},
{
"input": "0\n2",
"output": "***\n*0*\n*2*\n***"
},
{
"input": "O\no\nd",
"output": "***\n*O*\n*o*\n*d*\n***"
},
{
"input": "0v uO M6Sy",
"output": "************\n*0v uO M6Sy*\n************"
},
{
"input": "fm v\nOL U W",
"output": "**********\n* fm v *\n*OL U W*\n**********"
},
{
"input": "vb\nJ\nyU\nZ",
"output": "****\n*vb*\n*J *\n*yU*\n* Z*\n****"
},
{
"input": "N\nSV\nEh\n6f\nX6\n9e",
"output": "****\n*N *\n*SV*\n*Eh*\n*6f*\n*X6*\n*9e*\n****"
},
{
"input": "Pj\nA\nFA\nP\nVJ\nU\nEb\nW",
"output": "****\n*Pj*\n*A *\n*FA*\n* P*\n*VJ*\n*U *\n*Eb*\n* W*\n****"
},
{
"input": "T\n7j\nS\nb\nq8\nVZ\nn\n4T\niZ\npA",
"output": "****\n*T *\n*7j*\n* S*\n*b *\n*q8*\n*VZ*\n* n*\n*4T*\n*iZ*\n*pA*\n****"
},
{
"input": "8\n\n\n\ny\nW\n\n\n\n3B\n\nw\nV\n\n\n\nL\nSr\n\n\nV\n\n5\n\nAq\n\n\n\nJ\nR\n\n04\nJ\nv\nhU\n\n\n\nY\nG\n4\n\nG\nb\n\n\n9\n\n6\nd\n\n2\n\n\nE\n7\n\nr\n\n\n\n\nKC\ns\nE\n\nab\n4\nx\n\n\n\n\n\nEe\n4\n\nl\n\np\n\nG\nM\n\n\nn\n\n\nm0\n\nw\n\n\nP\n\n\n\n0",
"output": "****\n*8 *\n* *\n* *\n* *\n* y*\n*W *\n* *\n* *\n* *\n*3B*\n* *\n* w*\n*V *\n* *\n* *\n* *\n* L*\n*Sr*\n* *\n* *\n*V *\n* *\n* 5*\n* *\n*Aq*\n* *\n* *\n* *\n*J *\n* R*\n* *\n*04*\n*J *\n* v*\n*hU*\n* *\n* *\n* *\n*Y *\n* G*\n*4 *\n* *\n* G*\n*b *\n* *\n* *\n* 9*\n* *\n*6 *\n* d*\n* *\n*2 *\n* *\n* *\n* E*\n*7 *\n* *\n* r*\n* *\n* *\n* *\n* *\n*KC*\n*s *\n* E*\n* *\n*ab*\n*4 *\n* x*\n* *\n* *\n* *\n* *\n* *\n*Ee*\n*4 *\n* *\n* l*\n* *\n*p *\n* *\n* G*\n*M *\n* *\n*..."
},
{
"input": "U",
"output": "***\n*U*\n***"
}
] | 1,609,235,095 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 186 | 614,400 | import fileinput
m = []
l = []
for line in fileinput.input():
m.append(line[:-1])
l.append(len(line) - 1)
r = max(l)
print('*' * (r + 2))
for i in range(0, len(m) - 1):
s1 = ' ' * ((r - l[i]) // 2)
s2 = ' ' * (r - len(s1) - l[i])
print('*' + s1 + m[i] + s2 + '*')
print('*' * (r + 2)) | Title: Center Alignment
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Almost every text editor has a built-in function of center text alignment. The developers of the popular in Berland text editor «Textpad» decided to introduce this functionality into the fourth release of the product.
You are to implement the alignment in the shortest possible time. Good luck!
Input Specification:
The input file consists of one or more lines, each of the lines contains Latin letters, digits and/or spaces. The lines cannot start or end with a space. It is guaranteed that at least one of the lines has positive length. The length of each line and the total amount of the lines do not exceed 1000.
Output Specification:
Format the given text, aligning it center. Frame the whole text with characters «*» of the minimum size. If a line cannot be aligned perfectly (for example, the line has even length, while the width of the block is uneven), you should place such lines rounding down the distance to the left or to the right edge and bringing them closer left or right alternatively (you should start with bringing left). Study the sample tests carefully to understand the output format better.
Demo Input:
['This is\n\nCodeforces\nBeta\nRound\n5\n', 'welcome to the\nCodeforces\nBeta\nRound 5\n\nand\ngood luck\n']
Demo Output:
['************\n* This is *\n* *\n*Codeforces*\n* Beta *\n* Round *\n* 5 *\n************\n', '****************\n*welcome to the*\n* Codeforces *\n* Beta *\n* Round 5 *\n* *\n* and *\n* good luck *\n****************\n']
Note:
none | ```python
import fileinput
m = []
l = []
for line in fileinput.input():
m.append(line[:-1])
l.append(len(line) - 1)
r = max(l)
print('*' * (r + 2))
for i in range(0, len(m) - 1):
s1 = ' ' * ((r - l[i]) // 2)
s2 = ' ' * (r - len(s1) - l[i])
print('*' + s1 + m[i] + s2 + '*')
print('*' * (r + 2))
``` | 0 |
753 | A | Santa Claus and Candies | PROGRAMMING | 1,000 | [
"dp",
"greedy",
"math"
] | null | null | Santa Claus has *n* candies, he dreams to give them as gifts to children.
What is the maximal number of children for whose he can give candies if Santa Claus want each kid should get distinct positive integer number of candies. Santa Class wants to give all *n* candies he has. | The only line contains positive integer number *n* (1<=≤<=*n*<=≤<=1000) — number of candies Santa Claus has. | Print to the first line integer number *k* — maximal number of kids which can get candies.
Print to the second line *k* distinct integer numbers: number of candies for each of *k* kid. The sum of *k* printed numbers should be exactly *n*.
If there are many solutions, print any of them. | [
"5\n",
"9\n",
"2\n"
] | [
"2\n2 3\n",
"3\n3 5 1\n",
"1\n2 \n"
] | none | 500 | [
{
"input": "5",
"output": "2\n1 4 "
},
{
"input": "9",
"output": "3\n1 2 6 "
},
{
"input": "2",
"output": "1\n2 "
},
{
"input": "1",
"output": "1\n1 "
},
{
"input": "3",
"output": "2\n1 2 "
},
{
"input": "1000",
"output": "44\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 54 "
},
{
"input": "4",
"output": "2\n1 3 "
},
{
"input": "6",
"output": "3\n1 2 3 "
},
{
"input": "7",
"output": "3\n1 2 4 "
},
{
"input": "8",
"output": "3\n1 2 5 "
},
{
"input": "10",
"output": "4\n1 2 3 4 "
},
{
"input": "11",
"output": "4\n1 2 3 5 "
},
{
"input": "12",
"output": "4\n1 2 3 6 "
},
{
"input": "13",
"output": "4\n1 2 3 7 "
},
{
"input": "14",
"output": "4\n1 2 3 8 "
},
{
"input": "15",
"output": "5\n1 2 3 4 5 "
},
{
"input": "16",
"output": "5\n1 2 3 4 6 "
},
{
"input": "20",
"output": "5\n1 2 3 4 10 "
},
{
"input": "21",
"output": "6\n1 2 3 4 5 6 "
},
{
"input": "22",
"output": "6\n1 2 3 4 5 7 "
},
{
"input": "27",
"output": "6\n1 2 3 4 5 12 "
},
{
"input": "28",
"output": "7\n1 2 3 4 5 6 7 "
},
{
"input": "29",
"output": "7\n1 2 3 4 5 6 8 "
},
{
"input": "35",
"output": "7\n1 2 3 4 5 6 14 "
},
{
"input": "36",
"output": "8\n1 2 3 4 5 6 7 8 "
},
{
"input": "37",
"output": "8\n1 2 3 4 5 6 7 9 "
},
{
"input": "44",
"output": "8\n1 2 3 4 5 6 7 16 "
},
{
"input": "45",
"output": "9\n1 2 3 4 5 6 7 8 9 "
},
{
"input": "46",
"output": "9\n1 2 3 4 5 6 7 8 10 "
},
{
"input": "230",
"output": "20\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 40 "
},
{
"input": "231",
"output": "21\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 "
},
{
"input": "232",
"output": "21\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 22 "
},
{
"input": "239",
"output": "21\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 29 "
},
{
"input": "629",
"output": "34\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 68 "
},
{
"input": "630",
"output": "35\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 "
},
{
"input": "631",
"output": "35\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 36 "
},
{
"input": "945",
"output": "42\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 84 "
},
{
"input": "946",
"output": "43\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 "
},
{
"input": "947",
"output": "43\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 44 "
},
{
"input": "989",
"output": "43\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 86 "
},
{
"input": "990",
"output": "44\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 "
},
{
"input": "991",
"output": "44\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 45 "
},
{
"input": "956",
"output": "43\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 53 "
},
{
"input": "981",
"output": "43\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 78 "
},
{
"input": "867",
"output": "41\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 47 "
},
{
"input": "906",
"output": "42\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 45 "
},
{
"input": "999",
"output": "44\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 53 "
},
{
"input": "100",
"output": "13\n1 2 3 4 5 6 7 8 9 10 11 12 22 "
},
{
"input": "126",
"output": "15\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 21 "
}
] | 1,658,897,538 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 3 | 46 | 0 | # -*- coding=utf-8 -*-
if __name__ == "__main__":
N = int(input())
if N == 2:
print(1)
print(2)
exit()
counter = 2
dp = [2]
dp_set = set([2])
has_finish = False
for n in range(N - 2):
if n == 0:
dp.append(1)
counter += 1
else:
while N > counter:
has_finish = False
for s in range(len(dp)):
dp[s] += 1
counter += 1
if counter == N:
has_finish = True
break
if not has_finish:
dp.append(1)
counter+= 1
if has_finish:
break
if has_finish:
break
print(len(dp))
print(*dp) | Title: Santa Claus and Candies
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Santa Claus has *n* candies, he dreams to give them as gifts to children.
What is the maximal number of children for whose he can give candies if Santa Claus want each kid should get distinct positive integer number of candies. Santa Class wants to give all *n* candies he has.
Input Specification:
The only line contains positive integer number *n* (1<=≤<=*n*<=≤<=1000) — number of candies Santa Claus has.
Output Specification:
Print to the first line integer number *k* — maximal number of kids which can get candies.
Print to the second line *k* distinct integer numbers: number of candies for each of *k* kid. The sum of *k* printed numbers should be exactly *n*.
If there are many solutions, print any of them.
Demo Input:
['5\n', '9\n', '2\n']
Demo Output:
['2\n2 3\n', '3\n3 5 1\n', '1\n2 \n']
Note:
none | ```python
# -*- coding=utf-8 -*-
if __name__ == "__main__":
N = int(input())
if N == 2:
print(1)
print(2)
exit()
counter = 2
dp = [2]
dp_set = set([2])
has_finish = False
for n in range(N - 2):
if n == 0:
dp.append(1)
counter += 1
else:
while N > counter:
has_finish = False
for s in range(len(dp)):
dp[s] += 1
counter += 1
if counter == N:
has_finish = True
break
if not has_finish:
dp.append(1)
counter+= 1
if has_finish:
break
if has_finish:
break
print(len(dp))
print(*dp)
``` | 0 |