contestId
int64 0
1.01k
| index
stringclasses 57
values | name
stringlengths 2
58
| type
stringclasses 2
values | rating
int64 0
3.5k
| tags
sequencelengths 0
11
| title
stringclasses 522
values | time-limit
stringclasses 8
values | memory-limit
stringclasses 8
values | problem-description
stringlengths 0
7.15k
| input-specification
stringlengths 0
2.05k
| output-specification
stringlengths 0
1.5k
| demo-input
sequencelengths 0
7
| demo-output
sequencelengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
425k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 14
values | testset
stringclasses 12
values | passedTestCount
int64 0
1k
| timeConsumedMillis
int64 0
15k
| memoryConsumedBytes
int64 0
805M
| code
stringlengths 3
65.5k
| prompt
stringlengths 262
8.2k
| response
stringlengths 17
65.5k
| score
float64 -1
3.99
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
741 | B | Arpa's weak amphitheater and Mehrdad's valuable Hoses | PROGRAMMING | 1,600 | [
"dfs and similar",
"dp",
"dsu"
] | null | null | Just to remind, girls in Arpa's land are really nice.
Mehrdad wants to invite some Hoses to the palace for a dancing party. Each Hos has some weight *w**i* and some beauty *b**i*. Also each Hos may have some friends. Hoses are divided in some friendship groups. Two Hoses *x* and *y* are in the same friendship group if and only if there is a sequence of Hoses *a*1,<=*a*2,<=...,<=*a**k* such that *a**i* and *a**i*<=+<=1 are friends for each 1<=≤<=*i*<=<<=*k*, and *a*1<==<=*x* and *a**k*<==<=*y*.
Arpa allowed to use the amphitheater of palace to Mehrdad for this party. Arpa's amphitheater can hold at most *w* weight on it.
Mehrdad is so greedy that he wants to invite some Hoses such that sum of their weights is not greater than *w* and sum of their beauties is as large as possible. Along with that, from each friendship group he can either invite all Hoses, or no more than one. Otherwise, some Hoses will be hurt. Find for Mehrdad the maximum possible total beauty of Hoses he can invite so that no one gets hurt and the total weight doesn't exceed *w*. | The first line contains integers *n*, *m* and *w* (1<=<=≤<=<=*n*<=<=≤<=<=1000, , 1<=≤<=*w*<=≤<=1000) — the number of Hoses, the number of pair of friends and the maximum total weight of those who are invited.
The second line contains *n* integers *w*1,<=*w*2,<=...,<=*w**n* (1<=≤<=*w**i*<=≤<=1000) — the weights of the Hoses.
The third line contains *n* integers *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=106) — the beauties of the Hoses.
The next *m* lines contain pairs of friends, the *i*-th of them contains two integers *x**i* and *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=*n*, *x**i*<=≠<=*y**i*), meaning that Hoses *x**i* and *y**i* are friends. Note that friendship is bidirectional. All pairs (*x**i*,<=*y**i*) are distinct. | Print the maximum possible total beauty of Hoses Mehrdad can invite so that no one gets hurt and the total weight doesn't exceed *w*. | [
"3 1 5\n3 2 5\n2 4 2\n1 2\n",
"4 2 11\n2 4 6 6\n6 4 2 1\n1 2\n2 3\n"
] | [
"6\n",
"7\n"
] | In the first sample there are two friendship groups: Hoses {1, 2} and Hos {3}. The best way is to choose all of Hoses in the first group, sum of their weights is equal to 5 and sum of their beauty is 6.
In the second sample there are two friendship groups: Hoses {1, 2, 3} and Hos {4}. Mehrdad can't invite all the Hoses from the first group because their total weight is 12 > 11, thus the best way is to choose the first Hos from the first group and the only one from the second group. The total weight will be 8, and the total beauty will be 7. | 1,000 | [
{
"input": "3 1 5\n3 2 5\n2 4 2\n1 2",
"output": "6"
},
{
"input": "4 2 11\n2 4 6 6\n6 4 2 1\n1 2\n2 3",
"output": "7"
},
{
"input": "10 5 100\n70 67 8 64 28 82 18 61 82 7\n596434 595982 237932 275698 361351 850374 936914 877996 789231 331012\n1 7\n2 4\n3 6\n5 7\n1 5",
"output": "2383854"
},
{
"input": "10 5 100\n64 90 3 94 96 97 52 54 82 31\n796554 444893 214351 43810 684158 555762 686198 339093 383018 699152\n6 8\n8 3\n3 9\n2 3\n10 3",
"output": "1495706"
},
{
"input": "10 5 100\n6 18 35 6 87 58 4 53 37 71\n465782 57034 547741 748298 315223 370368 679320 349012 9740 622511\n1 2\n10 9\n6 7\n3 6\n7 1",
"output": "2050129"
},
{
"input": "10 5 100\n78 89 3 2 95 96 87 11 13 60\n694709 921 799687 428614 221900 536251 117674 36488 219932 771513\n4 5\n3 4\n6 2\n2 3\n8 3",
"output": "1791132"
},
{
"input": "10 5 100\n48 73 30 46 95 19 98 73 94 24\n501216 675859 843572 565104 879875 828759 80776 766980 213551 492652\n1 2\n6 5\n7 6\n10 3\n8 1",
"output": "2237435"
},
{
"input": "10 5 100\n68 55 15 94 53 100 52 68 24 3\n286803 660813 226501 624597 215418 290774 416040 961916 910482 50278\n1 5\n7 2\n2 8\n5 3\n10 3",
"output": "1922676"
},
{
"input": "10 5 100\n19 8 95 18 9 79 42 94 20 49\n735491 935681 717266 935275 521356 866021 356037 394445 589369 585077\n9 4\n5 6\n5 1\n1 4\n7 1",
"output": "2456033"
}
] | 1,606,089,124 | 2,147,483,647 | Python 3 | OK | TESTS | 68 | 842 | 614,400 | def g(x):
if x == t[x]: return x
t[x] = g(t[x])
return t[x]
f = lambda: map(int, input().split())
hoses, pairOfFriends, weight = f()
weightsAndBeauties = [(0, 0)] + list(zip(f(), f()))
t = list(range(hoses + 1))
for i in range(pairOfFriends):
f1, f2 = f()
f1, f2 = g(f1), g(f2)
if f1 != f2:
t[f2] = f1
p = [[] for j in range(hoses + 1)]
for i in range(1, hoses + 1):
p[g(i)].append(i)
beauties = [1] + [0] * weight
for q in p:
if len(q) > 1:
t = [weightsAndBeauties[i] for i in q]
t.append((sum(f1[0] for f1 in t), sum(f1[1] for f1 in t)))
t.sort(key=lambda f1: f1[0])
for j in range(weight, -1, -1):
if beauties[j]:
for w, b in t:
if j + w > weight:
break
else:
beauties[j + w] = max(beauties[j + w], beauties[j] + b)
elif len(q) == 1:
w, b = weightsAndBeauties[q[0]]
for j in range(weight - w, -1, -1):
if beauties[j]:
beauties[j + w] = max(beauties[j + w], beauties[j] + b)
maxBeauty = max(beauties) - 1
print(maxBeauty) | Title: Arpa's weak amphitheater and Mehrdad's valuable Hoses
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Just to remind, girls in Arpa's land are really nice.
Mehrdad wants to invite some Hoses to the palace for a dancing party. Each Hos has some weight *w**i* and some beauty *b**i*. Also each Hos may have some friends. Hoses are divided in some friendship groups. Two Hoses *x* and *y* are in the same friendship group if and only if there is a sequence of Hoses *a*1,<=*a*2,<=...,<=*a**k* such that *a**i* and *a**i*<=+<=1 are friends for each 1<=≤<=*i*<=<<=*k*, and *a*1<==<=*x* and *a**k*<==<=*y*.
Arpa allowed to use the amphitheater of palace to Mehrdad for this party. Arpa's amphitheater can hold at most *w* weight on it.
Mehrdad is so greedy that he wants to invite some Hoses such that sum of their weights is not greater than *w* and sum of their beauties is as large as possible. Along with that, from each friendship group he can either invite all Hoses, or no more than one. Otherwise, some Hoses will be hurt. Find for Mehrdad the maximum possible total beauty of Hoses he can invite so that no one gets hurt and the total weight doesn't exceed *w*.
Input Specification:
The first line contains integers *n*, *m* and *w* (1<=<=≤<=<=*n*<=<=≤<=<=1000, , 1<=≤<=*w*<=≤<=1000) — the number of Hoses, the number of pair of friends and the maximum total weight of those who are invited.
The second line contains *n* integers *w*1,<=*w*2,<=...,<=*w**n* (1<=≤<=*w**i*<=≤<=1000) — the weights of the Hoses.
The third line contains *n* integers *b*1,<=*b*2,<=...,<=*b**n* (1<=≤<=*b**i*<=≤<=106) — the beauties of the Hoses.
The next *m* lines contain pairs of friends, the *i*-th of them contains two integers *x**i* and *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=*n*, *x**i*<=≠<=*y**i*), meaning that Hoses *x**i* and *y**i* are friends. Note that friendship is bidirectional. All pairs (*x**i*,<=*y**i*) are distinct.
Output Specification:
Print the maximum possible total beauty of Hoses Mehrdad can invite so that no one gets hurt and the total weight doesn't exceed *w*.
Demo Input:
['3 1 5\n3 2 5\n2 4 2\n1 2\n', '4 2 11\n2 4 6 6\n6 4 2 1\n1 2\n2 3\n']
Demo Output:
['6\n', '7\n']
Note:
In the first sample there are two friendship groups: Hoses {1, 2} and Hos {3}. The best way is to choose all of Hoses in the first group, sum of their weights is equal to 5 and sum of their beauty is 6.
In the second sample there are two friendship groups: Hoses {1, 2, 3} and Hos {4}. Mehrdad can't invite all the Hoses from the first group because their total weight is 12 > 11, thus the best way is to choose the first Hos from the first group and the only one from the second group. The total weight will be 8, and the total beauty will be 7. | ```python
def g(x):
if x == t[x]: return x
t[x] = g(t[x])
return t[x]
f = lambda: map(int, input().split())
hoses, pairOfFriends, weight = f()
weightsAndBeauties = [(0, 0)] + list(zip(f(), f()))
t = list(range(hoses + 1))
for i in range(pairOfFriends):
f1, f2 = f()
f1, f2 = g(f1), g(f2)
if f1 != f2:
t[f2] = f1
p = [[] for j in range(hoses + 1)]
for i in range(1, hoses + 1):
p[g(i)].append(i)
beauties = [1] + [0] * weight
for q in p:
if len(q) > 1:
t = [weightsAndBeauties[i] for i in q]
t.append((sum(f1[0] for f1 in t), sum(f1[1] for f1 in t)))
t.sort(key=lambda f1: f1[0])
for j in range(weight, -1, -1):
if beauties[j]:
for w, b in t:
if j + w > weight:
break
else:
beauties[j + w] = max(beauties[j + w], beauties[j] + b)
elif len(q) == 1:
w, b = weightsAndBeauties[q[0]]
for j in range(weight - w, -1, -1):
if beauties[j]:
beauties[j + w] = max(beauties[j + w], beauties[j] + b)
maxBeauty = max(beauties) - 1
print(maxBeauty)
``` | 3 |
|
233 | A | Perfect Permutation | PROGRAMMING | 800 | [
"implementation",
"math"
] | null | null | A permutation is a sequence of integers *p*1,<=*p*2,<=...,<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. Let's denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size of permutation *p*1,<=*p*2,<=...,<=*p**n*.
Nickolas adores permutations. He likes some permutations more than the others. He calls such permutations perfect. A perfect permutation is such permutation *p* that for any *i* (1<=≤<=*i*<=≤<=*n*) (*n* is the permutation size) the following equations hold *p**p**i*<==<=*i* and *p**i*<=≠<=*i*. Nickolas asks you to print any perfect permutation of size *n* for the given *n*. | A single line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the permutation size. | If a perfect permutation of size *n* doesn't exist, print a single integer -1. Otherwise print *n* distinct integers from 1 to *n*, *p*1,<=*p*2,<=...,<=*p**n* — permutation *p*, that is perfect. Separate printed numbers by whitespaces. | [
"1\n",
"2\n",
"4\n"
] | [
"-1\n",
"2 1 \n",
"2 1 4 3 \n"
] | none | 500 | [
{
"input": "1",
"output": "-1"
},
{
"input": "2",
"output": "2 1 "
},
{
"input": "4",
"output": "2 1 4 3 "
},
{
"input": "3",
"output": "-1"
},
{
"input": "5",
"output": "-1"
},
{
"input": "6",
"output": "2 1 4 3 6 5 "
},
{
"input": "7",
"output": "-1"
},
{
"input": "20",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 "
},
{
"input": "8",
"output": "2 1 4 3 6 5 8 7 "
},
{
"input": "9",
"output": "-1"
},
{
"input": "10",
"output": "2 1 4 3 6 5 8 7 10 9 "
},
{
"input": "11",
"output": "-1"
},
{
"input": "21",
"output": "-1"
},
{
"input": "50",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 "
},
{
"input": "51",
"output": "-1"
},
{
"input": "52",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 "
},
{
"input": "84",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 "
},
{
"input": "86",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 "
},
{
"input": "100",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 98 97 100 99 "
},
{
"input": "98",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 98 97 "
},
{
"input": "96",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 50 49 52 51 54 53 56 55 58 57 60 59 62 61 64 63 66 65 68 67 70 69 72 71 74 73 76 75 78 77 80 79 82 81 84 83 86 85 88 87 90 89 92 91 94 93 96 95 "
},
{
"input": "33",
"output": "-1"
},
{
"input": "34",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 "
},
{
"input": "36",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 "
},
{
"input": "38",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 "
},
{
"input": "40",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 "
},
{
"input": "42",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 "
},
{
"input": "44",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 "
},
{
"input": "46",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 "
},
{
"input": "48",
"output": "2 1 4 3 6 5 8 7 10 9 12 11 14 13 16 15 18 17 20 19 22 21 24 23 26 25 28 27 30 29 32 31 34 33 36 35 38 37 40 39 42 41 44 43 46 45 48 47 "
}
] | 1,664,513,971 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 1 | 60 | 0 | list1 = []
num = int(input())
if num % 2 != 0:
print(-1)
else:
if len(list1) % 2 == 0:
for j in range(1, num + 1, 2):
list1.append(j + 1)
list1.append(j)
print(list1)
| Title: Perfect Permutation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A permutation is a sequence of integers *p*1,<=*p*2,<=...,<=*p**n*, consisting of *n* distinct positive integers, each of them doesn't exceed *n*. Let's denote the *i*-th element of permutation *p* as *p**i*. We'll call number *n* the size of permutation *p*1,<=*p*2,<=...,<=*p**n*.
Nickolas adores permutations. He likes some permutations more than the others. He calls such permutations perfect. A perfect permutation is such permutation *p* that for any *i* (1<=≤<=*i*<=≤<=*n*) (*n* is the permutation size) the following equations hold *p**p**i*<==<=*i* and *p**i*<=≠<=*i*. Nickolas asks you to print any perfect permutation of size *n* for the given *n*.
Input Specification:
A single line contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the permutation size.
Output Specification:
If a perfect permutation of size *n* doesn't exist, print a single integer -1. Otherwise print *n* distinct integers from 1 to *n*, *p*1,<=*p*2,<=...,<=*p**n* — permutation *p*, that is perfect. Separate printed numbers by whitespaces.
Demo Input:
['1\n', '2\n', '4\n']
Demo Output:
['-1\n', '2 1 \n', '2 1 4 3 \n']
Note:
none | ```python
list1 = []
num = int(input())
if num % 2 != 0:
print(-1)
else:
if len(list1) % 2 == 0:
for j in range(1, num + 1, 2):
list1.append(j + 1)
list1.append(j)
print(list1)
``` | 0 |
|
710 | A | King Moves | PROGRAMMING | 800 | [
"implementation"
] | null | null | The only king stands on the standard chess board. You are given his position in format "cd", where *c* is the column from 'a' to 'h' and *d* is the row from '1' to '8'. Find the number of moves permitted for the king.
Check the king's moves here [https://en.wikipedia.org/wiki/King_(chess)](https://en.wikipedia.org/wiki/King_(chess)). | The only line contains the king's position in the format "cd", where 'c' is the column from 'a' to 'h' and 'd' is the row from '1' to '8'. | Print the only integer *x* — the number of moves permitted for the king. | [
"e4\n"
] | [
"8\n"
] | none | 0 | [
{
"input": "e4",
"output": "8"
},
{
"input": "a1",
"output": "3"
},
{
"input": "h8",
"output": "3"
},
{
"input": "a4",
"output": "5"
},
{
"input": "g7",
"output": "8"
},
{
"input": "e1",
"output": "5"
},
{
"input": "b2",
"output": "8"
},
{
"input": "c7",
"output": "8"
},
{
"input": "h6",
"output": "5"
},
{
"input": "c8",
"output": "5"
},
{
"input": "h2",
"output": "5"
},
{
"input": "h5",
"output": "5"
},
{
"input": "a8",
"output": "3"
},
{
"input": "f8",
"output": "5"
},
{
"input": "h1",
"output": "3"
},
{
"input": "f2",
"output": "8"
},
{
"input": "e8",
"output": "5"
},
{
"input": "h3",
"output": "5"
},
{
"input": "b8",
"output": "5"
},
{
"input": "g8",
"output": "5"
},
{
"input": "d8",
"output": "5"
},
{
"input": "h4",
"output": "5"
},
{
"input": "b1",
"output": "5"
},
{
"input": "a2",
"output": "5"
}
] | 1,630,347,311 | 2,147,483,647 | PyPy 3 | OK | TESTS | 24 | 109 | 20,172,800 | from sys import stdin, stdout
def read():
return stdin.readline().rstrip()
def read_int():
return int(read())
def read_ints():
return list(map(int, read().split()))
def solve():
a=read()
c=0
if a[0]=='a' or a[0]=='h':
c+=1
if a[1]=='1' or a[1]=='8':
c+=1
if c==0:
print(8)
elif c==1:
print(5)
else:
print(3)
solve()
| Title: King Moves
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The only king stands on the standard chess board. You are given his position in format "cd", where *c* is the column from 'a' to 'h' and *d* is the row from '1' to '8'. Find the number of moves permitted for the king.
Check the king's moves here [https://en.wikipedia.org/wiki/King_(chess)](https://en.wikipedia.org/wiki/King_(chess)).
Input Specification:
The only line contains the king's position in the format "cd", where 'c' is the column from 'a' to 'h' and 'd' is the row from '1' to '8'.
Output Specification:
Print the only integer *x* — the number of moves permitted for the king.
Demo Input:
['e4\n']
Demo Output:
['8\n']
Note:
none | ```python
from sys import stdin, stdout
def read():
return stdin.readline().rstrip()
def read_int():
return int(read())
def read_ints():
return list(map(int, read().split()))
def solve():
a=read()
c=0
if a[0]=='a' or a[0]=='h':
c+=1
if a[1]=='1' or a[1]=='8':
c+=1
if c==0:
print(8)
elif c==1:
print(5)
else:
print(3)
solve()
``` | 3 |
|
807 | A | Is it rated? | PROGRAMMING | 900 | [
"implementation",
"sortings"
] | null | null | Is it rated?
Here it is. The Ultimate Question of Competitive Programming, Codeforces, and Everything. And you are here to answer it.
Another Codeforces round has been conducted. No two participants have the same number of points. For each participant, from the top to the bottom of the standings, their rating before and after the round is known.
It's known that if at least one participant's rating has changed, then the round was rated for sure.
It's also known that if the round was rated and a participant with lower rating took a better place in the standings than a participant with higher rating, then at least one round participant's rating has changed.
In this problem, you should not make any other assumptions about the rating system.
Determine if the current round is rated, unrated, or it's impossible to determine whether it is rated of not. | The first line contains a single integer *n* (2<=≤<=*n*<=≤<=1000) — the number of round participants.
Each of the next *n* lines contains two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=4126) — the rating of the *i*-th participant before and after the round, respectively. The participants are listed in order from the top to the bottom of the standings. | If the round is rated for sure, print "rated". If the round is unrated for sure, print "unrated". If it's impossible to determine whether the round is rated or not, print "maybe". | [
"6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884\n",
"4\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n",
"5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n"
] | [
"rated\n",
"unrated\n",
"maybe\n"
] | In the first example, the ratings of the participants in the third and fifth places have changed, therefore, the round was rated.
In the second example, no one's rating has changed, but the participant in the second place has lower rating than the participant in the fourth place. Therefore, if the round was rated, someone's rating would've changed for sure.
In the third example, no one's rating has changed, and the participants took places in non-increasing order of their rating. Therefore, it's impossible to determine whether the round is rated or not. | 500 | [
{
"input": "6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884",
"output": "rated"
},
{
"input": "4\n1500 1500\n1300 1300\n1200 1200\n1400 1400",
"output": "unrated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699",
"output": "maybe"
},
{
"input": "2\n1 1\n1 1",
"output": "maybe"
},
{
"input": "2\n4126 4126\n4126 4126",
"output": "maybe"
},
{
"input": "10\n446 446\n1331 1331\n3594 3594\n1346 1902\n91 91\n3590 3590\n2437 2437\n4007 3871\n2797 699\n1423 1423",
"output": "rated"
},
{
"input": "10\n4078 4078\n2876 2876\n1061 1061\n3721 3721\n143 143\n2992 2992\n3279 3279\n3389 3389\n1702 1702\n1110 1110",
"output": "unrated"
},
{
"input": "10\n4078 4078\n3721 3721\n3389 3389\n3279 3279\n2992 2992\n2876 2876\n1702 1702\n1110 1110\n1061 1061\n143 143",
"output": "maybe"
},
{
"input": "2\n3936 3936\n2967 2967",
"output": "maybe"
},
{
"input": "2\n1 1\n2 2",
"output": "unrated"
},
{
"input": "2\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n2 1\n1 2",
"output": "rated"
},
{
"input": "2\n2967 2967\n3936 3936",
"output": "unrated"
},
{
"input": "3\n1200 1200\n1200 1200\n1300 1300",
"output": "unrated"
},
{
"input": "3\n3 3\n2 2\n1 1",
"output": "maybe"
},
{
"input": "3\n1 1\n1 1\n2 2",
"output": "unrated"
},
{
"input": "2\n3 2\n3 2",
"output": "rated"
},
{
"input": "3\n5 5\n4 4\n3 4",
"output": "rated"
},
{
"input": "3\n200 200\n200 200\n300 300",
"output": "unrated"
},
{
"input": "3\n1 1\n2 2\n3 3",
"output": "unrated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2245 2245\n1699 1699",
"output": "maybe"
},
{
"input": "2\n10 10\n8 8",
"output": "maybe"
},
{
"input": "3\n1500 1500\n1500 1500\n1600 1600",
"output": "unrated"
},
{
"input": "3\n1500 1500\n1500 1500\n1700 1700",
"output": "unrated"
},
{
"input": "4\n100 100\n100 100\n70 70\n80 80",
"output": "unrated"
},
{
"input": "2\n1 2\n2 1",
"output": "rated"
},
{
"input": "3\n5 5\n4 3\n3 3",
"output": "rated"
},
{
"input": "3\n1600 1650\n1500 1550\n1400 1450",
"output": "rated"
},
{
"input": "4\n2000 2000\n1500 1500\n1500 1500\n1700 1700",
"output": "unrated"
},
{
"input": "4\n1500 1500\n1400 1400\n1400 1400\n1700 1700",
"output": "unrated"
},
{
"input": "2\n1600 1600\n1400 1400",
"output": "maybe"
},
{
"input": "2\n3 1\n9 8",
"output": "rated"
},
{
"input": "2\n2 1\n1 1",
"output": "rated"
},
{
"input": "4\n4123 4123\n4123 4123\n2670 2670\n3670 3670",
"output": "unrated"
},
{
"input": "2\n2 2\n3 3",
"output": "unrated"
},
{
"input": "2\n10 11\n5 4",
"output": "rated"
},
{
"input": "2\n15 14\n13 12",
"output": "rated"
},
{
"input": "2\n2 1\n2 2",
"output": "rated"
},
{
"input": "3\n2670 2670\n3670 3670\n4106 4106",
"output": "unrated"
},
{
"input": "3\n4 5\n3 3\n2 2",
"output": "rated"
},
{
"input": "2\n10 9\n10 10",
"output": "rated"
},
{
"input": "3\n1011 1011\n1011 999\n2200 2100",
"output": "rated"
},
{
"input": "2\n3 3\n5 5",
"output": "unrated"
},
{
"input": "2\n1500 1500\n3000 2000",
"output": "rated"
},
{
"input": "2\n5 6\n5 5",
"output": "rated"
},
{
"input": "3\n2000 2000\n1500 1501\n500 500",
"output": "rated"
},
{
"input": "2\n2 3\n2 2",
"output": "rated"
},
{
"input": "2\n3 3\n2 2",
"output": "maybe"
},
{
"input": "2\n1 2\n1 1",
"output": "rated"
},
{
"input": "4\n3123 3123\n2777 2777\n2246 2246\n1699 1699",
"output": "maybe"
},
{
"input": "2\n15 14\n14 13",
"output": "rated"
},
{
"input": "4\n3000 3000\n2900 2900\n3000 3000\n2900 2900",
"output": "unrated"
},
{
"input": "6\n30 3060\n24 2194\n26 2903\n24 2624\n37 2991\n24 2884",
"output": "rated"
},
{
"input": "2\n100 99\n100 100",
"output": "rated"
},
{
"input": "4\n2 2\n1 1\n1 1\n2 2",
"output": "unrated"
},
{
"input": "3\n100 101\n100 100\n100 100",
"output": "rated"
},
{
"input": "4\n1000 1001\n900 900\n950 950\n890 890",
"output": "rated"
},
{
"input": "2\n2 3\n1 1",
"output": "rated"
},
{
"input": "2\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n3 2\n2 2",
"output": "rated"
},
{
"input": "2\n3 2\n3 3",
"output": "rated"
},
{
"input": "2\n1 1\n2 2",
"output": "unrated"
},
{
"input": "3\n3 2\n3 3\n3 3",
"output": "rated"
},
{
"input": "4\n1500 1501\n1300 1300\n1200 1200\n1400 1400",
"output": "rated"
},
{
"input": "3\n1000 1000\n500 500\n400 300",
"output": "rated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n3000 3000",
"output": "unrated"
},
{
"input": "2\n1 1\n2 3",
"output": "rated"
},
{
"input": "2\n6 2\n6 2",
"output": "rated"
},
{
"input": "5\n3123 3123\n1699 1699\n2777 2777\n2246 2246\n2246 2246",
"output": "unrated"
},
{
"input": "2\n1500 1500\n1600 1600",
"output": "unrated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2241 2241\n1699 1699",
"output": "maybe"
},
{
"input": "2\n20 30\n10 5",
"output": "rated"
},
{
"input": "3\n1 1\n2 2\n1 1",
"output": "unrated"
},
{
"input": "2\n1 2\n3 3",
"output": "rated"
},
{
"input": "5\n5 5\n4 4\n3 3\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n2 2\n2 1",
"output": "rated"
},
{
"input": "2\n100 100\n90 89",
"output": "rated"
},
{
"input": "2\n1000 900\n2000 2000",
"output": "rated"
},
{
"input": "2\n50 10\n10 50",
"output": "rated"
},
{
"input": "2\n200 200\n100 100",
"output": "maybe"
},
{
"input": "3\n2 2\n2 2\n3 3",
"output": "unrated"
},
{
"input": "3\n1000 1000\n300 300\n100 100",
"output": "maybe"
},
{
"input": "4\n2 2\n2 2\n3 3\n4 4",
"output": "unrated"
},
{
"input": "2\n5 3\n6 3",
"output": "rated"
},
{
"input": "2\n1200 1100\n1200 1000",
"output": "rated"
},
{
"input": "2\n5 5\n4 4",
"output": "maybe"
},
{
"input": "2\n5 5\n3 3",
"output": "maybe"
},
{
"input": "5\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n1100 1100",
"output": "unrated"
},
{
"input": "5\n10 10\n9 9\n8 8\n7 7\n6 6",
"output": "maybe"
},
{
"input": "3\n1000 1000\n300 300\n10 10",
"output": "maybe"
},
{
"input": "5\n6 6\n5 5\n4 4\n3 3\n2 2",
"output": "maybe"
},
{
"input": "2\n3 3\n1 1",
"output": "maybe"
},
{
"input": "4\n2 2\n2 2\n2 2\n3 3",
"output": "unrated"
},
{
"input": "2\n1000 1000\n700 700",
"output": "maybe"
},
{
"input": "2\n4 3\n5 3",
"output": "rated"
},
{
"input": "2\n1000 1000\n1100 1100",
"output": "unrated"
},
{
"input": "4\n5 5\n4 4\n3 3\n2 2",
"output": "maybe"
},
{
"input": "3\n1 1\n2 3\n2 2",
"output": "rated"
},
{
"input": "2\n1 2\n1 3",
"output": "rated"
},
{
"input": "2\n3 3\n1 2",
"output": "rated"
},
{
"input": "4\n1501 1500\n1300 1300\n1200 1200\n1400 1400",
"output": "rated"
},
{
"input": "5\n1 1\n2 2\n3 3\n4 4\n5 5",
"output": "unrated"
},
{
"input": "2\n10 10\n1 2",
"output": "rated"
},
{
"input": "6\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n1900 1900",
"output": "unrated"
},
{
"input": "6\n3123 3123\n2777 2777\n3000 3000\n2246 2246\n2246 2246\n1699 1699",
"output": "unrated"
},
{
"input": "2\n100 100\n110 110",
"output": "unrated"
},
{
"input": "3\n3 3\n3 3\n4 4",
"output": "unrated"
},
{
"input": "3\n3 3\n3 2\n4 4",
"output": "rated"
},
{
"input": "3\n5 2\n4 4\n3 3",
"output": "rated"
},
{
"input": "4\n4 4\n3 3\n2 2\n1 1",
"output": "maybe"
},
{
"input": "2\n1 1\n3 2",
"output": "rated"
},
{
"input": "5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n2699 2699",
"output": "unrated"
},
{
"input": "3\n3 3\n3 3\n3 4",
"output": "rated"
},
{
"input": "3\n1 2\n2 2\n3 3",
"output": "rated"
},
{
"input": "3\n1 2\n1 2\n1 2",
"output": "rated"
},
{
"input": "2\n2 1\n2 1",
"output": "rated"
},
{
"input": "2\n1 2\n3 4",
"output": "rated"
},
{
"input": "2\n3 2\n2 3",
"output": "rated"
},
{
"input": "3\n1500 1500\n1600 1600\n1600 1600",
"output": "unrated"
},
{
"input": "3\n1 1\n3 3\n4 4",
"output": "unrated"
},
{
"input": "3\n1 1\n2 2\n2 2",
"output": "unrated"
},
{
"input": "2\n10 12\n8 8",
"output": "rated"
},
{
"input": "5\n1200 1200\n1500 1500\n1500 1500\n1500 1500\n1500 1500",
"output": "unrated"
},
{
"input": "2\n1 2\n2 2",
"output": "rated"
},
{
"input": "3\n1500 1400\n1200 1200\n1100 1100",
"output": "rated"
},
{
"input": "2\n10 12\n10 10",
"output": "rated"
},
{
"input": "3\n1500 1500\n1400 1400\n1300 1300",
"output": "maybe"
},
{
"input": "3\n3 3\n4 4\n5 5",
"output": "unrated"
},
{
"input": "3\n2 6\n3 5\n4 4",
"output": "rated"
},
{
"input": "2\n5 6\n4 6",
"output": "rated"
},
{
"input": "4\n10 10\n10 10\n7 7\n8 8",
"output": "unrated"
},
{
"input": "2\n4 4\n3 3",
"output": "maybe"
}
] | 1,593,217,124 | 2,147,483,647 | PyPy 3 | OK | TESTS | 150 | 187 | 21,606,400 | t = int(input())
left = []
right = []
for i in range(t):
x , y = input().split()
x , y = int(x) , int(y)
left.append(x)
right.append(y)
if left != right :print('rated')
elif left == right and sorted(left , reverse=True) != left and sorted(right , reverse=True) != right:print('unrated')
else:print('maybe') | Title: Is it rated?
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Is it rated?
Here it is. The Ultimate Question of Competitive Programming, Codeforces, and Everything. And you are here to answer it.
Another Codeforces round has been conducted. No two participants have the same number of points. For each participant, from the top to the bottom of the standings, their rating before and after the round is known.
It's known that if at least one participant's rating has changed, then the round was rated for sure.
It's also known that if the round was rated and a participant with lower rating took a better place in the standings than a participant with higher rating, then at least one round participant's rating has changed.
In this problem, you should not make any other assumptions about the rating system.
Determine if the current round is rated, unrated, or it's impossible to determine whether it is rated of not.
Input Specification:
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=1000) — the number of round participants.
Each of the next *n* lines contains two integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=4126) — the rating of the *i*-th participant before and after the round, respectively. The participants are listed in order from the top to the bottom of the standings.
Output Specification:
If the round is rated for sure, print "rated". If the round is unrated for sure, print "unrated". If it's impossible to determine whether the round is rated or not, print "maybe".
Demo Input:
['6\n3060 3060\n2194 2194\n2876 2903\n2624 2624\n3007 2991\n2884 2884\n', '4\n1500 1500\n1300 1300\n1200 1200\n1400 1400\n', '5\n3123 3123\n2777 2777\n2246 2246\n2246 2246\n1699 1699\n']
Demo Output:
['rated\n', 'unrated\n', 'maybe\n']
Note:
In the first example, the ratings of the participants in the third and fifth places have changed, therefore, the round was rated.
In the second example, no one's rating has changed, but the participant in the second place has lower rating than the participant in the fourth place. Therefore, if the round was rated, someone's rating would've changed for sure.
In the third example, no one's rating has changed, and the participants took places in non-increasing order of their rating. Therefore, it's impossible to determine whether the round is rated or not. | ```python
t = int(input())
left = []
right = []
for i in range(t):
x , y = input().split()
x , y = int(x) , int(y)
left.append(x)
right.append(y)
if left != right :print('rated')
elif left == right and sorted(left , reverse=True) != left and sorted(right , reverse=True) != right:print('unrated')
else:print('maybe')
``` | 3 |
|
379 | A | New Year Candles | PROGRAMMING | 1,000 | [
"implementation"
] | null | null | Vasily the Programmer loves romance, so this year he decided to illuminate his room with candles.
Vasily has *a* candles.When Vasily lights up a new candle, it first burns for an hour and then it goes out. Vasily is smart, so he can make *b* went out candles into a new candle. As a result, this new candle can be used like any other new candle.
Now Vasily wonders: for how many hours can his candles light up the room if he acts optimally well? Help him find this number. | The single line contains two integers, *a* and *b* (1<=≤<=*a*<=≤<=1000; 2<=≤<=*b*<=≤<=1000). | Print a single integer — the number of hours Vasily can light up the room for. | [
"4 2\n",
"6 3\n"
] | [
"7\n",
"8\n"
] | Consider the first sample. For the first four hours Vasily lights up new candles, then he uses four burned out candles to make two new ones and lights them up. When these candles go out (stop burning), Vasily can make another candle. Overall, Vasily can light up the room for 7 hours. | 500 | [
{
"input": "4 2",
"output": "7"
},
{
"input": "6 3",
"output": "8"
},
{
"input": "1000 1000",
"output": "1001"
},
{
"input": "123 5",
"output": "153"
},
{
"input": "1000 2",
"output": "1999"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "1 4",
"output": "1"
},
{
"input": "2 2",
"output": "3"
},
{
"input": "3 2",
"output": "5"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "999 2",
"output": "1997"
},
{
"input": "1000 3",
"output": "1499"
},
{
"input": "1000 4",
"output": "1333"
},
{
"input": "1 1000",
"output": "1"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "80 970",
"output": "80"
},
{
"input": "10 4",
"output": "13"
},
{
"input": "4 3",
"output": "5"
},
{
"input": "91 5",
"output": "113"
},
{
"input": "777 17",
"output": "825"
},
{
"input": "100 4",
"output": "133"
},
{
"input": "5 3",
"output": "7"
},
{
"input": "6 4",
"output": "7"
},
{
"input": "26 8",
"output": "29"
},
{
"input": "9 4",
"output": "11"
},
{
"input": "20 3",
"output": "29"
},
{
"input": "17 3",
"output": "25"
}
] | 1,643,800,871 | 2,147,483,647 | Python 3 | OK | TESTS | 32 | 46 | 0 | a,b=map(int,input().split())
c=int(a-1)/(b-1)
print(int(a+c))
| Title: New Year Candles
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasily the Programmer loves romance, so this year he decided to illuminate his room with candles.
Vasily has *a* candles.When Vasily lights up a new candle, it first burns for an hour and then it goes out. Vasily is smart, so he can make *b* went out candles into a new candle. As a result, this new candle can be used like any other new candle.
Now Vasily wonders: for how many hours can his candles light up the room if he acts optimally well? Help him find this number.
Input Specification:
The single line contains two integers, *a* and *b* (1<=≤<=*a*<=≤<=1000; 2<=≤<=*b*<=≤<=1000).
Output Specification:
Print a single integer — the number of hours Vasily can light up the room for.
Demo Input:
['4 2\n', '6 3\n']
Demo Output:
['7\n', '8\n']
Note:
Consider the first sample. For the first four hours Vasily lights up new candles, then he uses four burned out candles to make two new ones and lights them up. When these candles go out (stop burning), Vasily can make another candle. Overall, Vasily can light up the room for 7 hours. | ```python
a,b=map(int,input().split())
c=int(a-1)/(b-1)
print(int(a+c))
``` | 3 |
|
322 | B | Ciel and Flowers | PROGRAMMING | 1,600 | [
"combinatorics",
"math"
] | null | null | Fox Ciel has some flowers: *r* red flowers, *g* green flowers and *b* blue flowers. She wants to use these flowers to make several bouquets. There are 4 types of bouquets:
- To make a "red bouquet", it needs 3 red flowers. - To make a "green bouquet", it needs 3 green flowers. - To make a "blue bouquet", it needs 3 blue flowers. - To make a "mixing bouquet", it needs 1 red, 1 green and 1 blue flower.
Help Fox Ciel to find the maximal number of bouquets she can make. | The first line contains three integers *r*, *g* and *b* (0<=≤<=*r*,<=*g*,<=*b*<=≤<=109) — the number of red, green and blue flowers. | Print the maximal number of bouquets Fox Ciel can make. | [
"3 6 9\n",
"4 4 4\n",
"0 0 0\n"
] | [
"6\n",
"4\n",
"0\n"
] | In test case 1, we can make 1 red bouquet, 2 green bouquets and 3 blue bouquets.
In test case 2, we can make 1 red, 1 green, 1 blue and 1 mixing bouquet. | 1,000 | [
{
"input": "3 6 9",
"output": "6"
},
{
"input": "4 4 4",
"output": "4"
},
{
"input": "0 0 0",
"output": "0"
},
{
"input": "0 3 6",
"output": "3"
},
{
"input": "7 8 9",
"output": "7"
},
{
"input": "8 8 9",
"output": "8"
},
{
"input": "15 3 999",
"output": "339"
},
{
"input": "32 62 92",
"output": "62"
},
{
"input": "123456789 123456789 123456789",
"output": "123456789"
},
{
"input": "3 5 5",
"output": "4"
},
{
"input": "666806767 385540591 357848286",
"output": "470065214"
},
{
"input": "80010646 727118126 817880463",
"output": "541669744"
},
{
"input": "829651016 732259171 572879931",
"output": "711596705"
},
{
"input": "242854896 442432924 180395753",
"output": "288561190"
},
{
"input": "139978911 5123031 935395222",
"output": "360165721"
},
{
"input": "553182792 10264076 395427398",
"output": "319624755"
},
{
"input": "597790453 720437830 855459575",
"output": "724562619"
},
{
"input": "494914467 356982656 757942689",
"output": "536613270"
},
{
"input": "908118348 67156409 217974865",
"output": "397749873"
},
{
"input": "952726009 629846517 972974334",
"output": "851848953"
},
{
"input": "775140200 616574841 630329230",
"output": "674014756"
},
{
"input": "524780569 326748594 90361407",
"output": "313963523"
},
{
"input": "937984449 184405994 992844522",
"output": "705078321"
},
{
"input": "835108464 525983528 452876698",
"output": "604656229"
},
{
"input": "879716125 531124573 207876166",
"output": "539572288"
},
{
"input": "292920005 241298326 667908343",
"output": "400708891"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1000000000"
},
{
"input": "1000000000 999999999 999999998",
"output": "999999998"
},
{
"input": "999999998 999999998 999999999",
"output": "999999998"
},
{
"input": "0 1 1",
"output": "0"
},
{
"input": "0 1000000000 0",
"output": "333333333"
},
{
"input": "0 1 0",
"output": "0"
},
{
"input": "1 0 0",
"output": "0"
},
{
"input": "0 2 2",
"output": "0"
},
{
"input": "3 3 5",
"output": "3"
},
{
"input": "2 2 0",
"output": "0"
},
{
"input": "0 5 5",
"output": "2"
},
{
"input": "2 0 11",
"output": "3"
},
{
"input": "9 9 7",
"output": "8"
},
{
"input": "65 30 74",
"output": "56"
}
] | 1,623,413,621 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 9 | 248 | 307,200 | from sys import stdin,stdout
stdin.readline
def mp(): return list(map(int, stdin.readline().strip().split()))
def it():return int(stdin.readline().strip())
from collections import defaultdict as dd,Counter as C,deque
from math import ceil,gcd,sqrt,factorial,log2,floor
from bisect import bisect_right as br,bisect_left as bl
import heapq
r,g,b = mp()
ans = min(r,g,b)
r -= ans
g -= ans
b -= ans
ans += r//3
ans += g//3
ans += b//3
print(ans)
| Title: Ciel and Flowers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Fox Ciel has some flowers: *r* red flowers, *g* green flowers and *b* blue flowers. She wants to use these flowers to make several bouquets. There are 4 types of bouquets:
- To make a "red bouquet", it needs 3 red flowers. - To make a "green bouquet", it needs 3 green flowers. - To make a "blue bouquet", it needs 3 blue flowers. - To make a "mixing bouquet", it needs 1 red, 1 green and 1 blue flower.
Help Fox Ciel to find the maximal number of bouquets she can make.
Input Specification:
The first line contains three integers *r*, *g* and *b* (0<=≤<=*r*,<=*g*,<=*b*<=≤<=109) — the number of red, green and blue flowers.
Output Specification:
Print the maximal number of bouquets Fox Ciel can make.
Demo Input:
['3 6 9\n', '4 4 4\n', '0 0 0\n']
Demo Output:
['6\n', '4\n', '0\n']
Note:
In test case 1, we can make 1 red bouquet, 2 green bouquets and 3 blue bouquets.
In test case 2, we can make 1 red, 1 green, 1 blue and 1 mixing bouquet. | ```python
from sys import stdin,stdout
stdin.readline
def mp(): return list(map(int, stdin.readline().strip().split()))
def it():return int(stdin.readline().strip())
from collections import defaultdict as dd,Counter as C,deque
from math import ceil,gcd,sqrt,factorial,log2,floor
from bisect import bisect_right as br,bisect_left as bl
import heapq
r,g,b = mp()
ans = min(r,g,b)
r -= ans
g -= ans
b -= ans
ans += r//3
ans += g//3
ans += b//3
print(ans)
``` | 0 |
|
339 | A | Helpful Maths | PROGRAMMING | 800 | [
"greedy",
"implementation",
"sortings",
"strings"
] | null | null | Xenia the beginner mathematician is a third year student at elementary school. She is now learning the addition operation.
The teacher has written down the sum of multiple numbers. Pupils should calculate the sum. To make the calculation easier, the sum only contains numbers 1, 2 and 3. Still, that isn't enough for Xenia. She is only beginning to count, so she can calculate a sum only if the summands follow in non-decreasing order. For example, she can't calculate sum 1+3+2+1 but she can calculate sums 1+1+2 and 3+3.
You've got the sum that was written on the board. Rearrange the summans and print the sum in such a way that Xenia can calculate the sum. | The first line contains a non-empty string *s* — the sum Xenia needs to count. String *s* contains no spaces. It only contains digits and characters "+". Besides, string *s* is a correct sum of numbers 1, 2 and 3. String *s* is at most 100 characters long. | Print the new sum that Xenia can count. | [
"3+2+1\n",
"1+1+3+1+3\n",
"2\n"
] | [
"1+2+3\n",
"1+1+1+3+3\n",
"2\n"
] | none | 500 | [
{
"input": "3+2+1",
"output": "1+2+3"
},
{
"input": "1+1+3+1+3",
"output": "1+1+1+3+3"
},
{
"input": "2",
"output": "2"
},
{
"input": "2+2+1+1+3",
"output": "1+1+2+2+3"
},
{
"input": "2+1+2+2+2+3+1+3+1+2",
"output": "1+1+1+2+2+2+2+2+3+3"
},
{
"input": "1+2+1+2+2+2+2+1+3+3",
"output": "1+1+1+2+2+2+2+2+3+3"
},
{
"input": "2+3+3+1+2+2+2+1+1+2+1+3+2+2+3+3+2+2+3+3+3+1+1+1+3+3+3+2+1+3+2+3+2+1+1+3+3+3+1+2+2+1+2+2+1+2+1+3+1+1",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "1",
"output": "1"
},
{
"input": "2+1+2+2+1+3+2+3+1+1+2+1+2+2+3+1+1+3+3+3+2+2+3+2+2+2+1+2+1+2+3+2+2+2+1+3+1+3+3+3+1+2+1+2+2+2+2+3+1+1",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "2+2+1+1+1+3+1+1+3+3+2+3+1+3+1+1+3+1+1+2+2+2+2+1+2+1+2+1+1+1+3+1+3+2+3+2+3+3+1+1+1+2+3+2+1+3+1+3+2+2",
"output": "1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "3+2+3+3+2+2+1+2+1+2+3+1+2+3+2+3+2+1+2+2+1+1+2+2+3+2+1+3+1+1+3+2+2+2+2+3+3+2+2+3+3+1+1+2+3+3+2+3+3+3",
"output": "1+1+1+1+1+1+1+1+1+1+1+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+2+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3+3"
},
{
"input": "3",
"output": "3"
},
{
"input": "1+1",
"output": "1+1"
},
{
"input": "1+2",
"output": "1+2"
},
{
"input": "1+3",
"output": "1+3"
},
{
"input": "2+1",
"output": "1+2"
},
{
"input": "2+2",
"output": "2+2"
},
{
"input": "2+3",
"output": "2+3"
},
{
"input": "3+1",
"output": "1+3"
},
{
"input": "3+2",
"output": "2+3"
},
{
"input": "3+3",
"output": "3+3"
}
] | 1,694,660,081 | 2,147,483,647 | Python 3 | OK | TESTS | 21 | 92 | 0 | a=input()
b=[]
for i in range(0,len(a),2):
b.append(a[i])
b.sort()
b="+".join(b)
print(b)
| Title: Helpful Maths
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Xenia the beginner mathematician is a third year student at elementary school. She is now learning the addition operation.
The teacher has written down the sum of multiple numbers. Pupils should calculate the sum. To make the calculation easier, the sum only contains numbers 1, 2 and 3. Still, that isn't enough for Xenia. She is only beginning to count, so she can calculate a sum only if the summands follow in non-decreasing order. For example, she can't calculate sum 1+3+2+1 but she can calculate sums 1+1+2 and 3+3.
You've got the sum that was written on the board. Rearrange the summans and print the sum in such a way that Xenia can calculate the sum.
Input Specification:
The first line contains a non-empty string *s* — the sum Xenia needs to count. String *s* contains no spaces. It only contains digits and characters "+". Besides, string *s* is a correct sum of numbers 1, 2 and 3. String *s* is at most 100 characters long.
Output Specification:
Print the new sum that Xenia can count.
Demo Input:
['3+2+1\n', '1+1+3+1+3\n', '2\n']
Demo Output:
['1+2+3\n', '1+1+1+3+3\n', '2\n']
Note:
none | ```python
a=input()
b=[]
for i in range(0,len(a),2):
b.append(a[i])
b.sort()
b="+".join(b)
print(b)
``` | 3 |
|
231 | A | Team | PROGRAMMING | 800 | [
"brute force",
"greedy"
] | null | null | One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution.
This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution. | The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces. | Print a single integer — the number of problems the friends will implement on the contest. | [
"3\n1 1 0\n1 1 1\n1 0 0\n",
"2\n1 0 0\n0 1 1\n"
] | [
"2\n",
"1\n"
] | In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it.
In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution. | 500 | [
{
"input": "3\n1 1 0\n1 1 1\n1 0 0",
"output": "2"
},
{
"input": "2\n1 0 0\n0 1 1",
"output": "1"
},
{
"input": "1\n1 0 0",
"output": "0"
},
{
"input": "2\n1 0 0\n1 1 1",
"output": "1"
},
{
"input": "5\n1 0 0\n0 1 0\n1 1 1\n0 0 1\n0 0 0",
"output": "1"
},
{
"input": "10\n0 1 0\n0 1 0\n1 1 0\n1 0 0\n0 0 1\n0 1 1\n1 1 1\n1 1 0\n0 0 0\n0 0 0",
"output": "4"
},
{
"input": "15\n0 1 0\n1 0 0\n1 1 0\n1 1 1\n0 1 0\n0 0 1\n1 0 1\n1 0 1\n1 0 1\n0 0 0\n1 1 1\n1 1 0\n0 1 1\n1 1 0\n1 1 1",
"output": "10"
},
{
"input": "50\n0 0 0\n0 1 1\n1 1 1\n0 1 0\n1 0 1\n1 1 1\n0 0 1\n1 0 0\n1 1 0\n1 0 1\n0 1 0\n0 0 1\n1 1 0\n0 1 0\n1 1 0\n0 0 0\n1 1 1\n1 0 1\n0 0 1\n1 1 0\n1 1 1\n0 1 1\n1 1 0\n0 0 0\n0 0 0\n1 1 1\n0 0 0\n1 1 1\n0 1 1\n0 0 1\n0 0 0\n0 0 0\n1 1 0\n1 1 0\n1 0 1\n1 0 0\n1 0 1\n1 0 1\n0 1 1\n1 1 0\n1 1 0\n0 1 0\n1 0 1\n0 0 0\n0 0 0\n0 0 0\n0 0 1\n1 1 1\n0 1 1\n1 0 1",
"output": "29"
},
{
"input": "1\n1 1 1",
"output": "1"
},
{
"input": "8\n0 0 0\n0 0 1\n0 0 0\n0 1 1\n1 0 0\n1 0 1\n1 1 0\n1 1 1",
"output": "4"
},
{
"input": "16\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1",
"output": "16"
}
] | 1,697,737,931 | 2,147,483,647 | Python 3 | OK | TESTS | 21 | 92 | 0 | cases_num=int(input())
res=0
for ix in range(cases_num):
inputs=input()
cases=inputs.split(' ')
score=0
for num in cases:
score+=(int(num))
if score>=2:
res+=1
print(res) | Title: Team
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution.
This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution.
Input Specification:
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces.
Output Specification:
Print a single integer — the number of problems the friends will implement on the contest.
Demo Input:
['3\n1 1 0\n1 1 1\n1 0 0\n', '2\n1 0 0\n0 1 1\n']
Demo Output:
['2\n', '1\n']
Note:
In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it.
In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution. | ```python
cases_num=int(input())
res=0
for ix in range(cases_num):
inputs=input()
cases=inputs.split(' ')
score=0
for num in cases:
score+=(int(num))
if score>=2:
res+=1
print(res)
``` | 3 |
|
292 | D | Connected Components | PROGRAMMING | 1,900 | [
"data structures",
"dfs and similar",
"dp",
"dsu"
] | null | null | We already know of the large corporation where Polycarpus works as a system administrator. The computer network there consists of *n* computers and *m* cables that connect some pairs of computers. In other words, the computer network can be represented as some non-directed graph with *n* nodes and *m* edges. Let's index the computers with integers from 1 to *n*, let's index the cables with integers from 1 to *m*.
Polycarpus was given an important task — check the reliability of his company's network. For that Polycarpus decided to carry out a series of *k* experiments on the computer network, where the *i*-th experiment goes as follows:
1. Temporarily disconnect the cables with indexes from *l**i* to *r**i*, inclusive (the other cables remain connected). 1. Count the number of connected components in the graph that is defining the computer network at that moment. 1. Re-connect the disconnected cables with indexes from *l**i* to *r**i* (that is, restore the initial network).
Help Polycarpus carry out all experiments and for each print the number of connected components in the graph that defines the computer network through the given experiment. Isolated vertex should be counted as single component. | The first line contains two space-separated integers *n*, *m* (2<=≤<=*n*<=≤<=500; 1<=≤<=*m*<=≤<=104) — the number of computers and the number of cables, correspondingly.
The following *m* lines contain the cables' description. The *i*-th line contains space-separated pair of integers *x**i*, *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=*n*; *x**i*<=≠<=*y**i*) — the numbers of the computers that are connected by the *i*-th cable. Note that a pair of computers can be connected by multiple cables.
The next line contains integer *k* (1<=≤<=*k*<=≤<=2·104) — the number of experiments. Next *k* lines contain the experiments' descriptions. The *i*-th line contains space-separated integers *l**i*, *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*m*) — the numbers of the cables that Polycarpus disconnects during the *i*-th experiment. | Print *k* numbers, the *i*-th number represents the number of connected components of the graph that defines the computer network during the *i*-th experiment. | [
"6 5\n1 2\n5 4\n2 3\n3 1\n3 6\n6\n1 3\n2 5\n1 5\n5 5\n2 4\n3 3\n"
] | [
"4\n5\n6\n3\n4\n2\n"
] | none | 2,000 | [
{
"input": "6 5\n1 2\n5 4\n2 3\n3 1\n3 6\n6\n1 3\n2 5\n1 5\n5 5\n2 4\n3 3",
"output": "4\n5\n6\n3\n4\n2"
},
{
"input": "2 1\n2 1\n2\n1 1\n1 1",
"output": "2\n2"
},
{
"input": "3 2\n3 2\n3 1\n4\n1 1\n1 2\n2 2\n2 2",
"output": "2\n3\n2\n2"
},
{
"input": "3 3\n2 3\n3 1\n2 1\n5\n2 3\n3 3\n2 2\n2 2\n2 2",
"output": "2\n1\n1\n1\n1"
},
{
"input": "4 5\n1 4\n2 1\n4 3\n2 1\n3 4\n5\n4 5\n2 4\n4 4\n1 3\n4 4",
"output": "1\n2\n1\n2\n1"
},
{
"input": "5 4\n3 2\n5 2\n5 3\n2 3\n8\n4 4\n1 1\n3 4\n1 1\n3 3\n3 4\n3 4\n4 4",
"output": "3\n3\n3\n3\n3\n3\n3\n3"
},
{
"input": "8 10\n8 6\n8 7\n8 3\n3 7\n4 8\n1 6\n5 1\n8 7\n6 8\n1 6\n13\n1 10\n2 6\n3 3\n5 5\n2 2\n1 3\n10 10\n7 7\n2 4\n3 6\n2 7\n9 9\n3 6",
"output": "8\n4\n2\n3\n2\n2\n2\n3\n3\n4\n5\n2\n4"
},
{
"input": "10 10\n7 5\n5 9\n10 9\n8 7\n5 10\n4 2\n8 2\n9 1\n2 8\n10 7\n10\n10 10\n7 9\n2 6\n1 5\n4 7\n9 9\n7 7\n2 6\n6 9\n10 10",
"output": "3\n5\n6\n6\n5\n3\n3\n6\n6\n3"
},
{
"input": "7 14\n7 1\n1 5\n6 4\n7 6\n2 4\n2 4\n7 2\n3 1\n7 6\n6 7\n5 3\n5 4\n1 3\n6 2\n40\n2 3\n14 14\n13 14\n13 13\n7 9\n1 13\n12 14\n14 14\n12 12\n6 10\n6 14\n8 8\n14 14\n9 10\n8 9\n8 11\n9 9\n2 3\n1 11\n13 14\n4 11\n2 9\n1 10\n6 11\n3 3\n4 12\n5 11\n8 8\n7 14\n13 13\n14 14\n14 14\n8 12\n14 14\n8 8\n7 7\n2 11\n10 12\n4 5\n9 10",
"output": "1\n1\n1\n1\n1\n6\n1\n1\n1\n1\n2\n1\n1\n1\n1\n1\n1\n1\n4\n1\n1\n1\n3\n1\n1\n2\n1\n1\n2\n1\n1\n1\n1\n1\n1\n1\n3\n1\n1\n1"
}
] | 1,389,539,127 | 2,147,483,647 | Python 3 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | #include <iostream>
#define _USE_MATH_DEFINES
#include <stdio.h>
#include <stdlib.h>
#include <set>
#include <list>
#include <string>
#include <algorithm>
#include <map>
#include <cmath>
#include <stack>
#include <functional>
#include <math.h>
#include <queue>
#include <vector>
#include <bitset>
#include <cstdio>
#pragma comment(linker, "/STACK:256000000")
typedef long long ll;
#define MP make_pair
using namespace std;
int p[555];
int rang[555];
void make_set(int x) {
p[x] = x;
rang[x] = 0;
}
int find_set(int x) {
if (p[x] == x)
return x;
return p[x] = find_set(p[x]);
}
void union_set(int x, int y) {
x = find_set(x);
y = find_set(y);
if (rang[x] > rang[y])
swap(x, y);
if (x != y) {
p[x] = y;
rang[y] += (rang[x] == rang[y]);
}
}
int main() {
//freopen("input.txt","r",stdin);
//freopen("output.txt","w",stdout);
int n, m;
cin >> n >> m;
stack <int> ans;
vector <pair <int, int> > v;
pair <int, int> pp = MP(-1, -1);
v.push_back(pp);
for (int i = 1; i <= m; i++) {
int x, y;
cin >> x >> y;
pp = MP(x, y);
v.push_back(pp);
}
int q;
cin >> q;
stack <int> st;
bool us[555];
for (int i = 0; i <= 545; i++)
us[i] = 1;
for (int i = 1; i <= q; i++) {
vector <int> gr[555];
int l, r;
cin >> l >> r;
for (int i = 1; i <= n; i++)
make_set(i);
int komp = n;
for (int i = 1; i <= m; i++) {
if (!(i >= l && i <= r)) {
int u = v[i].first, vv = v[i].second;
gr[u].push_back(vv);
gr[vv].push_back(u);
if (find_set(u) != find_set(vv))
komp--;
union_set(u, vv);
}
}
cout << komp << endl;
}
} | Title: Connected Components
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
We already know of the large corporation where Polycarpus works as a system administrator. The computer network there consists of *n* computers and *m* cables that connect some pairs of computers. In other words, the computer network can be represented as some non-directed graph with *n* nodes and *m* edges. Let's index the computers with integers from 1 to *n*, let's index the cables with integers from 1 to *m*.
Polycarpus was given an important task — check the reliability of his company's network. For that Polycarpus decided to carry out a series of *k* experiments on the computer network, where the *i*-th experiment goes as follows:
1. Temporarily disconnect the cables with indexes from *l**i* to *r**i*, inclusive (the other cables remain connected). 1. Count the number of connected components in the graph that is defining the computer network at that moment. 1. Re-connect the disconnected cables with indexes from *l**i* to *r**i* (that is, restore the initial network).
Help Polycarpus carry out all experiments and for each print the number of connected components in the graph that defines the computer network through the given experiment. Isolated vertex should be counted as single component.
Input Specification:
The first line contains two space-separated integers *n*, *m* (2<=≤<=*n*<=≤<=500; 1<=≤<=*m*<=≤<=104) — the number of computers and the number of cables, correspondingly.
The following *m* lines contain the cables' description. The *i*-th line contains space-separated pair of integers *x**i*, *y**i* (1<=≤<=*x**i*,<=*y**i*<=≤<=*n*; *x**i*<=≠<=*y**i*) — the numbers of the computers that are connected by the *i*-th cable. Note that a pair of computers can be connected by multiple cables.
The next line contains integer *k* (1<=≤<=*k*<=≤<=2·104) — the number of experiments. Next *k* lines contain the experiments' descriptions. The *i*-th line contains space-separated integers *l**i*, *r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=*m*) — the numbers of the cables that Polycarpus disconnects during the *i*-th experiment.
Output Specification:
Print *k* numbers, the *i*-th number represents the number of connected components of the graph that defines the computer network during the *i*-th experiment.
Demo Input:
['6 5\n1 2\n5 4\n2 3\n3 1\n3 6\n6\n1 3\n2 5\n1 5\n5 5\n2 4\n3 3\n']
Demo Output:
['4\n5\n6\n3\n4\n2\n']
Note:
none | ```python
#include <iostream>
#define _USE_MATH_DEFINES
#include <stdio.h>
#include <stdlib.h>
#include <set>
#include <list>
#include <string>
#include <algorithm>
#include <map>
#include <cmath>
#include <stack>
#include <functional>
#include <math.h>
#include <queue>
#include <vector>
#include <bitset>
#include <cstdio>
#pragma comment(linker, "/STACK:256000000")
typedef long long ll;
#define MP make_pair
using namespace std;
int p[555];
int rang[555];
void make_set(int x) {
p[x] = x;
rang[x] = 0;
}
int find_set(int x) {
if (p[x] == x)
return x;
return p[x] = find_set(p[x]);
}
void union_set(int x, int y) {
x = find_set(x);
y = find_set(y);
if (rang[x] > rang[y])
swap(x, y);
if (x != y) {
p[x] = y;
rang[y] += (rang[x] == rang[y]);
}
}
int main() {
//freopen("input.txt","r",stdin);
//freopen("output.txt","w",stdout);
int n, m;
cin >> n >> m;
stack <int> ans;
vector <pair <int, int> > v;
pair <int, int> pp = MP(-1, -1);
v.push_back(pp);
for (int i = 1; i <= m; i++) {
int x, y;
cin >> x >> y;
pp = MP(x, y);
v.push_back(pp);
}
int q;
cin >> q;
stack <int> st;
bool us[555];
for (int i = 0; i <= 545; i++)
us[i] = 1;
for (int i = 1; i <= q; i++) {
vector <int> gr[555];
int l, r;
cin >> l >> r;
for (int i = 1; i <= n; i++)
make_set(i);
int komp = n;
for (int i = 1; i <= m; i++) {
if (!(i >= l && i <= r)) {
int u = v[i].first, vv = v[i].second;
gr[u].push_back(vv);
gr[vv].push_back(u);
if (find_set(u) != find_set(vv))
komp--;
union_set(u, vv);
}
}
cout << komp << endl;
}
}
``` | -1 |
|
50 | A | Domino piling | PROGRAMMING | 800 | [
"greedy",
"math"
] | A. Domino piling | 2 | 256 | You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions. | In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16). | Output one number — the maximal number of dominoes, which can be placed. | [
"2 4\n",
"3 3\n"
] | [
"4\n",
"4\n"
] | none | 500 | [
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,647,362,354 | 2,147,483,647 | Python 3 | OK | TESTS | 35 | 248 | 6,041,600 | from tkinter import N
m,n = list(map(int, input().split()))
t= m*n
c=0
if n%2==0:
c= n/2*m
elif m%2==0:
c= m/2*n
else:
c= ((m-1)/2*n)+ (n-1)/2
print(int(c)) | Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none | ```python
from tkinter import N
m,n = list(map(int, input().split()))
t= m*n
c=0
if n%2==0:
c= n/2*m
elif m%2==0:
c= m/2*n
else:
c= ((m-1)/2*n)+ (n-1)/2
print(int(c))
``` | 3.926747 |
912 | B | New Year's Eve | PROGRAMMING | 1,300 | [
"bitmasks",
"constructive algorithms",
"number theory"
] | null | null | Since Grisha behaved well last year, at New Year's Eve he was visited by Ded Moroz who brought an enormous bag of gifts with him! The bag contains *n* sweet candies from the good ol' bakery, each labeled from 1 to *n* corresponding to its tastiness. No two candies have the same tastiness.
The choice of candies has a direct effect on Grisha's happiness. One can assume that he should take the tastiest ones — but no, the holiday magic turns things upside down. It is the xor-sum of tastinesses that matters, not the ordinary sum!
A xor-sum of a sequence of integers *a*1,<=*a*2,<=...,<=*a**m* is defined as the bitwise XOR of all its elements: , here denotes the bitwise XOR operation; more about bitwise XOR can be found [here.](https://en.wikipedia.org/wiki/Bitwise_operation#XOR)
Ded Moroz warned Grisha he has more houses to visit, so Grisha can take no more than *k* candies from the bag. Help Grisha determine the largest xor-sum (largest xor-sum means maximum happiness!) he can obtain. | The sole string contains two integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=1018). | Output one number — the largest possible xor-sum. | [
"4 3\n",
"6 6\n"
] | [
"7\n",
"7\n"
] | In the first sample case, one optimal answer is 1, 2 and 4, giving the xor-sum of 7.
In the second sample case, one can, for example, take all six candies and obtain the xor-sum of 7. | 1,000 | [
{
"input": "4 3",
"output": "7"
},
{
"input": "6 6",
"output": "7"
},
{
"input": "2 2",
"output": "3"
},
{
"input": "1022 10",
"output": "1023"
},
{
"input": "415853337373441 52",
"output": "562949953421311"
},
{
"input": "75 12",
"output": "127"
},
{
"input": "1000000000000000000 1000000000000000000",
"output": "1152921504606846975"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1000000000000000000 2",
"output": "1152921504606846975"
},
{
"input": "49194939 22",
"output": "67108863"
},
{
"input": "228104606 17",
"output": "268435455"
},
{
"input": "817034381 7",
"output": "1073741823"
},
{
"input": "700976748 4",
"output": "1073741823"
},
{
"input": "879886415 9",
"output": "1073741823"
},
{
"input": "18007336 10353515",
"output": "33554431"
},
{
"input": "196917003 154783328",
"output": "268435455"
},
{
"input": "785846777 496205300",
"output": "1073741823"
},
{
"input": "964756444 503568330",
"output": "1073741823"
},
{
"input": "848698811 317703059",
"output": "1073741823"
},
{
"input": "676400020444788 1",
"output": "676400020444788"
},
{
"input": "502643198528213 1",
"output": "502643198528213"
},
{
"input": "815936580997298686 684083143940282566",
"output": "1152921504606846975"
},
{
"input": "816762824175382110 752185261508428780",
"output": "1152921504606846975"
},
{
"input": "327942415253132295 222598158321260499",
"output": "576460752303423487"
},
{
"input": "328768654136248423 284493129147496637",
"output": "576460752303423487"
},
{
"input": "329594893019364551 25055600080496801",
"output": "576460752303423487"
},
{
"input": "921874985256864012 297786684518764536",
"output": "1152921504606846975"
},
{
"input": "922701224139980141 573634416190460758",
"output": "1152921504606846975"
},
{
"input": "433880815217730325 45629641110945892",
"output": "576460752303423487"
},
{
"input": "434707058395813749 215729375494216481",
"output": "576460752303423487"
},
{
"input": "435533301573897173 34078453236225189",
"output": "576460752303423487"
},
{
"input": "436359544751980597 199220719961060641",
"output": "576460752303423487"
},
{
"input": "437185783635096725 370972992240105630",
"output": "576460752303423487"
},
{
"input": "438012026813180149 111323110116193830",
"output": "576460752303423487"
},
{
"input": "438838269991263573 295468957052046146",
"output": "576460752303423487"
},
{
"input": "439664513169346997 46560240538186155",
"output": "576460752303423487"
},
{
"input": "440490752052463125 216165966013438147",
"output": "576460752303423487"
},
{
"input": "441316995230546549 401964286420555423",
"output": "576460752303423487"
},
{
"input": "952496582013329437 673506882352402278",
"output": "1152921504606846975"
},
{
"input": "1000000000000000000 1",
"output": "1000000000000000000"
},
{
"input": "2147483647 1",
"output": "2147483647"
},
{
"input": "2147483647 2",
"output": "2147483647"
},
{
"input": "2147483647 31",
"output": "2147483647"
},
{
"input": "8 2",
"output": "15"
},
{
"input": "3 3",
"output": "3"
},
{
"input": "4 1",
"output": "4"
},
{
"input": "10 2",
"output": "15"
},
{
"input": "288230376151711743 2",
"output": "288230376151711743"
},
{
"input": "5 2",
"output": "7"
},
{
"input": "576460752303423487 2",
"output": "576460752303423487"
},
{
"input": "36028797018963967 123",
"output": "36028797018963967"
},
{
"input": "1125899906842623 2",
"output": "1125899906842623"
},
{
"input": "576460752303423489 5",
"output": "1152921504606846975"
},
{
"input": "288230376151711743 3",
"output": "288230376151711743"
},
{
"input": "36028797018963967 345",
"output": "36028797018963967"
},
{
"input": "18014398509481984 30",
"output": "36028797018963967"
},
{
"input": "8 8",
"output": "15"
},
{
"input": "8 1",
"output": "8"
}
] | 1,614,694,325 | 2,147,483,647 | Python 3 | OK | TESTS | 58 | 62 | 307,200 | def precompute(arr) :
arr[0] = 1
for index in range(1,60) :
arr[index] = arr[index-1]*2
def solve(n,k,power) :
if k == 1 :
return n
else :
for index in range(59,-1,-1):
if power[index] <= n :
return power[index] + (power[index] - 1)
arr = [0] * 60
n,k = list(map(int,input().split()))
precompute(arr)
print (solve(n,k,arr))
| Title: New Year's Eve
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Since Grisha behaved well last year, at New Year's Eve he was visited by Ded Moroz who brought an enormous bag of gifts with him! The bag contains *n* sweet candies from the good ol' bakery, each labeled from 1 to *n* corresponding to its tastiness. No two candies have the same tastiness.
The choice of candies has a direct effect on Grisha's happiness. One can assume that he should take the tastiest ones — but no, the holiday magic turns things upside down. It is the xor-sum of tastinesses that matters, not the ordinary sum!
A xor-sum of a sequence of integers *a*1,<=*a*2,<=...,<=*a**m* is defined as the bitwise XOR of all its elements: , here denotes the bitwise XOR operation; more about bitwise XOR can be found [here.](https://en.wikipedia.org/wiki/Bitwise_operation#XOR)
Ded Moroz warned Grisha he has more houses to visit, so Grisha can take no more than *k* candies from the bag. Help Grisha determine the largest xor-sum (largest xor-sum means maximum happiness!) he can obtain.
Input Specification:
The sole string contains two integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=1018).
Output Specification:
Output one number — the largest possible xor-sum.
Demo Input:
['4 3\n', '6 6\n']
Demo Output:
['7\n', '7\n']
Note:
In the first sample case, one optimal answer is 1, 2 and 4, giving the xor-sum of 7.
In the second sample case, one can, for example, take all six candies and obtain the xor-sum of 7. | ```python
def precompute(arr) :
arr[0] = 1
for index in range(1,60) :
arr[index] = arr[index-1]*2
def solve(n,k,power) :
if k == 1 :
return n
else :
for index in range(59,-1,-1):
if power[index] <= n :
return power[index] + (power[index] - 1)
arr = [0] * 60
n,k = list(map(int,input().split()))
precompute(arr)
print (solve(n,k,arr))
``` | 3 |
|
593 | B | Anton and Lines | PROGRAMMING | 1,600 | [
"geometry",
"sortings"
] | null | null | The teacher gave Anton a large geometry homework, but he didn't do it (as usual) as he participated in a regular round on Codeforces. In the task he was given a set of *n* lines defined by the equations *y*<==<=*k**i*·*x*<=+<=*b**i*. It was necessary to determine whether there is at least one point of intersection of two of these lines, that lays strictly inside the strip between *x*1<=<<=*x*2. In other words, is it true that there are 1<=≤<=*i*<=<<=*j*<=≤<=*n* and *x*',<=*y*', such that:
- *y*'<==<=*k**i*<=*<=*x*'<=+<=*b**i*, that is, point (*x*',<=*y*') belongs to the line number *i*; - *y*'<==<=*k**j*<=*<=*x*'<=+<=*b**j*, that is, point (*x*',<=*y*') belongs to the line number *j*; - *x*1<=<<=*x*'<=<<=*x*2, that is, point (*x*',<=*y*') lies inside the strip bounded by *x*1<=<<=*x*2.
You can't leave Anton in trouble, can you? Write a program that solves the given task. | The first line of the input contains an integer *n* (2<=≤<=*n*<=≤<=100<=000) — the number of lines in the task given to Anton. The second line contains integers *x*1 and *x*2 (<=-<=1<=000<=000<=≤<=*x*1<=<<=*x*2<=≤<=1<=000<=000) defining the strip inside which you need to find a point of intersection of at least two lines.
The following *n* lines contain integers *k**i*, *b**i* (<=-<=1<=000<=000<=≤<=*k**i*,<=*b**i*<=≤<=1<=000<=000) — the descriptions of the lines. It is guaranteed that all lines are pairwise distinct, that is, for any two *i*<=≠<=*j* it is true that either *k**i*<=≠<=*k**j*, or *b**i*<=≠<=*b**j*. | Print "Yes" (without quotes), if there is at least one intersection of two distinct lines, located strictly inside the strip. Otherwise print "No" (without quotes). | [
"4\n1 2\n1 2\n1 0\n0 1\n0 2\n",
"2\n1 3\n1 0\n-1 3\n",
"2\n1 3\n1 0\n0 2\n",
"2\n1 3\n1 0\n0 3\n"
] | [
"NO",
"YES",
"YES",
"NO"
] | In the first sample there are intersections located on the border of the strip, but there are no intersections located strictly inside it. | 1,000 | [
{
"input": "4\n1 2\n1 2\n1 0\n0 1\n0 2",
"output": "NO"
},
{
"input": "2\n1 3\n1 0\n-1 3",
"output": "YES"
},
{
"input": "2\n1 3\n1 0\n0 2",
"output": "YES"
},
{
"input": "2\n1 3\n1 0\n0 3",
"output": "NO"
},
{
"input": "2\n0 1\n-1000000 1000000\n1000000 -1000000",
"output": "NO"
},
{
"input": "2\n-1337 1888\n-1000000 1000000\n1000000 -1000000",
"output": "YES"
},
{
"input": "2\n-1337 1888\n-1000000 1000000\n-999999 -1000000",
"output": "NO"
},
{
"input": "15\n30 32\n-45 1\n-22 -81\n4 42\n-83 -19\n97 70\n55 -91\n-45 -64\n0 64\n11 96\n-16 76\n-46 52\n0 91\n31 -90\n6 75\n65 14",
"output": "NO"
},
{
"input": "15\n-1 3\n2 -4\n0 -6\n-2 -5\n0 -1\n-1 -2\n3 6\n4 4\n0 -4\n1 5\n5 -4\n-5 -6\n3 -6\n5 -3\n-1 6\n-3 -1",
"output": "YES"
},
{
"input": "5\n-197 -126\n0 -94\n-130 -100\n-84 233\n-173 -189\n61 -200",
"output": "NO"
},
{
"input": "2\n9 10\n-7 -11\n9 2",
"output": "NO"
},
{
"input": "3\n4 11\n-2 14\n2 -15\n-8 -15",
"output": "YES"
},
{
"input": "2\n1 2\n2 -2\n0 2",
"output": "NO"
},
{
"input": "10\n1 3\n1 5\n1 2\n1 4\n1 6\n1 3\n1 7\n1 -5\n1 -1\n1 1\n1 8",
"output": "NO"
},
{
"input": "10\n22290 75956\n-66905 -22602\n-88719 12654\n-191 -81032\n0 -26057\n-39609 0\n0 51194\n2648 88230\n90584 15544\n0 23060\n-29107 26878",
"output": "NO"
},
{
"input": "2\n-1337 1888\n100000 -100000\n99999 -100000",
"output": "YES"
},
{
"input": "2\n-100000 100000\n100000 100000\n100000 99999",
"output": "NO"
},
{
"input": "2\n-100000 100000\n100000 -100000\n99999 100000",
"output": "NO"
},
{
"input": "2\n-100000 100000\n100000 100000\n100000 99876",
"output": "NO"
},
{
"input": "2\n9 10\n4 -10\n-9 4",
"output": "NO"
},
{
"input": "3\n4 7\n7 9\n0 10\n-7 2",
"output": "NO"
},
{
"input": "4\n-4 -3\n4 -3\n10 -9\n5 -2\n0 9",
"output": "NO"
},
{
"input": "5\n8 9\n0 -3\n0 -6\n-5 0\n-7 -2\n-4 9",
"output": "NO"
},
{
"input": "6\n-7 8\n6 -1\n-10 -9\n4 8\n0 -2\n-6 -1\n3 -10",
"output": "YES"
},
{
"input": "7\n5 7\n6 4\n-9 4\n-7 5\n1 -3\n5 -2\n7 -8\n6 -8",
"output": "YES"
},
{
"input": "8\n-10 -2\n5 10\n9 7\n-8 -2\n0 6\n-9 0\n-6 2\n6 -8\n-3 2",
"output": "YES"
},
{
"input": "9\n9 10\n8 -3\n9 8\n0 5\n10 1\n0 8\n5 -5\n-4 8\n0 10\n3 -10",
"output": "NO"
},
{
"input": "10\n-1 0\n-2 4\n2 4\n-3 -7\n-2 -9\n7 6\n0 2\n1 4\n0 10\n0 -8\n-5 1",
"output": "YES"
},
{
"input": "11\n3 8\n0 -9\n-8 -10\n3 4\n3 5\n2 1\n-5 4\n0 -10\n-7 6\n5 -4\n-9 -3\n5 1",
"output": "YES"
},
{
"input": "3\n0 2\n10 0\n0 0\n8 2",
"output": "YES"
},
{
"input": "2\n0 1000000\n0 0\n1000000 1000000",
"output": "NO"
},
{
"input": "2\n515806 517307\n530512 500306\n520201 504696",
"output": "NO"
},
{
"input": "2\n0 65536\n65536 0\n0 1",
"output": "YES"
},
{
"input": "3\n1 3\n-1 5\n1 1\n0 4",
"output": "YES"
},
{
"input": "2\n0 1000000\n1000000 1\n1 2",
"output": "YES"
},
{
"input": "2\n0 3\n1 1\n2 1",
"output": "NO"
},
{
"input": "2\n0 1\n1 0\n2 0",
"output": "NO"
},
{
"input": "3\n1 3\n1 0\n-1 3\n0 10",
"output": "YES"
},
{
"input": "2\n0 1000000\n1000000 1000000\n0 3",
"output": "NO"
},
{
"input": "2\n0 1\n1 0\n-2 2",
"output": "YES"
},
{
"input": "2\n5 1000000\n1000000 5\n5 5",
"output": "NO"
},
{
"input": "4\n0 1\n0 0\n0 1\n1 0\n-1 1",
"output": "YES"
},
{
"input": "2\n0 1000000\n1000000 1000000\n1 1",
"output": "NO"
},
{
"input": "3\n0 1000000\n1000000 999999\n-1000000 1000000\n1000000 1000000",
"output": "YES"
},
{
"input": "2\n-1000000 1000000\n2 3\n1 3",
"output": "YES"
},
{
"input": "2\n0 1000000\n1000000 1\n2 2",
"output": "YES"
},
{
"input": "2\n-1 1\n1 0\n-1 0",
"output": "YES"
},
{
"input": "2\n0 1000000\n2200 1\n0 0",
"output": "NO"
},
{
"input": "2\n1 999999\n999999 0\n1 0",
"output": "NO"
},
{
"input": "2\n0 1\n1 0\n-1 1",
"output": "YES"
},
{
"input": "2\n0 1000000\n999999 999999\n0 0",
"output": "NO"
},
{
"input": "7\n0 1\n0 -1\n3 0\n5 0\n2 0\n4 0\n1 0\n0 100",
"output": "NO"
},
{
"input": "2\n0 1000000\n1000000 0\n0 100",
"output": "YES"
},
{
"input": "4\n0 1\n-1 2\n0 1\n1 0\n-1 0",
"output": "NO"
},
{
"input": "3\n0 1\n0 1\n0 10\n2 0",
"output": "YES"
},
{
"input": "4\n0 1\n3 0\n2 0\n1 0\n-1 3",
"output": "YES"
},
{
"input": "2\n0 1000000\n10000 0\n100000 1",
"output": "NO"
},
{
"input": "5\n-2 2\n2 0\n0 100000\n0 10000\n0 1000\n0 0",
"output": "YES"
},
{
"input": "2\n0 1000000\n0 0\n2200 1",
"output": "NO"
},
{
"input": "2\n0 1000000\n1 0\n1000000 1",
"output": "NO"
},
{
"input": "2\n2 5\n2 -4\n3 -6",
"output": "NO"
},
{
"input": "2\n-1 1\n0 0\n0 1",
"output": "NO"
},
{
"input": "2\n900000 1000000\n900000 1000000\n1000000 900000",
"output": "NO"
}
] | 1,446,661,522 | 6,022 | Python 3 | OK | TESTS | 93 | 561 | 9,932,800 | n = int(input())
a = list()
x1, x2 = map(int, input().split())
for i in range(n):
k, b = map(int, input().split())
y1 = k * x1 + b
y2 = k * x2 + b
a.append((y1, y2))
a.sort()
fl = 'NO'
y1m = a[0][0]
y2m = a[0][1]
for y1, y2 in a:
if y2 < y2m:
fl = 'YES'
else:
y2m = max(y2m, y2)
print(fl)
| Title: Anton and Lines
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The teacher gave Anton a large geometry homework, but he didn't do it (as usual) as he participated in a regular round on Codeforces. In the task he was given a set of *n* lines defined by the equations *y*<==<=*k**i*·*x*<=+<=*b**i*. It was necessary to determine whether there is at least one point of intersection of two of these lines, that lays strictly inside the strip between *x*1<=<<=*x*2. In other words, is it true that there are 1<=≤<=*i*<=<<=*j*<=≤<=*n* and *x*',<=*y*', such that:
- *y*'<==<=*k**i*<=*<=*x*'<=+<=*b**i*, that is, point (*x*',<=*y*') belongs to the line number *i*; - *y*'<==<=*k**j*<=*<=*x*'<=+<=*b**j*, that is, point (*x*',<=*y*') belongs to the line number *j*; - *x*1<=<<=*x*'<=<<=*x*2, that is, point (*x*',<=*y*') lies inside the strip bounded by *x*1<=<<=*x*2.
You can't leave Anton in trouble, can you? Write a program that solves the given task.
Input Specification:
The first line of the input contains an integer *n* (2<=≤<=*n*<=≤<=100<=000) — the number of lines in the task given to Anton. The second line contains integers *x*1 and *x*2 (<=-<=1<=000<=000<=≤<=*x*1<=<<=*x*2<=≤<=1<=000<=000) defining the strip inside which you need to find a point of intersection of at least two lines.
The following *n* lines contain integers *k**i*, *b**i* (<=-<=1<=000<=000<=≤<=*k**i*,<=*b**i*<=≤<=1<=000<=000) — the descriptions of the lines. It is guaranteed that all lines are pairwise distinct, that is, for any two *i*<=≠<=*j* it is true that either *k**i*<=≠<=*k**j*, or *b**i*<=≠<=*b**j*.
Output Specification:
Print "Yes" (without quotes), if there is at least one intersection of two distinct lines, located strictly inside the strip. Otherwise print "No" (without quotes).
Demo Input:
['4\n1 2\n1 2\n1 0\n0 1\n0 2\n', '2\n1 3\n1 0\n-1 3\n', '2\n1 3\n1 0\n0 2\n', '2\n1 3\n1 0\n0 3\n']
Demo Output:
['NO', 'YES', 'YES', 'NO']
Note:
In the first sample there are intersections located on the border of the strip, but there are no intersections located strictly inside it. | ```python
n = int(input())
a = list()
x1, x2 = map(int, input().split())
for i in range(n):
k, b = map(int, input().split())
y1 = k * x1 + b
y2 = k * x2 + b
a.append((y1, y2))
a.sort()
fl = 'NO'
y1m = a[0][0]
y2m = a[0][1]
for y1, y2 in a:
if y2 < y2m:
fl = 'YES'
else:
y2m = max(y2m, y2)
print(fl)
``` | 3 |
|
131 | A | cAPS lOCK | PROGRAMMING | 1,000 | [
"implementation",
"strings"
] | null | null | wHAT DO WE NEED cAPS LOCK FOR?
Caps lock is a computer keyboard key. Pressing it sets an input mode in which typed letters are capital by default. If it is pressed by accident, it leads to accidents like the one we had in the first passage.
Let's consider that a word has been typed with the Caps lock key accidentally switched on, if:
- either it only contains uppercase letters; - or all letters except for the first one are uppercase.
In this case we should automatically change the case of all letters. For example, the case of the letters that form words "hELLO", "HTTP", "z" should be changed.
Write a program that applies the rule mentioned above. If the rule cannot be applied, the program should leave the word unchanged. | The first line of the input data contains a word consisting of uppercase and lowercase Latin letters. The word's length is from 1 to 100 characters, inclusive. | Print the result of the given word's processing. | [
"cAPS\n",
"Lock\n"
] | [
"Caps",
"Lock\n"
] | none | 500 | [
{
"input": "cAPS",
"output": "Caps"
},
{
"input": "Lock",
"output": "Lock"
},
{
"input": "cAPSlOCK",
"output": "cAPSlOCK"
},
{
"input": "CAPs",
"output": "CAPs"
},
{
"input": "LoCK",
"output": "LoCK"
},
{
"input": "OOPS",
"output": "oops"
},
{
"input": "oops",
"output": "oops"
},
{
"input": "a",
"output": "A"
},
{
"input": "A",
"output": "a"
},
{
"input": "aA",
"output": "Aa"
},
{
"input": "Zz",
"output": "Zz"
},
{
"input": "Az",
"output": "Az"
},
{
"input": "zA",
"output": "Za"
},
{
"input": "AAA",
"output": "aaa"
},
{
"input": "AAa",
"output": "AAa"
},
{
"input": "AaR",
"output": "AaR"
},
{
"input": "Tdr",
"output": "Tdr"
},
{
"input": "aTF",
"output": "Atf"
},
{
"input": "fYd",
"output": "fYd"
},
{
"input": "dsA",
"output": "dsA"
},
{
"input": "fru",
"output": "fru"
},
{
"input": "hYBKF",
"output": "Hybkf"
},
{
"input": "XweAR",
"output": "XweAR"
},
{
"input": "mogqx",
"output": "mogqx"
},
{
"input": "eOhEi",
"output": "eOhEi"
},
{
"input": "nkdku",
"output": "nkdku"
},
{
"input": "zcnko",
"output": "zcnko"
},
{
"input": "lcccd",
"output": "lcccd"
},
{
"input": "vwmvg",
"output": "vwmvg"
},
{
"input": "lvchf",
"output": "lvchf"
},
{
"input": "IUNVZCCHEWENCHQQXQYPUJCRDZLUXCLJHXPHBXEUUGNXOOOPBMOBRIBHHMIRILYJGYYGFMTMFSVURGYHUWDRLQVIBRLPEVAMJQYO",
"output": "iunvzcchewenchqqxqypujcrdzluxcljhxphbxeuugnxooopbmobribhhmirilyjgyygfmtmfsvurgyhuwdrlqvibrlpevamjqyo"
},
{
"input": "OBHSZCAMDXEJWOZLKXQKIVXUUQJKJLMMFNBPXAEFXGVNSKQLJGXHUXHGCOTESIVKSFMVVXFVMTEKACRIWALAGGMCGFEXQKNYMRTG",
"output": "obhszcamdxejwozlkxqkivxuuqjkjlmmfnbpxaefxgvnskqljgxhuxhgcotesivksfmvvxfvmtekacriwalaggmcgfexqknymrtg"
},
{
"input": "IKJYZIKROIYUUCTHSVSKZTETNNOCMAUBLFJCEVANCADASMZRCNLBZPQRXESHEEMOMEPCHROSRTNBIDXYMEPJSIXSZQEBTEKKUHFS",
"output": "ikjyzikroiyuucthsvskztetnnocmaublfjcevancadasmzrcnlbzpqrxesheemomepchrosrtnbidxymepjsixszqebtekkuhfs"
},
{
"input": "cTKDZNWVYRTFPQLDAUUNSPKTDJTUPPFPRXRSINTVFVNNQNKXWUZUDHZBUSOKTABUEDQKUIVRTTVUREEOBJTSDKJKVEGFXVHXEYPE",
"output": "Ctkdznwvyrtfpqldauunspktdjtuppfprxrsintvfvnnqnkxwuzudhzbusoktabuedqkuivrttvureeobjtsdkjkvegfxvhxeype"
},
{
"input": "uCKJZRGZJCPPLEEYJTUNKOQSWGBMTBQEVPYFPIPEKRVYQNTDPANOIXKMPINNFUSZWCURGBDPYTEKBEKCPMVZPMWAOSHJYMGKOMBQ",
"output": "Uckjzrgzjcppleeyjtunkoqswgbmtbqevpyfpipekrvyqntdpanoixkmpinnfuszwcurgbdpytekbekcpmvzpmwaoshjymgkombq"
},
{
"input": "KETAXTSWAAOBKUOKUQREHIOMVMMRSAEWKGXZKRASwTVNSSFSNIWYNPSTMRADOADEEBURRHPOOBIEUIBGYDJCEKPNLEUCANZYJKMR",
"output": "KETAXTSWAAOBKUOKUQREHIOMVMMRSAEWKGXZKRASwTVNSSFSNIWYNPSTMRADOADEEBURRHPOOBIEUIBGYDJCEKPNLEUCANZYJKMR"
},
{
"input": "ZEKGDMWJPVUWFlNXRLUmWKLMMYSLRQQIBRWDPKWITUIMZYYKOEYGREKHHZRZZUFPVTNIHKGTCCTLOKSZITXXZDMPITHNZUIGDZLE",
"output": "ZEKGDMWJPVUWFlNXRLUmWKLMMYSLRQQIBRWDPKWITUIMZYYKOEYGREKHHZRZZUFPVTNIHKGTCCTLOKSZITXXZDMPITHNZUIGDZLE"
},
{
"input": "TcMbVPCFvnNkCEUUCIFLgBJeCOKuJhIGwXFrhAZjuAhBraMSchBfWwIuHAEbgJOFzGtxDLDXzDSaPCFujGGxgxdlHUIQYRrMFCgJ",
"output": "TcMbVPCFvnNkCEUUCIFLgBJeCOKuJhIGwXFrhAZjuAhBraMSchBfWwIuHAEbgJOFzGtxDLDXzDSaPCFujGGxgxdlHUIQYRrMFCgJ"
},
{
"input": "xFGqoLILNvxARKuIntPfeukFtMbvzDezKpPRAKkIoIvwqNXnehRVwkkXYvuRCeoieBaBfTjwsYhDeCLvBwktntyluoxCYVioXGdm",
"output": "xFGqoLILNvxARKuIntPfeukFtMbvzDezKpPRAKkIoIvwqNXnehRVwkkXYvuRCeoieBaBfTjwsYhDeCLvBwktntyluoxCYVioXGdm"
},
{
"input": "udvqolbxdwbkijwvhlyaelhynmnfgszbhgshlcwdkaibceqomzujndixuzivlsjyjqxzxodzbukxxhwwultvekdfntwpzlhhrIjm",
"output": "udvqolbxdwbkijwvhlyaelhynmnfgszbhgshlcwdkaibceqomzujndixuzivlsjyjqxzxodzbukxxhwwultvekdfntwpzlhhrIjm"
},
{
"input": "jgpwhetqqoncighgzbbaLwwwxkxivuwtokehrgprfgewzcwxkavwoflcgsgbhoeamzbefzoonwsyzisetoydrpufktzgbaycgaeg",
"output": "jgpwhetqqoncighgzbbaLwwwxkxivuwtokehrgprfgewzcwxkavwoflcgsgbhoeamzbefzoonwsyzisetoydrpufktzgbaycgaeg"
},
{
"input": "vyujsazdstbnkxeunedfbolicojzjpufgfemhtmdrswvmuhoivjvonacefqenbqudelmdegxqtbwezsbydmanzutvdgkgrjxzlnc",
"output": "vyujsazdstbnkxeunedfbolicojzjpufgfemhtmdrswvmuhoivjvonacefqenbqudelmdegxqtbwezsbydmanzutvdgkgrjxzlnc"
},
{
"input": "pivqnuqkaofcduvbttztjbuavrqwiqrwkfncmvatoxruelyoecnkpqraiahumiaiqeyjapbqyrsxcdgjbihivtqezvasfmzntdfv",
"output": "pivqnuqkaofcduvbttztjbuavrqwiqrwkfncmvatoxruelyoecnkpqraiahumiaiqeyjapbqyrsxcdgjbihivtqezvasfmzntdfv"
},
{
"input": "upvtbsxswbohxshdrbjxcungzquhuomgxwlryvshshsfvqbrxvcikbglietlpqkiwbhiqpmdwuqosbtdvyxekkaqiwrbsibpoect",
"output": "upvtbsxswbohxshdrbjxcungzquhuomgxwlryvshshsfvqbrxvcikbglietlpqkiwbhiqpmdwuqosbtdvyxekkaqiwrbsibpoect"
},
{
"input": "cTKDZNWVYRTFPQLDAUUNSPKTDJTUPPFPRXRSINTVFVNNQNKXWUZUDHZBUSOKTABUEDQKUIVRTTVUREEOBJTSDKJKVEGFXVHXEYPE",
"output": "Ctkdznwvyrtfpqldauunspktdjtuppfprxrsintvfvnnqnkxwuzudhzbusoktabuedqkuivrttvureeobjtsdkjkvegfxvhxeype"
},
{
"input": "JEGDOFJOFGJHFROGHOFGMHOFGHORGFHMOu",
"output": "JEGDOFJOFGJHFROGHOFGMHOFGHORGFHMOu"
},
{
"input": "aBACABa",
"output": "aBACABa"
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAaa",
"output": "AAAAAAAAAAAAAAAAAAAAAAAAaa"
},
{
"input": "aaAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "aaAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA"
},
{
"input": "dDDDDDDDDDDDDD",
"output": "Dddddddddddddd"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa"
},
{
"input": "z",
"output": "Z"
},
{
"input": "AZ",
"output": "az"
},
{
"input": "Z",
"output": "z"
},
{
"input": "aAAAA",
"output": "Aaaaa"
},
{
"input": "F",
"output": "f"
}
] | 1,693,370,777 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 31 | 0 | s = input()
if s[0] >= 'a' and s[1] < 'a':
print(s[0].upper(), end='')
for i in range(1, len(s)):
print(s[i].lower(), end='')
elif s[0] < 'a' and s[1] < 'a':
print(s.lower())
else:
print(s)
| Title: cAPS lOCK
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
wHAT DO WE NEED cAPS LOCK FOR?
Caps lock is a computer keyboard key. Pressing it sets an input mode in which typed letters are capital by default. If it is pressed by accident, it leads to accidents like the one we had in the first passage.
Let's consider that a word has been typed with the Caps lock key accidentally switched on, if:
- either it only contains uppercase letters; - or all letters except for the first one are uppercase.
In this case we should automatically change the case of all letters. For example, the case of the letters that form words "hELLO", "HTTP", "z" should be changed.
Write a program that applies the rule mentioned above. If the rule cannot be applied, the program should leave the word unchanged.
Input Specification:
The first line of the input data contains a word consisting of uppercase and lowercase Latin letters. The word's length is from 1 to 100 characters, inclusive.
Output Specification:
Print the result of the given word's processing.
Demo Input:
['cAPS\n', 'Lock\n']
Demo Output:
['Caps', 'Lock\n']
Note:
none | ```python
s = input()
if s[0] >= 'a' and s[1] < 'a':
print(s[0].upper(), end='')
for i in range(1, len(s)):
print(s[i].lower(), end='')
elif s[0] < 'a' and s[1] < 'a':
print(s.lower())
else:
print(s)
``` | 0 |
|
628 | B | New Skateboard | PROGRAMMING | 1,300 | [
"dp"
] | null | null | Max wants to buy a new skateboard. He has calculated the amount of money that is needed to buy a new skateboard. He left a calculator on the floor and went to ask some money from his parents. Meanwhile his little brother Yusuf came and started to press the keys randomly. Unfortunately Max has forgotten the number which he had calculated. The only thing he knows is that the number is divisible by 4.
You are given a string *s* consisting of digits (the number on the display of the calculator after Yusuf randomly pressed the keys). Your task is to find the number of substrings which are divisible by 4. A substring can start with a zero.
A substring of a string is a nonempty sequence of consecutive characters.
For example if string *s* is 124 then we have four substrings that are divisible by 4: 12, 4, 24 and 124. For the string 04 the answer is three: 0, 4, 04.
As input/output can reach huge size it is recommended to use fast input/output methods: for example, prefer to use gets/scanf/printf instead of getline/cin/cout in C++, prefer to use BufferedReader/PrintWriter instead of Scanner/System.out in Java. | The only line contains string *s* (1<=≤<=|*s*|<=≤<=3·105). The string *s* contains only digits from 0 to 9. | Print integer *a* — the number of substrings of the string *s* that are divisible by 4.
Note that the answer can be huge, so you should use 64-bit integer type to store it. In C++ you can use the long long integer type and in Java you can use long integer type. | [
"124\n",
"04\n",
"5810438174\n"
] | [
"4\n",
"3\n",
"9\n"
] | none | 0 | [
{
"input": "124",
"output": "4"
},
{
"input": "04",
"output": "3"
},
{
"input": "5810438174",
"output": "9"
},
{
"input": "1",
"output": "0"
},
{
"input": "039",
"output": "1"
},
{
"input": "97247",
"output": "6"
},
{
"input": "5810438174",
"output": "9"
},
{
"input": "12883340691714056185860211260984431382156326935244",
"output": "424"
},
{
"input": "2144315253572020279108092911160072328496568665545836825277616363478721946398140227406814602154768031",
"output": "1528"
},
{
"input": "80124649014054971081213608137817466046254652492627741860478258558206397113198232823859870363821007188476405951611069347299689170240023979048198711745011542774268179055311013054073075176122755643483380248999657649211459997766221072399103579977409770898200358240970169892326442892826731631357561876251276209119521202062222947560634301788787748428236988789594458520867663257476744168528121470923031438015546006185059454402637036376247785881323277542968298682307854655591317046086531554595892680980142608",
"output": "30826"
},
{
"input": "123456",
"output": "7"
},
{
"input": "4",
"output": "1"
},
{
"input": "123",
"output": "1"
}
] | 1,590,996,538 | 2,147,483,647 | Python 3 | OK | TESTS | 22 | 280 | 1,024,000 | s = input()
res = 0
for i in range(1, len(s)) :
if int(s[i-1 : i+1]) % 4 == 0 :
res += i
res += s.count('0') + s.count('4') + s.count('8')
print(res) | Title: New Skateboard
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Max wants to buy a new skateboard. He has calculated the amount of money that is needed to buy a new skateboard. He left a calculator on the floor and went to ask some money from his parents. Meanwhile his little brother Yusuf came and started to press the keys randomly. Unfortunately Max has forgotten the number which he had calculated. The only thing he knows is that the number is divisible by 4.
You are given a string *s* consisting of digits (the number on the display of the calculator after Yusuf randomly pressed the keys). Your task is to find the number of substrings which are divisible by 4. A substring can start with a zero.
A substring of a string is a nonempty sequence of consecutive characters.
For example if string *s* is 124 then we have four substrings that are divisible by 4: 12, 4, 24 and 124. For the string 04 the answer is three: 0, 4, 04.
As input/output can reach huge size it is recommended to use fast input/output methods: for example, prefer to use gets/scanf/printf instead of getline/cin/cout in C++, prefer to use BufferedReader/PrintWriter instead of Scanner/System.out in Java.
Input Specification:
The only line contains string *s* (1<=≤<=|*s*|<=≤<=3·105). The string *s* contains only digits from 0 to 9.
Output Specification:
Print integer *a* — the number of substrings of the string *s* that are divisible by 4.
Note that the answer can be huge, so you should use 64-bit integer type to store it. In C++ you can use the long long integer type and in Java you can use long integer type.
Demo Input:
['124\n', '04\n', '5810438174\n']
Demo Output:
['4\n', '3\n', '9\n']
Note:
none | ```python
s = input()
res = 0
for i in range(1, len(s)) :
if int(s[i-1 : i+1]) % 4 == 0 :
res += i
res += s.count('0') + s.count('4') + s.count('8')
print(res)
``` | 3 |
|
59 | A | Word | PROGRAMMING | 800 | [
"implementation",
"strings"
] | A. Word | 2 | 256 | Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. | The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. | Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. | [
"HoUse\n",
"ViP\n",
"maTRIx\n"
] | [
"house\n",
"VIP\n",
"matrix\n"
] | none | 500 | [
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,687,675,062 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 30 | 124 | 0 | k=input()
count=0
for i in k:
if(i.isupper()):
count+=1
if(count>(len(k)//2)):
print(k.upper())
else:
print(k.lower())
| Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none | ```python
k=input()
count=0
for i in k:
if(i.isupper()):
count+=1
if(count>(len(k)//2)):
print(k.upper())
else:
print(k.lower())
``` | 3.969 |
702 | A | Maximum Increase | PROGRAMMING | 800 | [
"dp",
"greedy",
"implementation"
] | null | null | You are given array consisting of *n* integers. Your task is to find the maximum length of an increasing subarray of the given array.
A subarray is the sequence of consecutive elements of the array. Subarray is called increasing if each element of this subarray strictly greater than previous. | The first line contains single positive integer *n* (1<=≤<=*n*<=≤<=105) — the number of integers.
The second line contains *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109). | Print the maximum length of an increasing subarray of the given array. | [
"5\n1 7 2 11 15\n",
"6\n100 100 100 100 100 100\n",
"3\n1 2 3\n"
] | [
"3\n",
"1\n",
"3\n"
] | none | 0 | [
{
"input": "5\n1 7 2 11 15",
"output": "3"
},
{
"input": "6\n100 100 100 100 100 100",
"output": "1"
},
{
"input": "3\n1 2 3",
"output": "3"
},
{
"input": "1\n1000000000",
"output": "1"
},
{
"input": "10\n802030518 598196518 640274071 983359971 71550121 96204862 799843967 446173607 796619138 402690754",
"output": "3"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "5\n1 2 3 3 4",
"output": "3"
},
{
"input": "4\n1 2 2 3",
"output": "2"
},
{
"input": "3\n2 1 1",
"output": "1"
},
{
"input": "3\n1 2 1",
"output": "2"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "2\n1 2",
"output": "2"
},
{
"input": "3\n1 1 2",
"output": "2"
},
{
"input": "11\n1 2 3 1 2 3 2 1 2 3 4",
"output": "4"
},
{
"input": "9\n1 2 3 4 5 6 7 8 9",
"output": "9"
},
{
"input": "9\n1 1 1 1 1 1 1 1 1",
"output": "1"
},
{
"input": "3\n3 2 1",
"output": "1"
},
{
"input": "7\n1 2 3 4 5 6 7",
"output": "7"
},
{
"input": "1\n1234394",
"output": "1"
}
] | 1,679,084,381 | 2,147,483,647 | Python 3 | OK | TESTS | 32 | 93 | 7,884,800 | n = int (input())
current = 1
max = 1
x = list(map(int,input().split()))
for i in range(n-1): # 0 1 2 3 4
if x[i+1] > x[i]: # 1 7 2 11 15
current = current +1
else:
current=1
if max<current:max=current
print (max) | Title: Maximum Increase
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given array consisting of *n* integers. Your task is to find the maximum length of an increasing subarray of the given array.
A subarray is the sequence of consecutive elements of the array. Subarray is called increasing if each element of this subarray strictly greater than previous.
Input Specification:
The first line contains single positive integer *n* (1<=≤<=*n*<=≤<=105) — the number of integers.
The second line contains *n* positive integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=109).
Output Specification:
Print the maximum length of an increasing subarray of the given array.
Demo Input:
['5\n1 7 2 11 15\n', '6\n100 100 100 100 100 100\n', '3\n1 2 3\n']
Demo Output:
['3\n', '1\n', '3\n']
Note:
none | ```python
n = int (input())
current = 1
max = 1
x = list(map(int,input().split()))
for i in range(n-1): # 0 1 2 3 4
if x[i+1] > x[i]: # 1 7 2 11 15
current = current +1
else:
current=1
if max<current:max=current
print (max)
``` | 3 |
|
892 | B | Wrath | PROGRAMMING | 1,200 | [
"greedy",
"implementation",
"two pointers"
] | null | null | Hands that shed innocent blood!
There are *n* guilty people in a line, the *i*-th of them holds a claw with length *L**i*. The bell rings and every person kills some of people in front of him. All people kill others at the same time. Namely, the *i*-th person kills the *j*-th person if and only if *j*<=<<=*i* and *j*<=≥<=*i*<=-<=*L**i*.
You are given lengths of the claws. You need to find the total number of alive people after the bell rings. | The first line contains one integer *n* (1<=≤<=*n*<=≤<=106) — the number of guilty people.
Second line contains *n* space-separated integers *L*1,<=*L*2,<=...,<=*L**n* (0<=≤<=*L**i*<=≤<=109), where *L**i* is the length of the *i*-th person's claw. | Print one integer — the total number of alive people after the bell rings. | [
"4\n0 1 0 10\n",
"2\n0 0\n",
"10\n1 1 3 0 0 0 2 1 0 3\n"
] | [
"1\n",
"2\n",
"3\n"
] | In first sample the last person kills everyone in front of him. | 1,000 | [
{
"input": "4\n0 1 0 10",
"output": "1"
},
{
"input": "2\n0 0",
"output": "2"
},
{
"input": "10\n1 1 3 0 0 0 2 1 0 3",
"output": "3"
},
{
"input": "10\n0 0 2 0 0 3 3 2 2 0",
"output": "2"
},
{
"input": "1\n0",
"output": "1"
},
{
"input": "5\n0 0 0 1 0",
"output": "4"
},
{
"input": "6\n3 1 1 0 3 3",
"output": "1"
},
{
"input": "8\n0 0 0 1 0 0 1 2",
"output": "5"
},
{
"input": "1\n1000000000",
"output": "1"
},
{
"input": "2\n1 3",
"output": "1"
},
{
"input": "2\n1000000000 1000000000",
"output": "1"
},
{
"input": "11\n1 0 0 1 1 3 2 0 0 2 3",
"output": "4"
},
{
"input": "1\n1",
"output": "1"
}
] | 1,553,753,362 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 1 | 93 | 0 | n = int(input())
s = list(map(int,input().split()))
died = []
live = n
if sum(s) == n * s[0]:
print(1)
else:
for i in range(n - 1, 0, -1):
for j in range(i):
if i > j and i - s[i] <= j and j not in died:
died.append(j)
print(n - len(died))
| Title: Wrath
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Hands that shed innocent blood!
There are *n* guilty people in a line, the *i*-th of them holds a claw with length *L**i*. The bell rings and every person kills some of people in front of him. All people kill others at the same time. Namely, the *i*-th person kills the *j*-th person if and only if *j*<=<<=*i* and *j*<=≥<=*i*<=-<=*L**i*.
You are given lengths of the claws. You need to find the total number of alive people after the bell rings.
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=106) — the number of guilty people.
Second line contains *n* space-separated integers *L*1,<=*L*2,<=...,<=*L**n* (0<=≤<=*L**i*<=≤<=109), where *L**i* is the length of the *i*-th person's claw.
Output Specification:
Print one integer — the total number of alive people after the bell rings.
Demo Input:
['4\n0 1 0 10\n', '2\n0 0\n', '10\n1 1 3 0 0 0 2 1 0 3\n']
Demo Output:
['1\n', '2\n', '3\n']
Note:
In first sample the last person kills everyone in front of him. | ```python
n = int(input())
s = list(map(int,input().split()))
died = []
live = n
if sum(s) == n * s[0]:
print(1)
else:
for i in range(n - 1, 0, -1):
for j in range(i):
if i > j and i - s[i] <= j and j not in died:
died.append(j)
print(n - len(died))
``` | 0 |
|
152 | C | Pocket Book | PROGRAMMING | 1,400 | [
"combinatorics"
] | null | null | One day little Vasya found mom's pocket book. The book had *n* names of her friends and unusually enough, each name was exactly *m* letters long. Let's number the names from 1 to *n* in the order in which they are written.
As mom wasn't home, Vasya decided to play with names: he chose three integers *i*, *j*, *k* (1<=≤<=*i*<=<<=*j*<=≤<=*n*, 1<=≤<=*k*<=≤<=*m*), then he took names number *i* and *j* and swapped their prefixes of length *k*. For example, if we take names "CBDAD" and "AABRD" and swap their prefixes with the length of 3, the result will be names "AABAD" and "CBDRD".
You wonder how many different names Vasya can write instead of name number 1, if Vasya is allowed to perform any number of the described actions. As Vasya performs each action, he chooses numbers *i*, *j*, *k* independently from the previous moves and his choice is based entirely on his will. The sought number can be very large, so you should only find it modulo 1000000007 (109<=+<=7). | The first input line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of names and the length of each name, correspondingly. Then *n* lines contain names, each name consists of exactly *m* uppercase Latin letters. | Print the single number — the number of different names that could end up in position number 1 in the pocket book after the applying the procedures described above. Print the number modulo 1000000007 (109<=+<=7). | [
"2 3\nAAB\nBAA\n",
"4 5\nABABA\nBCGDG\nAAAAA\nYABSA\n"
] | [
"4\n",
"216\n"
] | In the first sample Vasya can get the following names in the position number 1: "AAB", "AAA", "BAA" and "BAB". | 1,500 | [
{
"input": "2 3\nAAB\nBAA",
"output": "4"
},
{
"input": "4 5\nABABA\nBCGDG\nAAAAA\nYABSA",
"output": "216"
},
{
"input": "1 1\nE",
"output": "1"
},
{
"input": "2 2\nNS\nPD",
"output": "4"
},
{
"input": "3 4\nPJKD\nNFJX\nFGFK",
"output": "81"
},
{
"input": "4 5\nSXFMY\nATHLM\nKDDQW\nZWGDS",
"output": "1024"
},
{
"input": "20 14\nJNFKBBBJYZHWQE\nLBOKZCPFNKDBJY\nXKNWGHQHIOXUPF\nDDNRUKVUGHWMXW\nMTIZFNAAFEAPHX\nIXBQOOHEULZYHU\nMRCSREUEOOMUUN\nHJTSQWKUFYZDQU\nGMCMUZCOPRVEIQ\nXBKKGGJECOBLTH\nXXHTLXCNJZJUAF\nVLJRKXXXWMTPKZ\nPTYMNPTBBCWKAD\nQYJGOBUBHMEDYE\nGTKUUVVNKAHTUI\nZNKXYZPCYLBZFP\nQCBLJTRMBDWNNE\nTDOKJOBKEOVNLZ\nFKZUITYAFJOQIM\nUWQNSGLXEEIRWF",
"output": "515139391"
},
{
"input": "5 14\nAQRXUQQNSKZPGC\nDTTKSPFGGVCLPT\nVLZQWWESCHDTAZ\nCOKOWDWDRUOMHP\nXDTRBIZTTCIDGS",
"output": "124999979"
},
{
"input": "9 23\nOILBYKHRGMPENVFNHLSIUOW\nLPJFHTUQUINAALRDGLSQUXR\nLYYJJEBNZATAFQWTDZSPUNZ\nHSJPIQKKWWERJZIEMLCZUKI\nOJYIEYDGPFWRHCMISJCCUEM\nLMGKZVFYIVDRTIHBWPCNUTG\nUBGGNCITVHAIPKXCLTSAULQ\nOWSAWUOXQDBSXXBHTLSXUVD\nUGQTIZQPBGMASRQPVPSFUWK",
"output": "454717784"
},
{
"input": "25 4\nLVKG\nMICU\nZHKW\nLFGG\nOWQO\nLCQG\nLVXU\nOUKB\nLNQX\nZJTO\nOOQX\nLVQP\nMFQB\nMRQV\nOIQH\nOPXX\nXFKU\nFCQB\nZPKH\nLVCH\nNFCU\nOVQW\nOZKU\nLFHX\nLPXO",
"output": "5733"
},
{
"input": "30 10\nUTNTGOKZYJ\nQHOUHNYZVW\nLTVGHJRZVW\nMZHYHOLZYJ\nERYEUEPZYE\nUZDBFTURYJ\nRVSMQTIZGW\nWDJQHMIRYY\nKCORHQPZYE\nRRPLFOZZVY\nJTXMFNNNYJ\nMVTGGOZZVV\nEHAFFNUZVF\nLBRNWJZNYE\nJVMOHTPZYJ\nWTARFJLZVV\nLVJCWOURVW\nLCLQFJYRVV\nQVBVGNJRYF\nNTZGHOLRYE\nMGQKHOUPYJ\nRRSSBXPZYJ\nRYCRGTLZYJ\nJRDEGNKRVW\nRZKFGHYRVG\nMDJBFNIZYG\nMPLWHXIZYE\nSRZMHMURVE\nMTEBBMRZYJ\nJPJIFOLZYM",
"output": "919913906"
},
{
"input": "40 7\nPNTVVER\nPAHTQDR\nRXMJVAS\nVIQNLYC\nILPUSVX\nYJOXQDJ\nSEFODTO\nOTJMREL\nLIQRZGD\nLBJJPOR\nRUTYHQO\nRIWEPBD\nKQUMFIB\nISTRRYH\nXBTOTGK\nRFQODEY\nHDSTZTP\nYCXFAGL\nAREGRFU\nLELZUYU\nGVABDKH\nFJAMMME\nACVULXE\nJHVPJAS\nAAQNMBX\nJJGUCXG\nOQATILQ\nNEOSHJM\nHFLWOFM\nICYEQHY\nFACGLYP\nPLLXJEQ\nDCHXYPB\nAGDDZJJ\nLSQRXTN\nHDQZXIY\nNAHDDWW\nQCMXRQN\nFDUDSZO\nHKBEVTW",
"output": "206575993"
},
{
"input": "2 2\nAA\nBB",
"output": "4"
},
{
"input": "1 10\nAAAAAAAAAA",
"output": "1"
},
{
"input": "2 8\nAAAAAAAA\nBBBBBBBB",
"output": "256"
},
{
"input": "10 10\nAAAAAAAAAA\nBBBBBBBBBB\nCCCCCCCCCC\nDDDDDDDDDD\nAAAAAAAAAA\nBBBBBBBBBB\nCCCCCCCCCC\nDDDDDDDDDD\nAAAAAAAAAA\nBBBBBBBBBB",
"output": "1048576"
},
{
"input": "1 20\nAAAAAAAAAAAAAAAAAAAA",
"output": "1"
},
{
"input": "20 1\nA\nB\nC\nD\nE\nF\nG\nA\nB\nC\nD\nE\nF\nG\nA\nB\nC\nD\nE\nF",
"output": "7"
},
{
"input": "5 60\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB\nCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC\nDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD\nEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE",
"output": "449874206"
},
{
"input": "50 4\nAAAA\nBBBB\nCCCC\nDDDD\nEEEE\nFFFF\nGGGG\nHHHH\nIIII\nJJJJ\nAAAA\nBBBB\nCCCC\nDDDD\nEEEE\nFFFF\nGGGG\nHHHH\nIIII\nJJJJ\nAAAA\nBBBB\nCCCC\nDDDD\nEEEE\nFFFF\nGGGG\nHHHH\nIIII\nJJJJ\nAAAA\nBBBB\nCCCC\nDDDD\nEEEE\nFFFF\nGGGG\nHHHH\nIIII\nJJJJ\nAAAA\nBBBB\nCCCC\nDDDD\nEEEE\nFFFF\nGGGG\nHHHH\nIIII\nJJJJ",
"output": "10000"
},
{
"input": "1 100\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "1"
},
{
"input": "100 1\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA",
"output": "1"
},
{
"input": "100 1\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB",
"output": "2"
},
{
"input": "100 1\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB",
"output": "14"
},
{
"input": "100 1\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nO\nP\nQ\nR\nS\nT\nU\nV\nW\nX\nY\nZ\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nO\nP\nQ\nR\nS\nT\nU\nV\nW\nX\nY\nZ\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nO\nP\nQ\nR\nS\nT\nU\nV\nW\nX\nY\nZ\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nO\nP\nQ\nR\nS\nT\nU\nV",
"output": "26"
}
] | 1,663,609,937 | 2,147,483,647 | Python 3 | OK | TESTS | 60 | 92 | 0 | if __name__ == "__main__":
modulo=10**9+7
n,m=map(int,input().split())
names=[]
for i in range(n):
names.append(input().strip())
res=1
for j in range(m):
unique_col_char_count=0
tmp_arr=[]
for i in range(n):
if names[i][j] not in tmp_arr:
unique_col_char_count+=1
tmp_arr.append(names[i][j])
res*=unique_col_char_count
res=res%(modulo)
print(res) | Title: Pocket Book
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day little Vasya found mom's pocket book. The book had *n* names of her friends and unusually enough, each name was exactly *m* letters long. Let's number the names from 1 to *n* in the order in which they are written.
As mom wasn't home, Vasya decided to play with names: he chose three integers *i*, *j*, *k* (1<=≤<=*i*<=<<=*j*<=≤<=*n*, 1<=≤<=*k*<=≤<=*m*), then he took names number *i* and *j* and swapped their prefixes of length *k*. For example, if we take names "CBDAD" and "AABRD" and swap their prefixes with the length of 3, the result will be names "AABAD" and "CBDRD".
You wonder how many different names Vasya can write instead of name number 1, if Vasya is allowed to perform any number of the described actions. As Vasya performs each action, he chooses numbers *i*, *j*, *k* independently from the previous moves and his choice is based entirely on his will. The sought number can be very large, so you should only find it modulo 1000000007 (109<=+<=7).
Input Specification:
The first input line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of names and the length of each name, correspondingly. Then *n* lines contain names, each name consists of exactly *m* uppercase Latin letters.
Output Specification:
Print the single number — the number of different names that could end up in position number 1 in the pocket book after the applying the procedures described above. Print the number modulo 1000000007 (109<=+<=7).
Demo Input:
['2 3\nAAB\nBAA\n', '4 5\nABABA\nBCGDG\nAAAAA\nYABSA\n']
Demo Output:
['4\n', '216\n']
Note:
In the first sample Vasya can get the following names in the position number 1: "AAB", "AAA", "BAA" and "BAB". | ```python
if __name__ == "__main__":
modulo=10**9+7
n,m=map(int,input().split())
names=[]
for i in range(n):
names.append(input().strip())
res=1
for j in range(m):
unique_col_char_count=0
tmp_arr=[]
for i in range(n):
if names[i][j] not in tmp_arr:
unique_col_char_count+=1
tmp_arr.append(names[i][j])
res*=unique_col_char_count
res=res%(modulo)
print(res)
``` | 3 |
|
749 | A | Bachgold Problem | PROGRAMMING | 800 | [
"greedy",
"implementation",
"math",
"number theory"
] | null | null | Bachgold problem is very easy to formulate. Given a positive integer *n* represent it as a sum of maximum possible number of prime numbers. One can prove that such representation exists for any integer greater than 1.
Recall that integer *k* is called prime if it is greater than 1 and has exactly two positive integer divisors — 1 and *k*. | The only line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000). | The first line of the output contains a single integer *k* — maximum possible number of primes in representation.
The second line should contain *k* primes with their sum equal to *n*. You can print them in any order. If there are several optimal solution, print any of them. | [
"5\n",
"6\n"
] | [
"2\n2 3\n",
"3\n2 2 2\n"
] | none | 500 | [
{
"input": "5",
"output": "2\n2 3"
},
{
"input": "6",
"output": "3\n2 2 2"
},
{
"input": "2",
"output": "1\n2"
},
{
"input": "3",
"output": "1\n3"
},
{
"input": "99999",
"output": "49999\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "100000",
"output": "50000\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "7",
"output": "3\n2 2 3"
},
{
"input": "4",
"output": "2\n2 2"
},
{
"input": "8",
"output": "4\n2 2 2 2"
},
{
"input": "9",
"output": "4\n2 2 2 3"
},
{
"input": "99995",
"output": "49997\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99996",
"output": "49998\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "10",
"output": "5\n2 2 2 2 2"
},
{
"input": "11",
"output": "5\n2 2 2 2 3"
},
{
"input": "99997",
"output": "49998\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99998",
"output": "49999\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "12",
"output": "6\n2 2 2 2 2 2"
},
{
"input": "13",
"output": "6\n2 2 2 2 2 3"
},
{
"input": "99993",
"output": "49996\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99994",
"output": "49997\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "14",
"output": "7\n2 2 2 2 2 2 2"
},
{
"input": "15",
"output": "7\n2 2 2 2 2 2 3"
},
{
"input": "53",
"output": "26\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "57",
"output": "28\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "61",
"output": "30\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "774",
"output": "387\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "202",
"output": "101\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2"
},
{
"input": "530",
"output": "265\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "7166",
"output": "3583\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "9294",
"output": "4647\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "2422",
"output": "1211\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "15326",
"output": "7663\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "11454",
"output": "5727\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "14878",
"output": "7439\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "90672",
"output": "45336\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99544",
"output": "49772\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "90472",
"output": "45236\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "23",
"output": "11\n2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "93",
"output": "46\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "19",
"output": "9\n2 2 2 2 2 2 2 2 3"
},
{
"input": "11110",
"output": "5555\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
}
] | 1,676,308,146 | 2,147,483,647 | Python 3 | OK | TESTS | 41 | 108 | 0 | n = int(input())
if n % 2 == 0:
print(n//2)
for x in range(n//2):
print(2,end=" ")
else:
print(n//2)
for x in range((n//2) - 1):
print(2,end=" ")
print(3)
| Title: Bachgold Problem
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bachgold problem is very easy to formulate. Given a positive integer *n* represent it as a sum of maximum possible number of prime numbers. One can prove that such representation exists for any integer greater than 1.
Recall that integer *k* is called prime if it is greater than 1 and has exactly two positive integer divisors — 1 and *k*.
Input Specification:
The only line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000).
Output Specification:
The first line of the output contains a single integer *k* — maximum possible number of primes in representation.
The second line should contain *k* primes with their sum equal to *n*. You can print them in any order. If there are several optimal solution, print any of them.
Demo Input:
['5\n', '6\n']
Demo Output:
['2\n2 3\n', '3\n2 2 2\n']
Note:
none | ```python
n = int(input())
if n % 2 == 0:
print(n//2)
for x in range(n//2):
print(2,end=" ")
else:
print(n//2)
for x in range((n//2) - 1):
print(2,end=" ")
print(3)
``` | 3 |
|
0 | none | none | none | 0 | [
"none"
] | null | null | A substring of some string is called the most frequent, if the number of its occurrences is not less than number of occurrences of any other substring.
You are given a set of strings. A string (not necessarily from this set) is called good if all elements of the set are the most frequent substrings of this string. Restore the non-empty good string with minimum length. If several such strings exist, restore lexicographically minimum string. If there are no good strings, print "NO" (without quotes).
A substring of a string is a contiguous subsequence of letters in the string. For example, "ab", "c", "abc" are substrings of string "abc", while "ac" is not a substring of that string.
The number of occurrences of a substring in a string is the number of starting positions in the string where the substring occurs. These occurrences could overlap.
String *a* is lexicographically smaller than string *b*, if *a* is a prefix of *b*, or *a* has a smaller letter at the first position where *a* and *b* differ. | The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of strings in the set.
Each of the next *n* lines contains a non-empty string consisting of lowercase English letters. It is guaranteed that the strings are distinct.
The total length of the strings doesn't exceed 105. | Print the non-empty good string with minimum length. If several good strings exist, print lexicographically minimum among them. Print "NO" (without quotes) if there are no good strings. | [
"4\nmail\nai\nlru\ncf\n",
"3\nkek\npreceq\ncheburek\n"
] | [
"cfmailru\n",
"NO\n"
] | One can show that in the first sample only two good strings with minimum length exist: "cfmailru" and "mailrucf". The first string is lexicographically minimum. | 0 | [
{
"input": "4\nmail\nai\nlru\ncf",
"output": "cfmailru"
},
{
"input": "3\nkek\npreceq\ncheburek",
"output": "NO"
},
{
"input": "1\nz",
"output": "z"
},
{
"input": "2\nab\nba",
"output": "NO"
},
{
"input": "2\nac\nbc",
"output": "NO"
},
{
"input": "2\ncd\nce",
"output": "NO"
},
{
"input": "2\nca\ncb",
"output": "NO"
},
{
"input": "2\ndc\nec",
"output": "NO"
},
{
"input": "26\nhw\nwb\nba\nax\nxl\nle\neo\nod\ndj\njt\ntm\nmq\nqf\nfk\nkn\nny\nyz\nzr\nrg\ngv\nvc\ncs\nsi\niu\nup\nph",
"output": "NO"
},
{
"input": "25\nsw\nwt\nc\nl\nyo\nag\nz\nof\np\nmz\nnm\nui\nzs\nj\nq\nk\ngd\nb\nen\nx\ndv\nty\nh\nr\nvu",
"output": "agdvuibcenmzswtyofhjklpqrx"
},
{
"input": "2\naz\nzb",
"output": "azb"
},
{
"input": "26\nl\nq\nb\nk\nh\nf\nx\ny\nj\na\ni\nu\ns\nd\nc\ng\nv\nw\np\no\nm\nt\nr\nz\nn\ne",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "76\namnctposz\nmnctpos\nos\nu\ne\nam\namnc\neamnctpo\nl\nx\nq\nposzq\neamnc\nctposzq\nctpos\nmnc\ntpos\namnctposzql\ntposzq\nmnctposz\nnctpos\nctposzql\namnctpos\nmnct\np\nux\nposzql\ntpo\nmnctposzql\nmnctp\neamnctpos\namnct\ntposzql\nposz\nz\nct\namnctpo\noszq\neamnct\ntposz\ns\nmn\nn\nc\noszql\npo\no\nmnctposzq\nt\namnctposzq\nnctposzql\nnct\namn\neam\nctp\nosz\npos\nmnctpo\nzq\neamnctposzql\namnctp\nszql\neamn\ntp\nzql\na\nea\nql\nsz\neamnctposz\nnctpo\nctposz\nm\nnctposz\nnctp\nnc",
"output": "eamnctposzqlux"
},
{
"input": "75\nqsicaj\nd\nnkmd\ndb\ntqsicaj\nm\naje\nftqsicaj\ncaj\nftqsic\ntqsicajeh\nic\npv\ny\nho\nicajeho\nc\ns\nb\nftqsi\nmdb\ntqsic\ntqs\nsi\nnkmdb\njeh\najeho\nqs\ntqsicajeho\nje\nwp\njeho\neh\nwpv\nh\no\nyw\nj\nv\ntqsicaje\nftqsicajeho\nsica\ncajeho\nqsic\nqsica\na\nftqsicajeh\nn\ntqsi\nicajeh\nsic\ne\nqsicaje\ncajeh\nca\nft\nsicajeho\najeh\ncaje\nqsicajeho\nsicaje\nftqsicaje\nsicajeh\nftqsica\nica\nkm\nqsicajeh\naj\ni\ntq\nmd\nkmdb\nkmd\ntqsica\nnk",
"output": "ftqsicajehonkmdbywpv"
},
{
"input": "16\nngv\nng\njngvu\ng\ngv\nvu\ni\nn\njngv\nu\nngvu\njng\njn\nl\nj\ngvu",
"output": "ijngvul"
},
{
"input": "33\naqzwlyfjcuktsr\ngidpnvaqzwlyfj\nvaqzwlyf\npnvaqzwlyfjcuktsrbx\njcuktsrbxme\nuktsrb\nhgidpnvaqzw\nvaqzwlyfjcu\nhgid\nvaqzwlyfjcukts\npnvaqzwl\npnvaqzwlyfj\ngidpnvaqzwlyfjcukt\naqzwlyfjcuktsrbxme\ngidpnvaqzwlyfjcuktsrb\naqzw\nlyfjcuktsrbxme\nrbxm\nwlyfjcukt\npnvaqzwlyfjcuktsr\nnvaqzwly\nd\nzwlyf\nhgidpnva\ngidpnvaqzwlyfjcuktsrbxm\ngidpn\nfjcuktsrbxmeo\nfjcuktsrbx\ngidpnva\nzwlyfjc\nrb\ntsrbxm\ndpnvaqzwlyfjcuktsrbxm",
"output": "hgidpnvaqzwlyfjcuktsrbxmeo"
},
{
"input": "15\nipxh\nipx\nr\nxh\ncjr\njr\np\nip\ncj\ni\nx\nhi\nc\nh\npx",
"output": "NO"
},
{
"input": "51\np\nsu\nbpxh\nx\nxhvacdy\nqosuf\ncdy\nbpxhvacd\nxh\nbpxhv\nf\npxh\nhva\nhvac\nxhva\nos\ns\ndy\nqo\nv\nq\na\nbpxhvacdy\nxhv\nqosu\nyb\nacdy\nu\npxhvacd\nc\nvacdy\no\nuf\nxhvacd\nvac\nbpx\nacd\nbp\nhvacdy\nsuf\nbpxhvac\ncd\nh\npxhva\nhv\npxhv\nosu\nd\ny\nxhvac\npxhvacdy",
"output": "NO"
},
{
"input": "20\nckdza\nw\ntvylck\nbqtv\ntvylckd\nos\nbqtvy\nrpx\nzaj\nrpxebqtvylckdzajfmi\nbqtvylckdzajf\nvylc\ntvyl\npxebq\nf\npxebqtv\nlckdza\nwnh\ns\npxe",
"output": "osrpxebqtvylckdzajfmiwnh"
},
{
"input": "25\nza\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nr\ns\nt\nu\nv\nw\nx\ny\nz",
"output": "bcdefghijklmnoprstuvwxyza"
},
{
"input": "25\nzdcba\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nr\ns\nt\nu\nv\nw\nx\ny\nz",
"output": "efghijklmnoprstuvwxyzdcba"
},
{
"input": "13\nza\nyb\nxc\nwd\nve\nuf\ntg\nsh\nri\nqj\npk\nol\nnm",
"output": "nmolpkqjrishtgufvewdxcybza"
},
{
"input": "13\naz\nby\ncx\ndw\nev\nfu\ngt\nhs\nir\njq\nkp\nlo\nmn",
"output": "azbycxdwevfugthsirjqkplomn"
},
{
"input": "4\nab\nbc\nca\nd",
"output": "NO"
},
{
"input": "3\nb\nd\nc",
"output": "bcd"
},
{
"input": "3\nab\nba\nc",
"output": "NO"
},
{
"input": "2\nba\nca",
"output": "NO"
},
{
"input": "4\naz\nzy\ncx\nxd",
"output": "azycxd"
},
{
"input": "2\nab\nbb",
"output": "NO"
},
{
"input": "2\nab\nac",
"output": "NO"
},
{
"input": "3\nab\nba\ncd",
"output": "NO"
},
{
"input": "2\nabc\ncb",
"output": "NO"
},
{
"input": "1\nlol",
"output": "NO"
},
{
"input": "2\naa\nb",
"output": "NO"
},
{
"input": "6\na\nb\nc\nde\nef\nfd",
"output": "NO"
},
{
"input": "3\nabc\ncb\ndd",
"output": "NO"
},
{
"input": "3\nabcd\nefg\ncdefg",
"output": "abcdefg"
}
] | 1,510,531,453 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 4 | 62 | 0 | n = int(input())
s = []
for _ in range(n):
s.append(input())
if len(set(s[-1])) != len(s[-1]):
print("NO")
exit(0)
m = []
for i in range(len(s)):
c = s[i]
for j in range(len(m)):
if len(set(s[i]) & set(m[j])) != 0:
merged = False
for k in range(1, min(len(s[i]), len(m[j]))):
if s[i][:k] == m[j][len(m[j])-k:]:
c = m[j]+s[i][k:]
m.pop(j)
merged = True
break
if s[i][len(s[i])-k:] == m[j][:k]:
c = s[i]+m[j][k:]
m.pop(j)
merged = True
break
if merged == False:
if m[j].find(s[i]):
c = m[j]
m.pop(j)
merged = True
elif s[i].find(m[j]):
c = s[i]
m.pop(j)
merged = True
if merged == False:
print("NO")
exit(0)
else:
break
m.append(c)
m.sort()
fs = ''.join(m)
if len(set(fs)) != len(fs):
print("NO")
else:
print(fs)
| Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A substring of some string is called the most frequent, if the number of its occurrences is not less than number of occurrences of any other substring.
You are given a set of strings. A string (not necessarily from this set) is called good if all elements of the set are the most frequent substrings of this string. Restore the non-empty good string with minimum length. If several such strings exist, restore lexicographically minimum string. If there are no good strings, print "NO" (without quotes).
A substring of a string is a contiguous subsequence of letters in the string. For example, "ab", "c", "abc" are substrings of string "abc", while "ac" is not a substring of that string.
The number of occurrences of a substring in a string is the number of starting positions in the string where the substring occurs. These occurrences could overlap.
String *a* is lexicographically smaller than string *b*, if *a* is a prefix of *b*, or *a* has a smaller letter at the first position where *a* and *b* differ.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of strings in the set.
Each of the next *n* lines contains a non-empty string consisting of lowercase English letters. It is guaranteed that the strings are distinct.
The total length of the strings doesn't exceed 105.
Output Specification:
Print the non-empty good string with minimum length. If several good strings exist, print lexicographically minimum among them. Print "NO" (without quotes) if there are no good strings.
Demo Input:
['4\nmail\nai\nlru\ncf\n', '3\nkek\npreceq\ncheburek\n']
Demo Output:
['cfmailru\n', 'NO\n']
Note:
One can show that in the first sample only two good strings with minimum length exist: "cfmailru" and "mailrucf". The first string is lexicographically minimum. | ```python
n = int(input())
s = []
for _ in range(n):
s.append(input())
if len(set(s[-1])) != len(s[-1]):
print("NO")
exit(0)
m = []
for i in range(len(s)):
c = s[i]
for j in range(len(m)):
if len(set(s[i]) & set(m[j])) != 0:
merged = False
for k in range(1, min(len(s[i]), len(m[j]))):
if s[i][:k] == m[j][len(m[j])-k:]:
c = m[j]+s[i][k:]
m.pop(j)
merged = True
break
if s[i][len(s[i])-k:] == m[j][:k]:
c = s[i]+m[j][k:]
m.pop(j)
merged = True
break
if merged == False:
if m[j].find(s[i]):
c = m[j]
m.pop(j)
merged = True
elif s[i].find(m[j]):
c = s[i]
m.pop(j)
merged = True
if merged == False:
print("NO")
exit(0)
else:
break
m.append(c)
m.sort()
fs = ''.join(m)
if len(set(fs)) != len(fs):
print("NO")
else:
print(fs)
``` | 0 |
|
387 | B | George and Round | PROGRAMMING | 1,200 | [
"brute force",
"greedy",
"two pointers"
] | null | null | George decided to prepare a Codesecrof round, so he has prepared *m* problems for the round. Let's number the problems with integers 1 through *m*. George estimates the *i*-th problem's complexity by integer *b**i*.
To make the round good, he needs to put at least *n* problems there. Besides, he needs to have at least one problem with complexity exactly *a*1, at least one with complexity exactly *a*2, ..., and at least one with complexity exactly *a**n*. Of course, the round can also have problems with other complexities.
George has a poor imagination. It's easier for him to make some already prepared problem simpler than to come up with a new one and prepare it. George is magnificent at simplifying problems. He can simplify any already prepared problem with complexity *c* to any positive integer complexity *d* (*c*<=≥<=*d*), by changing limits on the input data.
However, nothing is so simple. George understood that even if he simplifies some problems, he can run out of problems for a good round. That's why he decided to find out the minimum number of problems he needs to come up with in addition to the *m* he's prepared in order to make a good round. Note that George can come up with a new problem of any complexity. | The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=3000) — the minimal number of problems in a good round and the number of problems George's prepared. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a*1<=<<=*a*2<=<<=...<=<<=*a**n*<=≤<=106) — the requirements for the complexity of the problems in a good round. The third line contains space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b*1<=≤<=*b*2...<=≤<=*b**m*<=≤<=106) — the complexities of the problems prepared by George. | Print a single integer — the answer to the problem. | [
"3 5\n1 2 3\n1 2 2 3 3\n",
"3 5\n1 2 3\n1 1 1 1 1\n",
"3 1\n2 3 4\n1\n"
] | [
"0\n",
"2\n",
"3\n"
] | In the first sample the set of the prepared problems meets the requirements for a good round.
In the second sample, it is enough to come up with and prepare two problems with complexities 2 and 3 to get a good round.
In the third sample it is very easy to get a good round if come up with and prepare extra problems with complexities: 2, 3, 4. | 1,000 | [
{
"input": "3 5\n1 2 3\n1 2 2 3 3",
"output": "0"
},
{
"input": "3 5\n1 2 3\n1 1 1 1 1",
"output": "2"
},
{
"input": "3 1\n2 3 4\n1",
"output": "3"
},
{
"input": "29 100\n20 32 41 67 72 155 331 382 399 412 465 470 484 511 515 529 616 637 679 715 733 763 826 843 862 903 925 979 989\n15 15 15 17 18 19 19 20 21 21 22 24 25 26 26 27 28 31 32 32 37 38 38 39 39 40 41 42 43 43 45 45 46 47 49 49 50 50 50 51 52 53 53 55 56 57 59 59 59 60 60 62 62 63 63 64 64 64 66 67 69 69 70 70 72 72 73 74 75 76 77 78 80 80 81 81 83 83 83 84 86 86 86 86 87 88 89 91 91 91 92 93 94 94 96 97 97 97 98 98",
"output": "24"
}
] | 1,520,266,923 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 26 | 1,000 | 5,939,200 | n,m=map(int,input().split())
a=list(map(int,input().split()))
b=list(map(int,input().split()))
count=0
l=len(b)
count1=n
for i in range(n):
if l==0:
count+=n-i
break
j=0
while j<l:
if a[i]<=b[j]:
del b[j]
l-=1
break
elif j==l-1:
count+=1
j+=1
print(count) | Title: George and Round
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
George decided to prepare a Codesecrof round, so he has prepared *m* problems for the round. Let's number the problems with integers 1 through *m*. George estimates the *i*-th problem's complexity by integer *b**i*.
To make the round good, he needs to put at least *n* problems there. Besides, he needs to have at least one problem with complexity exactly *a*1, at least one with complexity exactly *a*2, ..., and at least one with complexity exactly *a**n*. Of course, the round can also have problems with other complexities.
George has a poor imagination. It's easier for him to make some already prepared problem simpler than to come up with a new one and prepare it. George is magnificent at simplifying problems. He can simplify any already prepared problem with complexity *c* to any positive integer complexity *d* (*c*<=≥<=*d*), by changing limits on the input data.
However, nothing is so simple. George understood that even if he simplifies some problems, he can run out of problems for a good round. That's why he decided to find out the minimum number of problems he needs to come up with in addition to the *m* he's prepared in order to make a good round. Note that George can come up with a new problem of any complexity.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=3000) — the minimal number of problems in a good round and the number of problems George's prepared. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a*1<=<<=*a*2<=<<=...<=<<=*a**n*<=≤<=106) — the requirements for the complexity of the problems in a good round. The third line contains space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b*1<=≤<=*b*2...<=≤<=*b**m*<=≤<=106) — the complexities of the problems prepared by George.
Output Specification:
Print a single integer — the answer to the problem.
Demo Input:
['3 5\n1 2 3\n1 2 2 3 3\n', '3 5\n1 2 3\n1 1 1 1 1\n', '3 1\n2 3 4\n1\n']
Demo Output:
['0\n', '2\n', '3\n']
Note:
In the first sample the set of the prepared problems meets the requirements for a good round.
In the second sample, it is enough to come up with and prepare two problems with complexities 2 and 3 to get a good round.
In the third sample it is very easy to get a good round if come up with and prepare extra problems with complexities: 2, 3, 4. | ```python
n,m=map(int,input().split())
a=list(map(int,input().split()))
b=list(map(int,input().split()))
count=0
l=len(b)
count1=n
for i in range(n):
if l==0:
count+=n-i
break
j=0
while j<l:
if a[i]<=b[j]:
del b[j]
l-=1
break
elif j==l-1:
count+=1
j+=1
print(count)
``` | 0 |
|
837 | A | Text Volume | PROGRAMMING | 800 | [
"implementation"
] | null | null | You are given a text of single-space separated words, consisting of small and capital Latin letters.
Volume of the word is number of capital letters in the word. Volume of the text is maximum volume of all words in the text.
Calculate the volume of the given text. | The first line contains one integer number *n* (1<=≤<=*n*<=≤<=200) — length of the text.
The second line contains text of single-space separated words *s*1,<=*s*2,<=...,<=*s**i*, consisting only of small and capital Latin letters. | Print one integer number — volume of text. | [
"7\nNonZERO\n",
"24\nthis is zero answer text\n",
"24\nHarbour Space University\n"
] | [
"5\n",
"0\n",
"1\n"
] | In the first example there is only one word, there are 5 capital letters in it.
In the second example all of the words contain 0 capital letters. | 0 | [
{
"input": "7\nNonZERO",
"output": "5"
},
{
"input": "24\nthis is zero answer text",
"output": "0"
},
{
"input": "24\nHarbour Space University",
"output": "1"
},
{
"input": "2\nWM",
"output": "2"
},
{
"input": "200\nLBmJKQLCKUgtTxMoDsEerwvLOXsxASSydOqWyULsRcjMYDWdDCgaDvBfATIWPVSXlbcCLHPYahhxMEYUiaxoCebghJqvmRnaNHYTKLeOiaLDnATPZAOgSNfBzaxLymTGjfzvTegbXsAthTxyDTcmBUkqyGlVGZhoazQzVSoKbTFcCRvYsgSCwjGMxBfWEwMHuagTBxkz",
"output": "105"
},
{
"input": "199\no A r v H e J q k J k v w Q F p O R y R Z o a K R L Z E H t X y X N y y p b x B m r R S q i A x V S u i c L y M n N X c C W Z m S j e w C w T r I S X T D F l w o k f t X u n W w p Z r A k I Y E h s g",
"output": "1"
},
{
"input": "200\nhCyIdivIiISmmYIsCLbpKcTyHaOgTUQEwnQACXnrLdHAVFLtvliTEMlzBVzTesQbhXmcqvwPDeojglBMIjOXANfyQxCSjOJyO SIqOTnRzVzseGIDDYNtrwIusScWSuEhPyEmgQIVEzXofRptjeMzzhtUQxJgcUWILUhEaaRmYRBVsjoqgmyPIKwSajdlNPccOOtWrez",
"output": "50"
},
{
"input": "1\ne",
"output": "0"
},
{
"input": "1\nA",
"output": "1"
},
{
"input": "200\nABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ ABCDEFGHIJ KLMNOPRSTU KLMNOPRSTU KLMNOPRSTU VWXYZABCDE KLMNOPRSTU KLMNOPRSTU KLMNOPRSTU KLMNOPRSTU KZ",
"output": "10"
},
{
"input": "200\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "200"
},
{
"input": "200\nffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffffff",
"output": "0"
},
{
"input": "24\nHarbour Space UniversitY",
"output": "2"
},
{
"input": "5\naA AA",
"output": "2"
},
{
"input": "10\nas AS ASDA",
"output": "4"
},
{
"input": "10\nas AS ASDZ",
"output": "4"
},
{
"input": "3\na A",
"output": "1"
},
{
"input": "24\nHarbour space UniversitY",
"output": "2"
},
{
"input": "10\nas AS ASAa",
"output": "3"
},
{
"input": "15\naAb ABCDFGRHTJS",
"output": "11"
},
{
"input": "53\nsdfAZEZR AZE dfdf dsdRFGSDF ZZDZSD dfsd ERBGF dsfsdfR",
"output": "6"
},
{
"input": "10\nABC ABc AB",
"output": "3"
},
{
"input": "10\nA c de CDE",
"output": "3"
},
{
"input": "4\nA AB",
"output": "2"
},
{
"input": "18\nHARbour Space UNIV",
"output": "4"
},
{
"input": "13\na b c d e f A",
"output": "1"
},
{
"input": "6\nA B CA",
"output": "2"
},
{
"input": "4\naa A",
"output": "1"
},
{
"input": "3\nA a",
"output": "1"
}
] | 1,656,093,053 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 5 | 46 | 0 | n= int(input())
string = input()
count=0
for i in range(len(string)):
if string[i].isupper()== True:
count=count+1
if string[i]==" ":
count=0
print(count) | Title: Text Volume
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a text of single-space separated words, consisting of small and capital Latin letters.
Volume of the word is number of capital letters in the word. Volume of the text is maximum volume of all words in the text.
Calculate the volume of the given text.
Input Specification:
The first line contains one integer number *n* (1<=≤<=*n*<=≤<=200) — length of the text.
The second line contains text of single-space separated words *s*1,<=*s*2,<=...,<=*s**i*, consisting only of small and capital Latin letters.
Output Specification:
Print one integer number — volume of text.
Demo Input:
['7\nNonZERO\n', '24\nthis is zero answer text\n', '24\nHarbour Space University\n']
Demo Output:
['5\n', '0\n', '1\n']
Note:
In the first example there is only one word, there are 5 capital letters in it.
In the second example all of the words contain 0 capital letters. | ```python
n= int(input())
string = input()
count=0
for i in range(len(string)):
if string[i].isupper()== True:
count=count+1
if string[i]==" ":
count=0
print(count)
``` | 0 |
|
928 | A | Login Verification | PROGRAMMING | 1,200 | [
"*special",
"strings"
] | null | null | When registering in a social network, users are allowed to create their own convenient login to make it easier to share contacts, print it on business cards, etc.
Login is an arbitrary sequence of lower and uppercase latin letters, digits and underline symbols («_»). However, in order to decrease the number of frauds and user-inattention related issues, it is prohibited to register a login if it is similar with an already existing login. More precisely, two logins *s* and *t* are considered similar if we can transform *s* to *t* via a sequence of operations of the following types:
- transform lowercase letters to uppercase and vice versa; - change letter «O» (uppercase latin letter) to digit «0» and vice versa; - change digit «1» (one) to any letter among «l» (lowercase latin «L»), «I» (uppercase latin «i») and vice versa, or change one of these letters to other.
For example, logins «Codeforces» and «codef0rces» as well as «OO0OOO00O0OOO0O00OOO0OO_lol» and «OO0OOO0O00OOO0O00OO0OOO_1oI» are considered similar whereas «Codeforces» and «Code_forces» are not.
You're given a list of existing logins with no two similar amonst and a newly created user login. Check whether this new login is similar with any of the existing ones. | The first line contains a non-empty string *s* consisting of lower and uppercase latin letters, digits and underline symbols («_») with length not exceeding 50 — the login itself.
The second line contains a single integer *n* (1<=≤<=*n*<=≤<=1<=000) — the number of existing logins.
The next *n* lines describe the existing logins, following the same constraints as the user login (refer to the first line of the input). It's guaranteed that no two existing logins are similar. | Print «Yes» (without quotes), if user can register via this login, i.e. none of the existing logins is similar with it.
Otherwise print «No» (without quotes). | [
"1_wat\n2\n2_wat\nwat_1\n",
"000\n3\n00\nooA\noOo\n",
"_i_\n3\n__i_\n_1_\nI\n",
"La0\n3\n2a0\nLa1\n1a0\n",
"abc\n1\naBc\n",
"0Lil\n2\nLIL0\n0Ril\n"
] | [
"Yes\n",
"No\n",
"No\n",
"No\n",
"No\n",
"Yes\n"
] | In the second sample case the user wants to create a login consisting of three zeros. It's impossible due to collision with the third among the existing.
In the third sample case the new login is similar with the second one. | 500 | [
{
"input": "1_wat\n2\n2_wat\nwat_1",
"output": "Yes"
},
{
"input": "000\n3\n00\nooA\noOo",
"output": "No"
},
{
"input": "_i_\n3\n__i_\n_1_\nI",
"output": "No"
},
{
"input": "La0\n3\n2a0\nLa1\n1a0",
"output": "No"
},
{
"input": "abc\n1\naBc",
"output": "No"
},
{
"input": "0Lil\n2\nLIL0\n0Ril",
"output": "Yes"
},
{
"input": "iloO\n3\niIl0\noIl0\nIooO",
"output": "Yes"
},
{
"input": "L1il0o1L1\n5\niLLoLL\noOI1Io10il\nIoLLoO\nO01ilOoI\nI10l0o",
"output": "Yes"
},
{
"input": "ELioO1lOoOIOiLoooi1iolul1O\n7\nOoEIuOIl1ui1010uiooOoi0Oio001L0EoEolO0\nOLIoOEuoE11u1u1iLOI0oO\nuEOuO0uIOOlO01OlEI0E1Oo0IO1LI0uE0LILO0\nEOo0Il11iIOOOIiuOiIiiLOLEOOII001EE\niOoO0LOulioE0OLIIIulli01OoiuOOOoOlEiI0EiiElIIu0\nlE1LOE1Oil\n1u0EOliIiIOl1u110il0l1O0u",
"output": "Yes"
},
{
"input": "0blo7X\n20\n1oobb6\nXIXIO2X\n2iYI2\n607XXol\n2I6io22\nOl10I\nbXX0Lo\nolOOb7X\n07LlXL\nlXY17\n12iIX2\n7lL70\nbOo11\n17Y6b62\n0O6L7\n1lX2L\n2iYl6lI\n7bXIi1o\niLIY2\n0OIo1X",
"output": "Yes"
},
{
"input": "lkUL\n25\nIIfL\nokl\nfoo\ni0U\noko\niIoU\nUUv\nvli\nv0Uk\n0Of\niill\n1vkl\nUIf\nUfOO\nlvLO\nUUo0\nIOf1\nlovL\nIkk\noIv\nLvfU\n0UI\nkol\n1OO0\n1OOi",
"output": "Yes"
},
{
"input": "L1lo\n3\nOOo1\nL1lo\n0lOl",
"output": "No"
},
{
"input": "LIoooiLO\n5\nLIoooiLO\nl0o01I00\n0OOl0lLO01\nil10i0\noiloi",
"output": "No"
},
{
"input": "1i1lQI\n7\nuLg1uLLigIiOLoggu\nLLLgIuQIQIIloiQuIIoIO0l0o000\n0u1LQu11oIuooIl0OooLg0i0IQu1O1lloI1\nQuQgIQi0LOIliLOuuuioLQou1l\nlLIO00QLi01LogOliOIggII1\no0Ll1uIOQl10IL0IILQ\n1i1lQI",
"output": "No"
},
{
"input": "oIzz1\n20\n1TTl0O\nloF0LT\n1lLzo\noi0Ov\nFlIF1zT\nzoITzx\n0TIFlT\nl1vllil\nOviix1F\nLFvI1lL\nLIl0loz\nixz1v\n1i1vFi\nTIFTol\noIzz1\nIvTl0o\nxv1U0O\niiiioF\n1oiLUlO\nxToxv1",
"output": "No"
},
{
"input": "00L0\n25\n0il\nIlkZ\nL0I\n00L0\nBd0\nZLd\n0d1k\nddk\nIdl\nkBd\nkBOL\nZ1lI\nkBL\nLOko\noZ0i\nZ1lO\nLiOk\niBld\nLO0d\ndIo\nZ10\n1k1i\n0o0L\nIoBd\ni0B0",
"output": "No"
},
{
"input": "Z\n1\nz",
"output": "No"
},
{
"input": "0\n1\no",
"output": "No"
},
{
"input": "0\n1\nO",
"output": "No"
},
{
"input": "o\n1\n0",
"output": "No"
},
{
"input": "o\n1\nO",
"output": "No"
},
{
"input": "o\n1\no",
"output": "No"
},
{
"input": "O\n1\no",
"output": "No"
},
{
"input": "O\n1\n0",
"output": "No"
},
{
"input": "1\n1\nl",
"output": "No"
},
{
"input": "1\n1\nL",
"output": "No"
},
{
"input": "1\n1\ni",
"output": "No"
},
{
"input": "1\n1\nI",
"output": "No"
},
{
"input": "1\n1\no",
"output": "Yes"
},
{
"input": "i\n1\n1",
"output": "No"
},
{
"input": "i\n1\nL",
"output": "No"
},
{
"input": "i\n1\nl",
"output": "No"
},
{
"input": "I\n1\nL",
"output": "No"
},
{
"input": "I\n1\nl",
"output": "No"
},
{
"input": "I\n1\n1",
"output": "No"
},
{
"input": "l\n1\n1",
"output": "No"
},
{
"input": "l\n1\nL",
"output": "No"
},
{
"input": "l\n1\ni",
"output": "No"
},
{
"input": "l\n1\nI",
"output": "No"
},
{
"input": "L\n1\nl",
"output": "No"
},
{
"input": "L\n1\n1",
"output": "No"
},
{
"input": "L\n1\ni",
"output": "No"
},
{
"input": "L\n1\nI",
"output": "No"
}
] | 1,673,892,058 | 2,147,483,647 | Python 3 | OK | TESTS | 73 | 46 | 0 | s=input()
s=s.upper()
s=s.replace('O','0')
s=s.replace('L','1')
s=s.replace('I','1')
f=1
for i in range(int(input())):
s1=input()
s1=s1.upper()
s1=s1.replace('O','0')
s1=s1.replace('L','1')
s1=s1.replace('I','1')
if(s==s1):
f=0
if(f):
print("Yes")
else:
print("No") | Title: Login Verification
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
When registering in a social network, users are allowed to create their own convenient login to make it easier to share contacts, print it on business cards, etc.
Login is an arbitrary sequence of lower and uppercase latin letters, digits and underline symbols («_»). However, in order to decrease the number of frauds and user-inattention related issues, it is prohibited to register a login if it is similar with an already existing login. More precisely, two logins *s* and *t* are considered similar if we can transform *s* to *t* via a sequence of operations of the following types:
- transform lowercase letters to uppercase and vice versa; - change letter «O» (uppercase latin letter) to digit «0» and vice versa; - change digit «1» (one) to any letter among «l» (lowercase latin «L»), «I» (uppercase latin «i») and vice versa, or change one of these letters to other.
For example, logins «Codeforces» and «codef0rces» as well as «OO0OOO00O0OOO0O00OOO0OO_lol» and «OO0OOO0O00OOO0O00OO0OOO_1oI» are considered similar whereas «Codeforces» and «Code_forces» are not.
You're given a list of existing logins with no two similar amonst and a newly created user login. Check whether this new login is similar with any of the existing ones.
Input Specification:
The first line contains a non-empty string *s* consisting of lower and uppercase latin letters, digits and underline symbols («_») with length not exceeding 50 — the login itself.
The second line contains a single integer *n* (1<=≤<=*n*<=≤<=1<=000) — the number of existing logins.
The next *n* lines describe the existing logins, following the same constraints as the user login (refer to the first line of the input). It's guaranteed that no two existing logins are similar.
Output Specification:
Print «Yes» (without quotes), if user can register via this login, i.e. none of the existing logins is similar with it.
Otherwise print «No» (without quotes).
Demo Input:
['1_wat\n2\n2_wat\nwat_1\n', '000\n3\n00\nooA\noOo\n', '_i_\n3\n__i_\n_1_\nI\n', 'La0\n3\n2a0\nLa1\n1a0\n', 'abc\n1\naBc\n', '0Lil\n2\nLIL0\n0Ril\n']
Demo Output:
['Yes\n', 'No\n', 'No\n', 'No\n', 'No\n', 'Yes\n']
Note:
In the second sample case the user wants to create a login consisting of three zeros. It's impossible due to collision with the third among the existing.
In the third sample case the new login is similar with the second one. | ```python
s=input()
s=s.upper()
s=s.replace('O','0')
s=s.replace('L','1')
s=s.replace('I','1')
f=1
for i in range(int(input())):
s1=input()
s1=s1.upper()
s1=s1.replace('O','0')
s1=s1.replace('L','1')
s1=s1.replace('I','1')
if(s==s1):
f=0
if(f):
print("Yes")
else:
print("No")
``` | 3 |
|
222 | B | Cosmic Tables | PROGRAMMING | 1,300 | [
"data structures",
"implementation"
] | null | null | The Free Meteor Association (FMA) has got a problem: as meteors are moving, the Universal Cosmic Descriptive Humorous Program (UCDHP) needs to add a special module that would analyze this movement.
UCDHP stores some secret information about meteors as an *n*<=×<=*m* table with integers in its cells. The order of meteors in the Universe is changing. That's why the main UCDHP module receives the following queries:
- The query to swap two table rows; - The query to swap two table columns; - The query to obtain a secret number in a particular table cell.
As the main UCDHP module is critical, writing the functional of working with the table has been commissioned to you. | The first line contains three space-separated integers *n*, *m* and *k* (1<=≤<=*n*,<=*m*<=≤<=1000, 1<=≤<=*k*<=≤<=500000) — the number of table columns and rows and the number of queries, correspondingly.
Next *n* lines contain *m* space-separated numbers each — the initial state of the table. Each number *p* in the table is an integer and satisfies the inequality 0<=≤<=*p*<=≤<=106.
Next *k* lines contain queries in the format "*s**i* *x**i* *y**i*", where *s**i* is one of the characters "с", "r" or "g", and *x**i*, *y**i* are two integers.
- If *s**i* = "c", then the current query is the query to swap columns with indexes *x**i* and *y**i* (1<=≤<=*x*,<=*y*<=≤<=*m*,<=*x*<=≠<=*y*); - If *s**i* = "r", then the current query is the query to swap rows with indexes *x**i* and *y**i* (1<=≤<=*x*,<=*y*<=≤<=*n*,<=*x*<=≠<=*y*); - If *s**i* = "g", then the current query is the query to obtain the number that located in the *x**i*-th row and in the *y**i*-th column (1<=≤<=*x*<=≤<=*n*,<=1<=≤<=*y*<=≤<=*m*).
The table rows are considered to be indexed from top to bottom from 1 to *n*, and the table columns — from left to right from 1 to *m*. | For each query to obtain a number (*s**i* = "g") print the required number. Print the answers to the queries in the order of the queries in the input. | [
"3 3 5\n1 2 3\n4 5 6\n7 8 9\ng 3 2\nr 3 2\nc 2 3\ng 2 2\ng 3 2\n",
"2 3 3\n1 2 4\n3 1 5\nc 2 1\nr 1 2\ng 1 3\n"
] | [
"8\n9\n6\n",
"5\n"
] | Let's see how the table changes in the second test case.
After the first operation is fulfilled, the table looks like that:
2 1 4
1 3 5
After the second operation is fulfilled, the table looks like that:
1 3 5
2 1 4
So the answer to the third query (the number located in the first row and in the third column) will be 5. | 1,000 | [
{
"input": "3 3 5\n1 2 3\n4 5 6\n7 8 9\ng 3 2\nr 3 2\nc 2 3\ng 2 2\ng 3 2",
"output": "8\n9\n6"
},
{
"input": "2 3 3\n1 2 4\n3 1 5\nc 2 1\nr 1 2\ng 1 3",
"output": "5"
},
{
"input": "1 1 15\n1\ng 1 1\ng 1 1\ng 1 1\ng 1 1\ng 1 1\ng 1 1\ng 1 1\ng 1 1\ng 1 1\ng 1 1\ng 1 1\ng 1 1\ng 1 1\ng 1 1\ng 1 1",
"output": "1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1"
},
{
"input": "1 2 3\n1 2\nc 1 2\ng 1 1\ng 1 2",
"output": "2\n1"
},
{
"input": "2 2 6\n1 2\n3 4\nc 1 2\nr 1 2\ng 1 1\ng 1 2\ng 2 1\ng 2 2",
"output": "4\n3\n2\n1"
},
{
"input": "3 4 5\n1 2 3 4\n5 6 7 8\n9 10 11 12\nr 1 2\nr 1 3\nr 2 3\ng 1 1\ng 2 2",
"output": "9\n6"
},
{
"input": "5 5 12\n1 2 3 4 5\n6 7 8 9 10\n11 12 13 14 15\n16 17 18 19 20\n21 22 23 24 25\nc 1 2\nr 1 2\nr 2 3\nr 1 2\nr 4 5\nc 3 4\ng 1 1\ng 2 2\ng 3 3\ng 4 4\ng 5 5\ng 2 3",
"output": "12\n6\n4\n23\n20\n9"
},
{
"input": "6 5 30\n536048 34640 572197 62457 304174\n194764 325606 270468 784237 551632\n10580 294606 63164 543647 531895\n430397 576813 678878 323394 603231\n534567 804015 403517 886087 981939\n518845 962097 609792 877955 88610\nc 1 5\nc 2 5\nc 2 5\nr 5 3\nc 5 2\nc 4 5\nr 6 5\nc 2 1\nr 3 4\nr 4 3\nc 4 5\nc 2 1\nr 1 5\nr 5 6\nc 3 1\ng 1 1\ng 5 4\ng 2 2\ng 2 1\nr 4 5\ng 1 1\nr 3 2\ng 5 1\nr 2 3\nr 6 5\nr 4 2\ng 5 2\nr 1 3\nr 1 3\nc 5 1",
"output": "609792\n543647\n194764\n270468\n609792\n678878\n536048"
},
{
"input": "2 1 3\n1\n2\nr 1 2\ng 1 1\ng 2 1",
"output": "2\n1"
},
{
"input": "3 3 13\n1 2 3\n4 5 6\n7 8 9\nc 1 2\nc 2 3\nr 2 3\nr 1 2\ng 1 1\ng 1 2\ng 1 3\ng 2 1\ng 2 2\ng 2 3\ng 3 1\ng 3 2\ng 3 3",
"output": "8\n9\n7\n2\n3\n1\n5\n6\n4"
},
{
"input": "1 3 7\n1 2 3\nc 1 2\nc 2 3\nc 1 3\nc 2 3\ng 1 1\ng 1 2\ng 1 3",
"output": "1\n2\n3"
},
{
"input": "3 1 7\n1\n2\n3\nr 1 2\nr 2 3\nr 1 3\nr 2 3\ng 1 1\ng 2 1\ng 3 1",
"output": "1\n2\n3"
},
{
"input": "5 6 20\n495907 68740 954868 197572 577456 641857\n16591 602443 981187 646143 137121 884307\n371452 725384 373988 59165 980490 837686\n514286 881540 886532 10541 684975 411009\n314261 127191 461802 89232 749116 563889\nr 2 1\nr 3 4\nc 3 4\nr 2 3\nc 6 3\nc 5 6\nc 4 1\nc 4 2\nr 2 4\nc 1 6\nr 5 3\nr 2 5\nr 4 2\ng 3 4\nc 2 5\nc 3 1\ng 3 6\ng 4 3\ng 2 3\nr 5 4",
"output": "127191\n461802\n577456\n684975"
}
] | 1,608,638,529 | 2,147,483,647 | PyPy 3 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | #include <iostream>
#include <vector>
#include <set>
#include <algorithm>
#include <map>
#include <queue>
#include <string>
using namespace std;
int arr[1005][1005];
int main(){
int n, m;
cin>>n>>m;
for(int i=0;i<m;i++){
int x, y;
cin>>x>>y;
for(int j=x;j<x+3;j++){
for(int k=y;k<y+3;k++){
arr[j][k]++;
if(arr[j][k]==9){
cout<<i+1<<endl;
return 0;
}
}
}
}
cout<<-1<<endl;
} | Title: Cosmic Tables
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Free Meteor Association (FMA) has got a problem: as meteors are moving, the Universal Cosmic Descriptive Humorous Program (UCDHP) needs to add a special module that would analyze this movement.
UCDHP stores some secret information about meteors as an *n*<=×<=*m* table with integers in its cells. The order of meteors in the Universe is changing. That's why the main UCDHP module receives the following queries:
- The query to swap two table rows; - The query to swap two table columns; - The query to obtain a secret number in a particular table cell.
As the main UCDHP module is critical, writing the functional of working with the table has been commissioned to you.
Input Specification:
The first line contains three space-separated integers *n*, *m* and *k* (1<=≤<=*n*,<=*m*<=≤<=1000, 1<=≤<=*k*<=≤<=500000) — the number of table columns and rows and the number of queries, correspondingly.
Next *n* lines contain *m* space-separated numbers each — the initial state of the table. Each number *p* in the table is an integer and satisfies the inequality 0<=≤<=*p*<=≤<=106.
Next *k* lines contain queries in the format "*s**i* *x**i* *y**i*", where *s**i* is one of the characters "с", "r" or "g", and *x**i*, *y**i* are two integers.
- If *s**i* = "c", then the current query is the query to swap columns with indexes *x**i* and *y**i* (1<=≤<=*x*,<=*y*<=≤<=*m*,<=*x*<=≠<=*y*); - If *s**i* = "r", then the current query is the query to swap rows with indexes *x**i* and *y**i* (1<=≤<=*x*,<=*y*<=≤<=*n*,<=*x*<=≠<=*y*); - If *s**i* = "g", then the current query is the query to obtain the number that located in the *x**i*-th row and in the *y**i*-th column (1<=≤<=*x*<=≤<=*n*,<=1<=≤<=*y*<=≤<=*m*).
The table rows are considered to be indexed from top to bottom from 1 to *n*, and the table columns — from left to right from 1 to *m*.
Output Specification:
For each query to obtain a number (*s**i* = "g") print the required number. Print the answers to the queries in the order of the queries in the input.
Demo Input:
['3 3 5\n1 2 3\n4 5 6\n7 8 9\ng 3 2\nr 3 2\nc 2 3\ng 2 2\ng 3 2\n', '2 3 3\n1 2 4\n3 1 5\nc 2 1\nr 1 2\ng 1 3\n']
Demo Output:
['8\n9\n6\n', '5\n']
Note:
Let's see how the table changes in the second test case.
After the first operation is fulfilled, the table looks like that:
2 1 4
1 3 5
After the second operation is fulfilled, the table looks like that:
1 3 5
2 1 4
So the answer to the third query (the number located in the first row and in the third column) will be 5. | ```python
#include <iostream>
#include <vector>
#include <set>
#include <algorithm>
#include <map>
#include <queue>
#include <string>
using namespace std;
int arr[1005][1005];
int main(){
int n, m;
cin>>n>>m;
for(int i=0;i<m;i++){
int x, y;
cin>>x>>y;
for(int j=x;j<x+3;j++){
for(int k=y;k<y+3;k++){
arr[j][k]++;
if(arr[j][k]==9){
cout<<i+1<<endl;
return 0;
}
}
}
}
cout<<-1<<endl;
}
``` | -1 |
|
799 | A | Carrot Cakes | PROGRAMMING | 1,100 | [
"brute force",
"implementation"
] | null | null | In some game by Playrix it takes *t* minutes for an oven to bake *k* carrot cakes, all cakes are ready at the same moment *t* minutes after they started baking. Arkady needs at least *n* cakes to complete a task, but he currently don't have any. However, he has infinitely many ingredients and one oven. Moreover, Arkady can build one more similar oven to make the process faster, it would take *d* minutes to build the oven. While the new oven is being built, only old one can bake cakes, after the new oven is built, both ovens bake simultaneously. Arkady can't build more than one oven.
Determine if it is reasonable to build the second oven, i.e. will it decrease the minimum time needed to get *n* cakes or not. If the time needed with the second oven is the same as with one oven, then it is unreasonable. | The only line contains four integers *n*, *t*, *k*, *d* (1<=≤<=*n*,<=*t*,<=*k*,<=*d*<=≤<=1<=000) — the number of cakes needed, the time needed for one oven to bake *k* cakes, the number of cakes baked at the same time, the time needed to build the second oven. | If it is reasonable to build the second oven, print "YES". Otherwise print "NO". | [
"8 6 4 5\n",
"8 6 4 6\n",
"10 3 11 4\n",
"4 2 1 4\n"
] | [
"YES\n",
"NO\n",
"NO\n",
"YES\n"
] | In the first example it is possible to get 8 cakes in 12 minutes using one oven. The second oven can be built in 5 minutes, so after 6 minutes the first oven bakes 4 cakes, the second oven bakes 4 more ovens after 11 minutes. Thus, it is reasonable to build the second oven.
In the second example it doesn't matter whether we build the second oven or not, thus it takes 12 minutes to bake 8 cakes in both cases. Thus, it is unreasonable to build the second oven.
In the third example the first oven bakes 11 cakes in 3 minutes, that is more than needed 10. It is unreasonable to build the second oven, because its building takes more time that baking the needed number of cakes using the only oven. | 500 | [
{
"input": "8 6 4 5",
"output": "YES"
},
{
"input": "8 6 4 6",
"output": "NO"
},
{
"input": "10 3 11 4",
"output": "NO"
},
{
"input": "4 2 1 4",
"output": "YES"
},
{
"input": "28 17 16 26",
"output": "NO"
},
{
"input": "60 69 9 438",
"output": "NO"
},
{
"input": "599 97 54 992",
"output": "YES"
},
{
"input": "11 22 18 17",
"output": "NO"
},
{
"input": "1 13 22 11",
"output": "NO"
},
{
"input": "1 1 1 1",
"output": "NO"
},
{
"input": "3 1 1 1",
"output": "YES"
},
{
"input": "1000 1000 1000 1000",
"output": "NO"
},
{
"input": "1000 1000 1 1",
"output": "YES"
},
{
"input": "1000 1000 1 400",
"output": "YES"
},
{
"input": "1000 1000 1 1000",
"output": "YES"
},
{
"input": "1000 1000 1 999",
"output": "YES"
},
{
"input": "53 11 3 166",
"output": "YES"
},
{
"input": "313 2 3 385",
"output": "NO"
},
{
"input": "214 9 9 412",
"output": "NO"
},
{
"input": "349 9 5 268",
"output": "YES"
},
{
"input": "611 16 8 153",
"output": "YES"
},
{
"input": "877 13 3 191",
"output": "YES"
},
{
"input": "340 9 9 10",
"output": "YES"
},
{
"input": "31 8 2 205",
"output": "NO"
},
{
"input": "519 3 2 148",
"output": "YES"
},
{
"input": "882 2 21 219",
"output": "NO"
},
{
"input": "982 13 5 198",
"output": "YES"
},
{
"input": "428 13 6 272",
"output": "YES"
},
{
"input": "436 16 14 26",
"output": "YES"
},
{
"input": "628 10 9 386",
"output": "YES"
},
{
"input": "77 33 18 31",
"output": "YES"
},
{
"input": "527 36 4 8",
"output": "YES"
},
{
"input": "128 18 2 169",
"output": "YES"
},
{
"input": "904 4 2 288",
"output": "YES"
},
{
"input": "986 4 3 25",
"output": "YES"
},
{
"input": "134 8 22 162",
"output": "NO"
},
{
"input": "942 42 3 69",
"output": "YES"
},
{
"input": "894 4 9 4",
"output": "YES"
},
{
"input": "953 8 10 312",
"output": "YES"
},
{
"input": "43 8 1 121",
"output": "YES"
},
{
"input": "12 13 19 273",
"output": "NO"
},
{
"input": "204 45 10 871",
"output": "YES"
},
{
"input": "342 69 50 425",
"output": "NO"
},
{
"input": "982 93 99 875",
"output": "NO"
},
{
"input": "283 21 39 132",
"output": "YES"
},
{
"input": "1000 45 83 686",
"output": "NO"
},
{
"input": "246 69 36 432",
"output": "NO"
},
{
"input": "607 93 76 689",
"output": "NO"
},
{
"input": "503 21 24 435",
"output": "NO"
},
{
"input": "1000 45 65 989",
"output": "NO"
},
{
"input": "30 21 2 250",
"output": "YES"
},
{
"input": "1000 49 50 995",
"output": "NO"
},
{
"input": "383 69 95 253",
"output": "YES"
},
{
"input": "393 98 35 999",
"output": "YES"
},
{
"input": "1000 22 79 552",
"output": "NO"
},
{
"input": "268 294 268 154",
"output": "NO"
},
{
"input": "963 465 706 146",
"output": "YES"
},
{
"input": "304 635 304 257",
"output": "NO"
},
{
"input": "4 2 1 6",
"output": "NO"
},
{
"input": "1 51 10 50",
"output": "NO"
},
{
"input": "5 5 4 4",
"output": "YES"
},
{
"input": "3 2 1 1",
"output": "YES"
},
{
"input": "3 4 3 3",
"output": "NO"
},
{
"input": "7 3 4 1",
"output": "YES"
},
{
"input": "101 10 1 1000",
"output": "NO"
},
{
"input": "5 1 1 1",
"output": "YES"
},
{
"input": "5 10 5 5",
"output": "NO"
},
{
"input": "19 1 7 1",
"output": "YES"
},
{
"input": "763 572 745 262",
"output": "YES"
},
{
"input": "1 2 1 1",
"output": "NO"
},
{
"input": "5 1 1 3",
"output": "YES"
},
{
"input": "170 725 479 359",
"output": "NO"
},
{
"input": "6 2 1 7",
"output": "YES"
},
{
"input": "6 2 5 1",
"output": "YES"
},
{
"input": "1 2 2 1",
"output": "NO"
},
{
"input": "24 2 8 3",
"output": "YES"
},
{
"input": "7 3 3 3",
"output": "YES"
},
{
"input": "5 2 2 2",
"output": "YES"
},
{
"input": "3 2 1 2",
"output": "YES"
},
{
"input": "1000 2 200 8",
"output": "NO"
},
{
"input": "3 100 2 100",
"output": "NO"
},
{
"input": "2 999 1 1000",
"output": "NO"
},
{
"input": "2 1 1 1",
"output": "NO"
},
{
"input": "2 3 5 1",
"output": "NO"
},
{
"input": "100 1 5 1",
"output": "YES"
},
{
"input": "7 2 3 3",
"output": "YES"
},
{
"input": "4 1 1 3",
"output": "NO"
},
{
"input": "3 2 2 1",
"output": "YES"
},
{
"input": "1 1 1 2",
"output": "NO"
},
{
"input": "91 8 7 13",
"output": "YES"
},
{
"input": "3 1 2 1",
"output": "NO"
},
{
"input": "5 3 2 3",
"output": "YES"
},
{
"input": "9 6 6 3",
"output": "YES"
}
] | 1,597,672,221 | 2,147,483,647 | PyPy 3 | OK | TESTS | 93 | 140 | 0 | n, t, k, d = map(int, input().split())
g = int((n + k - 1) / k)
o1, o2 = 0, d
i = 0
while i < g:
if o1 <= o2:
o1 += t
else:
o2 += t
i += 1
if max(o1, o2) < g * t:
print("YES")
else:
print("NO") | Title: Carrot Cakes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In some game by Playrix it takes *t* minutes for an oven to bake *k* carrot cakes, all cakes are ready at the same moment *t* minutes after they started baking. Arkady needs at least *n* cakes to complete a task, but he currently don't have any. However, he has infinitely many ingredients and one oven. Moreover, Arkady can build one more similar oven to make the process faster, it would take *d* minutes to build the oven. While the new oven is being built, only old one can bake cakes, after the new oven is built, both ovens bake simultaneously. Arkady can't build more than one oven.
Determine if it is reasonable to build the second oven, i.e. will it decrease the minimum time needed to get *n* cakes or not. If the time needed with the second oven is the same as with one oven, then it is unreasonable.
Input Specification:
The only line contains four integers *n*, *t*, *k*, *d* (1<=≤<=*n*,<=*t*,<=*k*,<=*d*<=≤<=1<=000) — the number of cakes needed, the time needed for one oven to bake *k* cakes, the number of cakes baked at the same time, the time needed to build the second oven.
Output Specification:
If it is reasonable to build the second oven, print "YES". Otherwise print "NO".
Demo Input:
['8 6 4 5\n', '8 6 4 6\n', '10 3 11 4\n', '4 2 1 4\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n', 'YES\n']
Note:
In the first example it is possible to get 8 cakes in 12 minutes using one oven. The second oven can be built in 5 minutes, so after 6 minutes the first oven bakes 4 cakes, the second oven bakes 4 more ovens after 11 minutes. Thus, it is reasonable to build the second oven.
In the second example it doesn't matter whether we build the second oven or not, thus it takes 12 minutes to bake 8 cakes in both cases. Thus, it is unreasonable to build the second oven.
In the third example the first oven bakes 11 cakes in 3 minutes, that is more than needed 10. It is unreasonable to build the second oven, because its building takes more time that baking the needed number of cakes using the only oven. | ```python
n, t, k, d = map(int, input().split())
g = int((n + k - 1) / k)
o1, o2 = 0, d
i = 0
while i < g:
if o1 <= o2:
o1 += t
else:
o2 += t
i += 1
if max(o1, o2) < g * t:
print("YES")
else:
print("NO")
``` | 3 |
|
749 | A | Bachgold Problem | PROGRAMMING | 800 | [
"greedy",
"implementation",
"math",
"number theory"
] | null | null | Bachgold problem is very easy to formulate. Given a positive integer *n* represent it as a sum of maximum possible number of prime numbers. One can prove that such representation exists for any integer greater than 1.
Recall that integer *k* is called prime if it is greater than 1 and has exactly two positive integer divisors — 1 and *k*. | The only line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000). | The first line of the output contains a single integer *k* — maximum possible number of primes in representation.
The second line should contain *k* primes with their sum equal to *n*. You can print them in any order. If there are several optimal solution, print any of them. | [
"5\n",
"6\n"
] | [
"2\n2 3\n",
"3\n2 2 2\n"
] | none | 500 | [
{
"input": "5",
"output": "2\n2 3"
},
{
"input": "6",
"output": "3\n2 2 2"
},
{
"input": "2",
"output": "1\n2"
},
{
"input": "3",
"output": "1\n3"
},
{
"input": "99999",
"output": "49999\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "100000",
"output": "50000\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "7",
"output": "3\n2 2 3"
},
{
"input": "4",
"output": "2\n2 2"
},
{
"input": "8",
"output": "4\n2 2 2 2"
},
{
"input": "9",
"output": "4\n2 2 2 3"
},
{
"input": "99995",
"output": "49997\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99996",
"output": "49998\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "10",
"output": "5\n2 2 2 2 2"
},
{
"input": "11",
"output": "5\n2 2 2 2 3"
},
{
"input": "99997",
"output": "49998\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99998",
"output": "49999\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "12",
"output": "6\n2 2 2 2 2 2"
},
{
"input": "13",
"output": "6\n2 2 2 2 2 3"
},
{
"input": "99993",
"output": "49996\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99994",
"output": "49997\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "14",
"output": "7\n2 2 2 2 2 2 2"
},
{
"input": "15",
"output": "7\n2 2 2 2 2 2 3"
},
{
"input": "53",
"output": "26\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "57",
"output": "28\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "61",
"output": "30\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "774",
"output": "387\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "202",
"output": "101\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2"
},
{
"input": "530",
"output": "265\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "7166",
"output": "3583\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "9294",
"output": "4647\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "2422",
"output": "1211\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "15326",
"output": "7663\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "11454",
"output": "5727\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "14878",
"output": "7439\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
},
{
"input": "90672",
"output": "45336\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "99544",
"output": "49772\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "90472",
"output": "45236\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 ..."
},
{
"input": "23",
"output": "11\n2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "93",
"output": "46\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 3"
},
{
"input": "19",
"output": "9\n2 2 2 2 2 2 2 2 3"
},
{
"input": "11110",
"output": "5555\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2..."
}
] | 1,693,061,281 | 2,147,483,647 | Python 3 | OK | TESTS | 41 | 77 | 1,024,000 | n = int(input())
primes_sum = [2] * (n // 2)
if n % 2 == 1:
primes_sum[-1] = 3
print(len(primes_sum))
print(*primes_sum)
| Title: Bachgold Problem
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bachgold problem is very easy to formulate. Given a positive integer *n* represent it as a sum of maximum possible number of prime numbers. One can prove that such representation exists for any integer greater than 1.
Recall that integer *k* is called prime if it is greater than 1 and has exactly two positive integer divisors — 1 and *k*.
Input Specification:
The only line of the input contains a single integer *n* (2<=≤<=*n*<=≤<=100<=000).
Output Specification:
The first line of the output contains a single integer *k* — maximum possible number of primes in representation.
The second line should contain *k* primes with their sum equal to *n*. You can print them in any order. If there are several optimal solution, print any of them.
Demo Input:
['5\n', '6\n']
Demo Output:
['2\n2 3\n', '3\n2 2 2\n']
Note:
none | ```python
n = int(input())
primes_sum = [2] * (n // 2)
if n % 2 == 1:
primes_sum[-1] = 3
print(len(primes_sum))
print(*primes_sum)
``` | 3 |
|
152 | C | Pocket Book | PROGRAMMING | 1,400 | [
"combinatorics"
] | null | null | One day little Vasya found mom's pocket book. The book had *n* names of her friends and unusually enough, each name was exactly *m* letters long. Let's number the names from 1 to *n* in the order in which they are written.
As mom wasn't home, Vasya decided to play with names: he chose three integers *i*, *j*, *k* (1<=≤<=*i*<=<<=*j*<=≤<=*n*, 1<=≤<=*k*<=≤<=*m*), then he took names number *i* and *j* and swapped their prefixes of length *k*. For example, if we take names "CBDAD" and "AABRD" and swap their prefixes with the length of 3, the result will be names "AABAD" and "CBDRD".
You wonder how many different names Vasya can write instead of name number 1, if Vasya is allowed to perform any number of the described actions. As Vasya performs each action, he chooses numbers *i*, *j*, *k* independently from the previous moves and his choice is based entirely on his will. The sought number can be very large, so you should only find it modulo 1000000007 (109<=+<=7). | The first input line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of names and the length of each name, correspondingly. Then *n* lines contain names, each name consists of exactly *m* uppercase Latin letters. | Print the single number — the number of different names that could end up in position number 1 in the pocket book after the applying the procedures described above. Print the number modulo 1000000007 (109<=+<=7). | [
"2 3\nAAB\nBAA\n",
"4 5\nABABA\nBCGDG\nAAAAA\nYABSA\n"
] | [
"4\n",
"216\n"
] | In the first sample Vasya can get the following names in the position number 1: "AAB", "AAA", "BAA" and "BAB". | 1,500 | [
{
"input": "2 3\nAAB\nBAA",
"output": "4"
},
{
"input": "4 5\nABABA\nBCGDG\nAAAAA\nYABSA",
"output": "216"
},
{
"input": "1 1\nE",
"output": "1"
},
{
"input": "2 2\nNS\nPD",
"output": "4"
},
{
"input": "3 4\nPJKD\nNFJX\nFGFK",
"output": "81"
},
{
"input": "4 5\nSXFMY\nATHLM\nKDDQW\nZWGDS",
"output": "1024"
},
{
"input": "20 14\nJNFKBBBJYZHWQE\nLBOKZCPFNKDBJY\nXKNWGHQHIOXUPF\nDDNRUKVUGHWMXW\nMTIZFNAAFEAPHX\nIXBQOOHEULZYHU\nMRCSREUEOOMUUN\nHJTSQWKUFYZDQU\nGMCMUZCOPRVEIQ\nXBKKGGJECOBLTH\nXXHTLXCNJZJUAF\nVLJRKXXXWMTPKZ\nPTYMNPTBBCWKAD\nQYJGOBUBHMEDYE\nGTKUUVVNKAHTUI\nZNKXYZPCYLBZFP\nQCBLJTRMBDWNNE\nTDOKJOBKEOVNLZ\nFKZUITYAFJOQIM\nUWQNSGLXEEIRWF",
"output": "515139391"
},
{
"input": "5 14\nAQRXUQQNSKZPGC\nDTTKSPFGGVCLPT\nVLZQWWESCHDTAZ\nCOKOWDWDRUOMHP\nXDTRBIZTTCIDGS",
"output": "124999979"
},
{
"input": "9 23\nOILBYKHRGMPENVFNHLSIUOW\nLPJFHTUQUINAALRDGLSQUXR\nLYYJJEBNZATAFQWTDZSPUNZ\nHSJPIQKKWWERJZIEMLCZUKI\nOJYIEYDGPFWRHCMISJCCUEM\nLMGKZVFYIVDRTIHBWPCNUTG\nUBGGNCITVHAIPKXCLTSAULQ\nOWSAWUOXQDBSXXBHTLSXUVD\nUGQTIZQPBGMASRQPVPSFUWK",
"output": "454717784"
},
{
"input": "25 4\nLVKG\nMICU\nZHKW\nLFGG\nOWQO\nLCQG\nLVXU\nOUKB\nLNQX\nZJTO\nOOQX\nLVQP\nMFQB\nMRQV\nOIQH\nOPXX\nXFKU\nFCQB\nZPKH\nLVCH\nNFCU\nOVQW\nOZKU\nLFHX\nLPXO",
"output": "5733"
},
{
"input": "30 10\nUTNTGOKZYJ\nQHOUHNYZVW\nLTVGHJRZVW\nMZHYHOLZYJ\nERYEUEPZYE\nUZDBFTURYJ\nRVSMQTIZGW\nWDJQHMIRYY\nKCORHQPZYE\nRRPLFOZZVY\nJTXMFNNNYJ\nMVTGGOZZVV\nEHAFFNUZVF\nLBRNWJZNYE\nJVMOHTPZYJ\nWTARFJLZVV\nLVJCWOURVW\nLCLQFJYRVV\nQVBVGNJRYF\nNTZGHOLRYE\nMGQKHOUPYJ\nRRSSBXPZYJ\nRYCRGTLZYJ\nJRDEGNKRVW\nRZKFGHYRVG\nMDJBFNIZYG\nMPLWHXIZYE\nSRZMHMURVE\nMTEBBMRZYJ\nJPJIFOLZYM",
"output": "919913906"
},
{
"input": "40 7\nPNTVVER\nPAHTQDR\nRXMJVAS\nVIQNLYC\nILPUSVX\nYJOXQDJ\nSEFODTO\nOTJMREL\nLIQRZGD\nLBJJPOR\nRUTYHQO\nRIWEPBD\nKQUMFIB\nISTRRYH\nXBTOTGK\nRFQODEY\nHDSTZTP\nYCXFAGL\nAREGRFU\nLELZUYU\nGVABDKH\nFJAMMME\nACVULXE\nJHVPJAS\nAAQNMBX\nJJGUCXG\nOQATILQ\nNEOSHJM\nHFLWOFM\nICYEQHY\nFACGLYP\nPLLXJEQ\nDCHXYPB\nAGDDZJJ\nLSQRXTN\nHDQZXIY\nNAHDDWW\nQCMXRQN\nFDUDSZO\nHKBEVTW",
"output": "206575993"
},
{
"input": "2 2\nAA\nBB",
"output": "4"
},
{
"input": "1 10\nAAAAAAAAAA",
"output": "1"
},
{
"input": "2 8\nAAAAAAAA\nBBBBBBBB",
"output": "256"
},
{
"input": "10 10\nAAAAAAAAAA\nBBBBBBBBBB\nCCCCCCCCCC\nDDDDDDDDDD\nAAAAAAAAAA\nBBBBBBBBBB\nCCCCCCCCCC\nDDDDDDDDDD\nAAAAAAAAAA\nBBBBBBBBBB",
"output": "1048576"
},
{
"input": "1 20\nAAAAAAAAAAAAAAAAAAAA",
"output": "1"
},
{
"input": "20 1\nA\nB\nC\nD\nE\nF\nG\nA\nB\nC\nD\nE\nF\nG\nA\nB\nC\nD\nE\nF",
"output": "7"
},
{
"input": "5 60\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA\nBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBBB\nCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCC\nDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDDD\nEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEEE",
"output": "449874206"
},
{
"input": "50 4\nAAAA\nBBBB\nCCCC\nDDDD\nEEEE\nFFFF\nGGGG\nHHHH\nIIII\nJJJJ\nAAAA\nBBBB\nCCCC\nDDDD\nEEEE\nFFFF\nGGGG\nHHHH\nIIII\nJJJJ\nAAAA\nBBBB\nCCCC\nDDDD\nEEEE\nFFFF\nGGGG\nHHHH\nIIII\nJJJJ\nAAAA\nBBBB\nCCCC\nDDDD\nEEEE\nFFFF\nGGGG\nHHHH\nIIII\nJJJJ\nAAAA\nBBBB\nCCCC\nDDDD\nEEEE\nFFFF\nGGGG\nHHHH\nIIII\nJJJJ",
"output": "10000"
},
{
"input": "1 100\nAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "1"
},
{
"input": "100 1\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA\nA",
"output": "1"
},
{
"input": "100 1\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB\nA\nB",
"output": "2"
},
{
"input": "100 1\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nA\nB",
"output": "14"
},
{
"input": "100 1\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nO\nP\nQ\nR\nS\nT\nU\nV\nW\nX\nY\nZ\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nO\nP\nQ\nR\nS\nT\nU\nV\nW\nX\nY\nZ\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nO\nP\nQ\nR\nS\nT\nU\nV\nW\nX\nY\nZ\nA\nB\nC\nD\nE\nF\nG\nH\nI\nJ\nK\nL\nM\nN\nO\nP\nQ\nR\nS\nT\nU\nV",
"output": "26"
}
] | 1,685,973,273 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 6 | 122 | 2,560,000 | import sys
from math import ceil
input = sys.stdin.readline
for ii in range(1):
a,b=(map(int,input().split()))
s=[]
r=1
g={}
for o in range(b):
g[o]=[]
for i in range(a):
d=input()
for x in range(b):
g[x]+=d[x]
r=1
for i in g:
r*=len(set(g[i]))
sys.stdout.write(str(r)+'\n')
| Title: Pocket Book
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day little Vasya found mom's pocket book. The book had *n* names of her friends and unusually enough, each name was exactly *m* letters long. Let's number the names from 1 to *n* in the order in which they are written.
As mom wasn't home, Vasya decided to play with names: he chose three integers *i*, *j*, *k* (1<=≤<=*i*<=<<=*j*<=≤<=*n*, 1<=≤<=*k*<=≤<=*m*), then he took names number *i* and *j* and swapped their prefixes of length *k*. For example, if we take names "CBDAD" and "AABRD" and swap their prefixes with the length of 3, the result will be names "AABAD" and "CBDRD".
You wonder how many different names Vasya can write instead of name number 1, if Vasya is allowed to perform any number of the described actions. As Vasya performs each action, he chooses numbers *i*, *j*, *k* independently from the previous moves and his choice is based entirely on his will. The sought number can be very large, so you should only find it modulo 1000000007 (109<=+<=7).
Input Specification:
The first input line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=100) — the number of names and the length of each name, correspondingly. Then *n* lines contain names, each name consists of exactly *m* uppercase Latin letters.
Output Specification:
Print the single number — the number of different names that could end up in position number 1 in the pocket book after the applying the procedures described above. Print the number modulo 1000000007 (109<=+<=7).
Demo Input:
['2 3\nAAB\nBAA\n', '4 5\nABABA\nBCGDG\nAAAAA\nYABSA\n']
Demo Output:
['4\n', '216\n']
Note:
In the first sample Vasya can get the following names in the position number 1: "AAB", "AAA", "BAA" and "BAB". | ```python
import sys
from math import ceil
input = sys.stdin.readline
for ii in range(1):
a,b=(map(int,input().split()))
s=[]
r=1
g={}
for o in range(b):
g[o]=[]
for i in range(a):
d=input()
for x in range(b):
g[x]+=d[x]
r=1
for i in g:
r*=len(set(g[i]))
sys.stdout.write(str(r)+'\n')
``` | 0 |
|
4 | A | Watermelon | PROGRAMMING | 800 | [
"brute force",
"math"
] | A. Watermelon | 1 | 64 | One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem.
Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight. | The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys. | Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case. | [
"8\n"
] | [
"YES\n"
] | For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos). | 0 | [
{
"input": "8",
"output": "YES"
},
{
"input": "5",
"output": "NO"
},
{
"input": "4",
"output": "YES"
},
{
"input": "3",
"output": "NO"
},
{
"input": "2",
"output": "NO"
},
{
"input": "1",
"output": "NO"
},
{
"input": "7",
"output": "NO"
},
{
"input": "6",
"output": "YES"
},
{
"input": "10",
"output": "YES"
},
{
"input": "9",
"output": "NO"
},
{
"input": "53",
"output": "NO"
},
{
"input": "77",
"output": "NO"
},
{
"input": "32",
"output": "YES"
},
{
"input": "44",
"output": "YES"
},
{
"input": "98",
"output": "YES"
},
{
"input": "99",
"output": "NO"
},
{
"input": "90",
"output": "YES"
},
{
"input": "67",
"output": "NO"
},
{
"input": "100",
"output": "YES"
},
{
"input": "88",
"output": "YES"
}
] | 1,689,679,079 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 30 | 0 | W = range(1, 101)
W = int(input("Please input the weight of the watermelon: "))
if W % 2 == 0:
print("Yes.")
else:
print("No.")
| Title: Watermelon
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
One hot summer day Pete and his friend Billy decided to buy a watermelon. They chose the biggest and the ripest one, in their opinion. After that the watermelon was weighed, and the scales showed *w* kilos. They rushed home, dying of thirst, and decided to divide the berry, however they faced a hard problem.
Pete and Billy are great fans of even numbers, that's why they want to divide the watermelon in such a way that each of the two parts weighs even number of kilos, at the same time it is not obligatory that the parts are equal. The boys are extremely tired and want to start their meal as soon as possible, that's why you should help them and find out, if they can divide the watermelon in the way they want. For sure, each of them should get a part of positive weight.
Input Specification:
The first (and the only) input line contains integer number *w* (1<=≤<=*w*<=≤<=100) — the weight of the watermelon bought by the boys.
Output Specification:
Print YES, if the boys can divide the watermelon into two parts, each of them weighing even number of kilos; and NO in the opposite case.
Demo Input:
['8\n']
Demo Output:
['YES\n']
Note:
For example, the boys can divide the watermelon into two parts of 2 and 6 kilos respectively (another variant — two parts of 4 and 4 kilos). | ```python
W = range(1, 101)
W = int(input("Please input the weight of the watermelon: "))
if W % 2 == 0:
print("Yes.")
else:
print("No.")
``` | 0 |
948 | A | Protect Sheep | PROGRAMMING | 900 | [
"brute force",
"dfs and similar",
"graphs",
"implementation"
] | null | null | Bob is a farmer. He has a large pasture with many sheep. Recently, he has lost some of them due to wolf attacks. He thus decided to place some shepherd dogs in such a way that all his sheep are protected.
The pasture is a rectangle consisting of *R*<=×<=*C* cells. Each cell is either empty, contains a sheep, a wolf or a dog. Sheep and dogs always stay in place, but wolves can roam freely around the pasture, by repeatedly moving to the left, right, up or down to a neighboring cell. When a wolf enters a cell with a sheep, it consumes it. However, no wolf can enter a cell with a dog.
Initially there are no dogs. Place dogs onto the pasture in such a way that no wolf can reach any sheep, or determine that it is impossible. Note that since you have many dogs, you do not need to minimize their number. | First line contains two integers *R* (1<=≤<=*R*<=≤<=500) and *C* (1<=≤<=*C*<=≤<=500), denoting the number of rows and the numbers of columns respectively.
Each of the following *R* lines is a string consisting of exactly *C* characters, representing one row of the pasture. Here, 'S' means a sheep, 'W' a wolf and '.' an empty cell. | If it is impossible to protect all sheep, output a single line with the word "No".
Otherwise, output a line with the word "Yes". Then print *R* lines, representing the pasture after placing dogs. Again, 'S' means a sheep, 'W' a wolf, 'D' is a dog and '.' an empty space. You are not allowed to move, remove or add a sheep or a wolf.
If there are multiple solutions, you may print any of them. You don't have to minimize the number of dogs. | [
"6 6\n..S...\n..S.W.\n.S....\n..W...\n...W..\n......\n",
"1 2\nSW\n",
"5 5\n.S...\n...S.\nS....\n...S.\n.S...\n"
] | [
"Yes\n..SD..\n..SDW.\n.SD...\n.DW...\nDD.W..\n......\n",
"No\n",
"Yes\n.S...\n...S.\nS.D..\n...S.\n.S...\n"
] | In the first example, we can split the pasture into two halves, one containing wolves and one containing sheep. Note that the sheep at (2,1) is safe, as wolves cannot move diagonally.
In the second example, there are no empty spots to put dogs that would guard the lone sheep.
In the third example, there are no wolves, so the task is very easy. We put a dog in the center to observe the peacefulness of the meadow, but the solution would be correct even without him. | 500 | [
{
"input": "1 2\nSW",
"output": "No"
},
{
"input": "10 10\n....W.W.W.\n.........S\n.S.S...S..\nW.......SS\n.W..W.....\n.W...W....\nS..S...S.S\n....W...S.\n..S..S.S.S\nSS.......S",
"output": "Yes\nDDDDWDWDWD\nDDDDDDDDDS\nDSDSDDDSDD\nWDDDDDDDSS\nDWDDWDDDDD\nDWDDDWDDDD\nSDDSDDDSDS\nDDDDWDDDSD\nDDSDDSDSDS\nSSDDDDDDDS"
},
{
"input": "10 10\n....W.W.W.\n...W.....S\n.S.S...S..\nW......WSS\n.W..W.....\n.W...W....\nS..S...S.S\n...WWW..S.\n..S..S.S.S\nSS.......S",
"output": "No"
},
{
"input": "1 50\nW...S..............W.....S..S...............S...W.",
"output": "Yes\nWDDDSDDDDDDDDDDDDDDWDDDDDSDDSDDDDDDDDDDDDDDDSDDDWD"
},
{
"input": "2 4\n...S\n...W",
"output": "No"
},
{
"input": "4 2\n..\n..\n..\nSW",
"output": "No"
},
{
"input": "4 2\n..\n..\n..\nWS",
"output": "No"
},
{
"input": "2 4\n...W\n...S",
"output": "No"
},
{
"input": "50 1\nS\n.\n.\n.\n.\n.\n.\nS\n.\n.\n.\n.\n.\n.\n.\n.\nS\n.\nW\n.\nS\n.\n.\n.\n.\nS\n.\n.\n.\n.\n.\n.\n.\nW\n.\n.\n.\nW\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.\n.",
"output": "Yes\nS\nD\nD\nD\nD\nD\nD\nS\nD\nD\nD\nD\nD\nD\nD\nD\nS\nD\nW\nD\nS\nD\nD\nD\nD\nS\nD\nD\nD\nD\nD\nD\nD\nW\nD\nD\nD\nW\nD\nD\nD\nD\nD\nD\nD\nD\nD\nD\nD\nD"
},
{
"input": "4 4\nW..S\nW..S\nW..S\nW..S",
"output": "Yes\nWDDS\nWDDS\nWDDS\nWDDS"
},
{
"input": "4 4\nSSSS\n....\n....\nWWWW",
"output": "Yes\nSSSS\nDDDD\nDDDD\nWWWW"
},
{
"input": "4 4\nWWWW\n....\n....\nSSSS",
"output": "Yes\nWWWW\nDDDD\nDDDD\nSSSS"
},
{
"input": "4 4\nS..W\nS..W\nS..W\nS..W",
"output": "Yes\nSDDW\nSDDW\nSDDW\nSDDW"
},
{
"input": "1 1\n.",
"output": "Yes\nD"
},
{
"input": "1 1\nW",
"output": "Yes\nW"
},
{
"input": "1 1\nS",
"output": "Yes\nS"
},
{
"input": "4 2\n..\n..\n.W\n.S",
"output": "No"
},
{
"input": "4 2\n..\n..\n.S\n.W",
"output": "No"
},
{
"input": "4 2\n..\n..\nW.\nS.",
"output": "No"
},
{
"input": "4 2\n..\n..\nS.\nW.",
"output": "No"
},
{
"input": "2 4\n....\n..SW",
"output": "No"
},
{
"input": "2 4\n....\n..WS",
"output": "No"
},
{
"input": "1 2\nS.",
"output": "Yes\nSD"
}
] | 1,684,689,426 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 6 | 62 | 5,017,600 | R, C = list(map(int, input().split()))
grid = []
for _ in range(R):
li = list(input())
grid.append(li)
visited = [[0 for _ in range(C)] for _ in range(R)]
directions = [(1, 0), (-1, 0), (0, 1), (0, -1)]
def isBound(r, c):
return 0 <= r < R and 0 <= c < C
def search(r, c):
visited[r][c] = 1
for dr in directions:
new_row = r + dr[0]
new_col = c + dr[1]
if isBound(new_row, new_col):
if grid[new_row][new_col] == 'W':
return False
if grid[new_row][new_col] == '.':
grid[new_row][new_col] = 'D'
return True
for i in range(R):
found = False
for j in range(C):
if grid[i][j] == 'S':
if not search(i, j):
found = True
print("NO")
if found:
break
if not found:
print("YES")
for li in grid:
print(''.join(li))
| Title: Protect Sheep
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bob is a farmer. He has a large pasture with many sheep. Recently, he has lost some of them due to wolf attacks. He thus decided to place some shepherd dogs in such a way that all his sheep are protected.
The pasture is a rectangle consisting of *R*<=×<=*C* cells. Each cell is either empty, contains a sheep, a wolf or a dog. Sheep and dogs always stay in place, but wolves can roam freely around the pasture, by repeatedly moving to the left, right, up or down to a neighboring cell. When a wolf enters a cell with a sheep, it consumes it. However, no wolf can enter a cell with a dog.
Initially there are no dogs. Place dogs onto the pasture in such a way that no wolf can reach any sheep, or determine that it is impossible. Note that since you have many dogs, you do not need to minimize their number.
Input Specification:
First line contains two integers *R* (1<=≤<=*R*<=≤<=500) and *C* (1<=≤<=*C*<=≤<=500), denoting the number of rows and the numbers of columns respectively.
Each of the following *R* lines is a string consisting of exactly *C* characters, representing one row of the pasture. Here, 'S' means a sheep, 'W' a wolf and '.' an empty cell.
Output Specification:
If it is impossible to protect all sheep, output a single line with the word "No".
Otherwise, output a line with the word "Yes". Then print *R* lines, representing the pasture after placing dogs. Again, 'S' means a sheep, 'W' a wolf, 'D' is a dog and '.' an empty space. You are not allowed to move, remove or add a sheep or a wolf.
If there are multiple solutions, you may print any of them. You don't have to minimize the number of dogs.
Demo Input:
['6 6\n..S...\n..S.W.\n.S....\n..W...\n...W..\n......\n', '1 2\nSW\n', '5 5\n.S...\n...S.\nS....\n...S.\n.S...\n']
Demo Output:
['Yes\n..SD..\n..SDW.\n.SD...\n.DW...\nDD.W..\n......\n', 'No\n', 'Yes\n.S...\n...S.\nS.D..\n...S.\n.S...\n']
Note:
In the first example, we can split the pasture into two halves, one containing wolves and one containing sheep. Note that the sheep at (2,1) is safe, as wolves cannot move diagonally.
In the second example, there are no empty spots to put dogs that would guard the lone sheep.
In the third example, there are no wolves, so the task is very easy. We put a dog in the center to observe the peacefulness of the meadow, but the solution would be correct even without him. | ```python
R, C = list(map(int, input().split()))
grid = []
for _ in range(R):
li = list(input())
grid.append(li)
visited = [[0 for _ in range(C)] for _ in range(R)]
directions = [(1, 0), (-1, 0), (0, 1), (0, -1)]
def isBound(r, c):
return 0 <= r < R and 0 <= c < C
def search(r, c):
visited[r][c] = 1
for dr in directions:
new_row = r + dr[0]
new_col = c + dr[1]
if isBound(new_row, new_col):
if grid[new_row][new_col] == 'W':
return False
if grid[new_row][new_col] == '.':
grid[new_row][new_col] = 'D'
return True
for i in range(R):
found = False
for j in range(C):
if grid[i][j] == 'S':
if not search(i, j):
found = True
print("NO")
if found:
break
if not found:
print("YES")
for li in grid:
print(''.join(li))
``` | 0 |
|
909 | A | Generate Login | PROGRAMMING | 1,000 | [
"brute force",
"greedy",
"sortings"
] | null | null | The preferred way to generate user login in Polygon is to concatenate a prefix of the user's first name and a prefix of their last name, in that order. Each prefix must be non-empty, and any of the prefixes can be the full name. Typically there are multiple possible logins for each person.
You are given the first and the last name of a user. Return the alphabetically earliest login they can get (regardless of other potential Polygon users).
As a reminder, a prefix of a string *s* is its substring which occurs at the beginning of *s*: "a", "ab", "abc" etc. are prefixes of string "{abcdef}" but "b" and 'bc" are not. A string *a* is alphabetically earlier than a string *b*, if *a* is a prefix of *b*, or *a* and *b* coincide up to some position, and then *a* has a letter that is alphabetically earlier than the corresponding letter in *b*: "a" and "ab" are alphabetically earlier than "ac" but "b" and "ba" are alphabetically later than "ac". | The input consists of a single line containing two space-separated strings: the first and the last names. Each character of each string is a lowercase English letter. The length of each string is between 1 and 10, inclusive. | Output a single string — alphabetically earliest possible login formed from these names. The output should be given in lowercase as well. | [
"harry potter\n",
"tom riddle\n"
] | [
"hap\n",
"tomr\n"
] | none | 500 | [
{
"input": "harry potter",
"output": "hap"
},
{
"input": "tom riddle",
"output": "tomr"
},
{
"input": "a qdpinbmcrf",
"output": "aq"
},
{
"input": "wixjzniiub ssdfodfgap",
"output": "wis"
},
{
"input": "z z",
"output": "zz"
},
{
"input": "ertuyivhfg v",
"output": "ertuv"
},
{
"input": "asdfghjkli ware",
"output": "asdfghjkliw"
},
{
"input": "udggmyop ze",
"output": "udggmyopz"
},
{
"input": "fapkdme rtzxovx",
"output": "fapkdmer"
},
{
"input": "mybiqxmnqq l",
"output": "ml"
},
{
"input": "dtbqya fyyymv",
"output": "df"
},
{
"input": "fyclu zokbxiahao",
"output": "fycluz"
},
{
"input": "qngatnviv rdych",
"output": "qngar"
},
{
"input": "ttvnhrnng lqkfulhrn",
"output": "tl"
},
{
"input": "fya fgx",
"output": "ff"
},
{
"input": "nuis zvjjqlre",
"output": "nuisz"
},
{
"input": "ly qtsmze",
"output": "lq"
},
{
"input": "d kgfpjsurfw",
"output": "dk"
},
{
"input": "lwli ewrpu",
"output": "le"
},
{
"input": "rr wldsfubcs",
"output": "rrw"
},
{
"input": "h qart",
"output": "hq"
},
{
"input": "vugvblnzx kqdwdulm",
"output": "vk"
},
{
"input": "xohesmku ef",
"output": "xe"
},
{
"input": "twvvsl wtcyawv",
"output": "tw"
},
{
"input": "obljndajv q",
"output": "obljndajq"
},
{
"input": "jjxwj kxccwx",
"output": "jjk"
},
{
"input": "sk fftzmv",
"output": "sf"
},
{
"input": "cgpegngs aufzxkyyrw",
"output": "ca"
},
{
"input": "reyjzjdvq skuch",
"output": "res"
},
{
"input": "ardaae mxgdulijf",
"output": "am"
},
{
"input": "bgopsdfji uaps",
"output": "bgopsdfjiu"
},
{
"input": "amolfed pun",
"output": "amolfedp"
},
{
"input": "badkiln yort",
"output": "badkilny"
},
{
"input": "aaaaaaaaaz york",
"output": "aaaaaaaaay"
},
{
"input": "bbbbcbbbbd c",
"output": "bbbbc"
},
{
"input": "aa ab",
"output": "aa"
},
{
"input": "ab b",
"output": "ab"
},
{
"input": "aaaaa ab",
"output": "aa"
},
{
"input": "aa a",
"output": "aa"
},
{
"input": "aba b",
"output": "ab"
},
{
"input": "aaaaaaa aaaaaa",
"output": "aa"
},
{
"input": "a a",
"output": "aa"
},
{
"input": "a aa",
"output": "aa"
},
{
"input": "a b",
"output": "ab"
},
{
"input": "b a",
"output": "ba"
},
{
"input": "z a",
"output": "za"
},
{
"input": "aaa a",
"output": "aa"
},
{
"input": "aa aa",
"output": "aa"
},
{
"input": "a aaa",
"output": "aa"
},
{
"input": "aaaaaaaaaa aaaaaaaaaa",
"output": "aa"
},
{
"input": "aaaaaaaaaa a",
"output": "aa"
},
{
"input": "a aaaaaaaaaa",
"output": "aa"
},
{
"input": "zzaa b",
"output": "zb"
},
{
"input": "ca cf",
"output": "cac"
},
{
"input": "abhi ia",
"output": "abhi"
},
{
"input": "aaaa aaaab",
"output": "aa"
},
{
"input": "aar raa",
"output": "aar"
},
{
"input": "harry hotter",
"output": "hah"
},
{
"input": "aaaaaaa a",
"output": "aa"
},
{
"input": "apple pie",
"output": "ap"
},
{
"input": "aaa aaa",
"output": "aa"
},
{
"input": "kabc buba",
"output": "kab"
},
{
"input": "asd ss",
"output": "as"
},
{
"input": "bbb b",
"output": "bb"
}
] | 1,514,395,082 | 2,582 | Python 3 | OK | TESTS | 64 | 78 | 5,529,600 | def getprfx(s):
tab = [s[0]]
for i in range(1, len(s)):
x = tab[i-1] + s[i]
tab.append(x)
return tab
n, m = input().split()
a, b = getprfx(n), getprfx(m)
mn = a[0] + b[0]
for i in a:
for j in b:
if i+j < mn:
mn = i+j
print(mn) | Title: Generate Login
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The preferred way to generate user login in Polygon is to concatenate a prefix of the user's first name and a prefix of their last name, in that order. Each prefix must be non-empty, and any of the prefixes can be the full name. Typically there are multiple possible logins for each person.
You are given the first and the last name of a user. Return the alphabetically earliest login they can get (regardless of other potential Polygon users).
As a reminder, a prefix of a string *s* is its substring which occurs at the beginning of *s*: "a", "ab", "abc" etc. are prefixes of string "{abcdef}" but "b" and 'bc" are not. A string *a* is alphabetically earlier than a string *b*, if *a* is a prefix of *b*, or *a* and *b* coincide up to some position, and then *a* has a letter that is alphabetically earlier than the corresponding letter in *b*: "a" and "ab" are alphabetically earlier than "ac" but "b" and "ba" are alphabetically later than "ac".
Input Specification:
The input consists of a single line containing two space-separated strings: the first and the last names. Each character of each string is a lowercase English letter. The length of each string is between 1 and 10, inclusive.
Output Specification:
Output a single string — alphabetically earliest possible login formed from these names. The output should be given in lowercase as well.
Demo Input:
['harry potter\n', 'tom riddle\n']
Demo Output:
['hap\n', 'tomr\n']
Note:
none | ```python
def getprfx(s):
tab = [s[0]]
for i in range(1, len(s)):
x = tab[i-1] + s[i]
tab.append(x)
return tab
n, m = input().split()
a, b = getprfx(n), getprfx(m)
mn = a[0] + b[0]
for i in a:
for j in b:
if i+j < mn:
mn = i+j
print(mn)
``` | 3 |
|
9 | A | Die Roll | PROGRAMMING | 800 | [
"math",
"probabilities"
] | A. Die Roll | 1 | 64 | Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win. | The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls. | Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1». | [
"4 2\n"
] | [
"1/2\n"
] | Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points. | 0 | [
{
"input": "4 2",
"output": "1/2"
},
{
"input": "1 1",
"output": "1/1"
},
{
"input": "1 2",
"output": "5/6"
},
{
"input": "1 3",
"output": "2/3"
},
{
"input": "1 4",
"output": "1/2"
},
{
"input": "1 5",
"output": "1/3"
},
{
"input": "1 6",
"output": "1/6"
},
{
"input": "2 1",
"output": "5/6"
},
{
"input": "2 2",
"output": "5/6"
},
{
"input": "2 3",
"output": "2/3"
},
{
"input": "2 4",
"output": "1/2"
},
{
"input": "2 5",
"output": "1/3"
},
{
"input": "2 6",
"output": "1/6"
},
{
"input": "3 1",
"output": "2/3"
},
{
"input": "3 2",
"output": "2/3"
},
{
"input": "3 3",
"output": "2/3"
},
{
"input": "3 4",
"output": "1/2"
},
{
"input": "3 5",
"output": "1/3"
},
{
"input": "3 6",
"output": "1/6"
},
{
"input": "4 1",
"output": "1/2"
},
{
"input": "4 3",
"output": "1/2"
},
{
"input": "4 4",
"output": "1/2"
},
{
"input": "4 5",
"output": "1/3"
},
{
"input": "4 6",
"output": "1/6"
},
{
"input": "5 1",
"output": "1/3"
},
{
"input": "5 2",
"output": "1/3"
},
{
"input": "5 3",
"output": "1/3"
},
{
"input": "5 4",
"output": "1/3"
},
{
"input": "5 5",
"output": "1/3"
},
{
"input": "5 6",
"output": "1/6"
},
{
"input": "6 1",
"output": "1/6"
},
{
"input": "6 2",
"output": "1/6"
},
{
"input": "6 3",
"output": "1/6"
},
{
"input": "6 4",
"output": "1/6"
},
{
"input": "6 5",
"output": "1/6"
},
{
"input": "6 6",
"output": "1/6"
}
] | 1,488,779,264 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 122 | 5,836,800 | from fractions import Fraction
d=int(input(''))
a=int(input(''))
j=6
if d>=4 or a>=4:
print ('1/2')
else:
if d==1 and a==1:
print('1/1')
elif d>a:
print (Fraction(6-d,j))
elif d<a:
print( Fraction(6-a,j))
else:
print (Fraction(6-a+1,j))
| Title: Die Roll
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Yakko, Wakko and Dot, world-famous animaniacs, decided to rest from acting in cartoons, and take a leave to travel a bit. Yakko dreamt to go to Pennsylvania, his Motherland and the Motherland of his ancestors. Wakko thought about Tasmania, its beaches, sun and sea. Dot chose Transylvania as the most mysterious and unpredictable place.
But to their great regret, the leave turned to be very short, so it will be enough to visit one of the three above named places. That's why Yakko, as the cleverest, came up with a truly genius idea: let each of the three roll an ordinary six-sided die, and the one with the highest amount of points will be the winner, and will take the other two to the place of his/her dreams.
Yakko thrown a die and got Y points, Wakko — W points. It was Dot's turn. But she didn't hurry. Dot wanted to know for sure what were her chances to visit Transylvania.
It is known that Yakko and Wakko are true gentlemen, that's why if they have the same amount of points with Dot, they will let Dot win.
Input Specification:
The only line of the input file contains two natural numbers Y and W — the results of Yakko's and Wakko's die rolls.
Output Specification:
Output the required probability in the form of irreducible fraction in format «A/B», where A — the numerator, and B — the denominator. If the required probability equals to zero, output «0/1». If the required probability equals to 1, output «1/1».
Demo Input:
['4 2\n']
Demo Output:
['1/2\n']
Note:
Dot will go to Transylvania, if she is lucky to roll 4, 5 or 6 points. | ```python
from fractions import Fraction
d=int(input(''))
a=int(input(''))
j=6
if d>=4 or a>=4:
print ('1/2')
else:
if d==1 and a==1:
print('1/1')
elif d>a:
print (Fraction(6-d,j))
elif d<a:
print( Fraction(6-a,j))
else:
print (Fraction(6-a+1,j))
``` | -1 |
995 | C | Leaving the Bar | PROGRAMMING | 2,300 | [
"brute force",
"data structures",
"geometry",
"greedy",
"math",
"sortings"
] | null | null | For a vector $\vec{v} = (x, y)$, define $|v| = \sqrt{x^2 + y^2}$.
Allen had a bit too much to drink at the bar, which is at the origin. There are $n$ vectors $\vec{v_1}, \vec{v_2}, \cdots, \vec{v_n}$. Allen will make $n$ moves. As Allen's sense of direction is impaired, during the $i$-th move he will either move in the direction $\vec{v_i}$ or $-\vec{v_i}$. In other words, if his position is currently $p = (x, y)$, he will either move to $p + \vec{v_i}$ or $p - \vec{v_i}$.
Allen doesn't want to wander too far from home (which happens to also be the bar). You need to help him figure out a sequence of moves (a sequence of signs for the vectors) such that his final position $p$ satisfies $|p| \le 1.5 \cdot 10^6$ so that he can stay safe. | The first line contains a single integer $n$ ($1 \le n \le 10^5$) — the number of moves.
Each of the following lines contains two space-separated integers $x_i$ and $y_i$, meaning that $\vec{v_i} = (x_i, y_i)$. We have that $|v_i| \le 10^6$ for all $i$. | Output a single line containing $n$ integers $c_1, c_2, \cdots, c_n$, each of which is either $1$ or $-1$. Your solution is correct if the value of $p = \sum_{i = 1}^n c_i \vec{v_i}$, satisfies $|p| \le 1.5 \cdot 10^6$.
It can be shown that a solution always exists under the given constraints. | [
"3\n999999 0\n0 999999\n999999 0\n",
"1\n-824590 246031\n",
"8\n-67761 603277\n640586 -396671\n46147 -122580\n569609 -2112\n400 914208\n131792 309779\n-850150 -486293\n5272 721899\n"
] | [
"1 1 -1 \n",
"1 \n",
"1 1 1 1 1 1 1 -1 \n"
] | none | 1,500 | [
{
"input": "3\n999999 0\n0 999999\n999999 0",
"output": "1 1 -1 "
},
{
"input": "1\n-824590 246031",
"output": "1 "
},
{
"input": "8\n-67761 603277\n640586 -396671\n46147 -122580\n569609 -2112\n400 914208\n131792 309779\n-850150 -486293\n5272 721899",
"output": "1 1 1 1 1 1 1 -1 "
},
{
"input": "6\n1000000 0\n1000000 0\n-1000000 0\n0 1000000\n0 -1000000\n0 -1000000",
"output": "1 1 1 1 1 1 "
},
{
"input": "8\n-411248 143802\n300365 629658\n363219 343742\n396148 -94037\n-722124 467785\n-178147 -931253\n265458 73307\n-621502 -709713",
"output": "1 1 1 1 1 1 1 -1 "
},
{
"input": "3\n1000000 0\n0 999999\n600000 -600000",
"output": "-1 1 1 "
},
{
"input": "5\n140239 46311\n399464 -289055\n-540174 823360\n538102 -373313\n326189 933934",
"output": "1 1 1 1 -1 "
},
{
"input": "3\n1000000 0\n0 999999\n300000 -300000",
"output": "1 1 -1 "
},
{
"input": "9\n1000000 0\n0 -999999\n600000 600000\n600000 600000\n600000 600000\n-600000 -600000\n600000 600000\n600000 600000\n-700000 710000",
"output": "1 1 1 -1 1 1 1 -1 1 "
},
{
"input": "2\n1 999999\n1 -999999",
"output": "1 1 "
},
{
"input": "2\n999999 1\n999999 -1",
"output": "1 -1 "
},
{
"input": "2\n-1 999999\n-1 -999999",
"output": "1 1 "
},
{
"input": "2\n-999999 -1\n-999999 1",
"output": "1 -1 "
},
{
"input": "2\n999999 1\n-999999 1",
"output": "1 1 "
},
{
"input": "2\n999999 -1\n-999999 -1",
"output": "1 1 "
},
{
"input": "2\n1 999999\n-1 999999",
"output": "1 -1 "
},
{
"input": "2\n1 -999999\n-1 -999999",
"output": "1 -1 "
},
{
"input": "4\n1000000 0\n-1 999999\n600000 -600000\n0 0",
"output": "-1 1 1 1 "
},
{
"input": "2\n999999 -1\n-1 999999",
"output": "1 1 "
}
] | 1,529,864,525 | 6,425 | Python 3 | WRONG_ANSWER | TESTS | 50 | 639 | 13,004,800 | n = int(input())
res = []
ta, tb = 0, 0
for _ in range(n):
a, b = [int(x) for x in input().split()]
ta += a
tb += b
res.append((a, b))
def norm(x):
return x[0] ** 2 + x[1] ** 2
def add(x, y):
return (x[0] + y[0], x[1] + y[1])
def sub(x, y):
return (x[0] - y[0], x[1] - y[1])
target = 2.25 * 10 ** 12
ans = [1 for _ in range(n)]
v = (ta, tb)
cur = norm(v)
for i, v2 in enumerate(res):
v2 = (2*v2[0], 2*v2[1])
if norm(sub(v, v2)) < cur:
v = sub(v, v2)
cur = norm(v)
ans[i] = -1
print(" ".join(map(str, ans)))
| Title: Leaving the Bar
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
For a vector $\vec{v} = (x, y)$, define $|v| = \sqrt{x^2 + y^2}$.
Allen had a bit too much to drink at the bar, which is at the origin. There are $n$ vectors $\vec{v_1}, \vec{v_2}, \cdots, \vec{v_n}$. Allen will make $n$ moves. As Allen's sense of direction is impaired, during the $i$-th move he will either move in the direction $\vec{v_i}$ or $-\vec{v_i}$. In other words, if his position is currently $p = (x, y)$, he will either move to $p + \vec{v_i}$ or $p - \vec{v_i}$.
Allen doesn't want to wander too far from home (which happens to also be the bar). You need to help him figure out a sequence of moves (a sequence of signs for the vectors) such that his final position $p$ satisfies $|p| \le 1.5 \cdot 10^6$ so that he can stay safe.
Input Specification:
The first line contains a single integer $n$ ($1 \le n \le 10^5$) — the number of moves.
Each of the following lines contains two space-separated integers $x_i$ and $y_i$, meaning that $\vec{v_i} = (x_i, y_i)$. We have that $|v_i| \le 10^6$ for all $i$.
Output Specification:
Output a single line containing $n$ integers $c_1, c_2, \cdots, c_n$, each of which is either $1$ or $-1$. Your solution is correct if the value of $p = \sum_{i = 1}^n c_i \vec{v_i}$, satisfies $|p| \le 1.5 \cdot 10^6$.
It can be shown that a solution always exists under the given constraints.
Demo Input:
['3\n999999 0\n0 999999\n999999 0\n', '1\n-824590 246031\n', '8\n-67761 603277\n640586 -396671\n46147 -122580\n569609 -2112\n400 914208\n131792 309779\n-850150 -486293\n5272 721899\n']
Demo Output:
['1 1 -1 \n', '1 \n', '1 1 1 1 1 1 1 -1 \n']
Note:
none | ```python
n = int(input())
res = []
ta, tb = 0, 0
for _ in range(n):
a, b = [int(x) for x in input().split()]
ta += a
tb += b
res.append((a, b))
def norm(x):
return x[0] ** 2 + x[1] ** 2
def add(x, y):
return (x[0] + y[0], x[1] + y[1])
def sub(x, y):
return (x[0] - y[0], x[1] - y[1])
target = 2.25 * 10 ** 12
ans = [1 for _ in range(n)]
v = (ta, tb)
cur = norm(v)
for i, v2 in enumerate(res):
v2 = (2*v2[0], 2*v2[1])
if norm(sub(v, v2)) < cur:
v = sub(v, v2)
cur = norm(v)
ans[i] = -1
print(" ".join(map(str, ans)))
``` | 0 |
|
16 | C | Monitor | PROGRAMMING | 1,800 | [
"binary search",
"number theory"
] | C. Monitor | 0 | 64 | Reca company makes monitors, the most popular of their models is AB999 with the screen size *a*<=×<=*b* centimeters. Because of some production peculiarities a screen parameters are integer numbers. Recently the screen sides ratio *x*:<=*y* became popular with users. That's why the company wants to reduce monitor AB999 size so that its screen sides ratio becomes *x*:<=*y*, at the same time they want its total area to be maximal of all possible variants. Your task is to find the screen parameters of the reduced size model, or find out that such a reduction can't be performed. | The first line of the input contains 4 integers — *a*, *b*, *x* and *y* (1<=≤<=*a*,<=*b*,<=*x*,<=*y*<=≤<=2·109). | If the answer exists, output 2 positive integers — screen parameters of the reduced size model. Output 0 0 otherwise. | [
"800 600 4 3\n",
"1920 1200 16 9\n",
"1 1 1 2\n"
] | [
"800 600\n",
"1920 1080\n",
"0 0\n"
] | none | 0 | [
{
"input": "800 600 4 3",
"output": "800 600"
},
{
"input": "1920 1200 16 9",
"output": "1920 1080"
},
{
"input": "1 1 1 2",
"output": "0 0"
},
{
"input": "1002105126 227379125 179460772 1295256518",
"output": "0 0"
},
{
"input": "625166755 843062051 1463070160 1958300154",
"output": "0 0"
},
{
"input": "248228385 1458744978 824699604 1589655888",
"output": "206174901 397413972"
},
{
"input": "186329049 1221011622 90104472 1769702163",
"output": "60069648 1179801442"
},
{
"input": "511020182 242192314 394753578 198572007",
"output": "394753578 198572007"
},
{
"input": "134081812 857875240 82707261 667398699",
"output": "105411215 850606185"
},
{
"input": "721746595 799202881 143676564 380427290",
"output": "287353128 760854580"
},
{
"input": "912724694 1268739154 440710604 387545692",
"output": "881421208 775091384"
},
{
"input": "1103702793 1095784840 788679477 432619528",
"output": "788679477 432619528"
},
{
"input": "548893795 861438648 131329677 177735812",
"output": "525318708 710943248"
},
{
"input": "652586118 1793536161 127888702 397268645",
"output": "511554808 1589074580"
},
{
"input": "756278440 578150025 96644319 26752094",
"output": "676510233 187264658"
},
{
"input": "859970763 1510247537 37524734 97452508",
"output": "562871010 1461787620"
},
{
"input": "547278097 1977241684 51768282 183174370",
"output": "543566961 1923330885"
},
{
"input": "62256611 453071697 240966 206678",
"output": "62169228 53322924"
},
{
"input": "1979767797 878430446 5812753 3794880",
"output": "1342745943 876617280"
},
{
"input": "1143276347 1875662241 178868040 116042960",
"output": "1140283755 739773870"
},
{
"input": "435954880 1740366589 19415065 185502270",
"output": "182099920 1739883360"
},
{
"input": "664035593 983601098 4966148 2852768",
"output": "664032908 381448928"
},
{
"input": "1461963719 350925487 135888396 83344296",
"output": "572153868 350918568"
},
{
"input": "754199095 348965411 161206703 67014029",
"output": "754119492 313489356"
},
{
"input": "166102153 494841162 14166516 76948872",
"output": "91096406 494812252"
},
{
"input": "1243276346 1975662240 38441120 291740200",
"output": "259477560 1969246350"
},
{
"input": "535954879 1840366588 26278959 73433046",
"output": "535849118 1497358892"
},
{
"input": "764035592 1083601097 1192390 7267738",
"output": "177777265 1083570463"
},
{
"input": "1561963718 450925486 475523188 136236856",
"output": "1561914768 447486816"
},
{
"input": "854199094 448965410 364102983 125971431",
"output": "853687785 295356745"
},
{
"input": "266102152 594841161 15854566 13392106",
"output": "266043102 224722482"
},
{
"input": "1 1 2 1",
"output": "0 0"
},
{
"input": "2000000000 2000000000 1 1999999999",
"output": "1 1999999999"
},
{
"input": "2000000000 2000000000 1999999999 1",
"output": "1999999999 1"
},
{
"input": "2000000000 2000000000 2 1999999999",
"output": "2 1999999999"
},
{
"input": "1000000000 1000000000 999999999 2",
"output": "999999999 2"
},
{
"input": "2000000000 2000000000 1999999999 2",
"output": "1999999999 2"
},
{
"input": "2000000000 2000000000 1999999999 1999999998",
"output": "1999999999 1999999998"
},
{
"input": "2000000000 2000000000 1999999998 1999999999",
"output": "1999999998 1999999999"
}
] | 1,436,608,596 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 3 | 500 | 0 | def inp(s):
j = 0
a = []
for i in range(len(s)):
if s[i] == " ":
a.append(int(s[j:i]))
j = i+1
if i == len(s)-1:
a.append(int(s[j:]))
return a
s = input()
a = inp(s)
p = 0
q = 0
for i in range(a[0],-1,-1):
x = (i*a[3])/a[2]
if x%1 == 0:
p = i
break
for j in range(a[1],-1,-1):
y = (i*a[2])/a[3]
if y%1 == 0:
q = j
break
if x <= a[1] and y<= a[0]:
if q*y > p*x:
print (str(int(y))+" "+str(q))
else:
print (str(p)+" "+str(int(x)))
elif x <= a[1] and y > a[0]:
print (str(int(p))+" "+str(int(x)))
elif x > a[1] and y <= a[0]:
print (str(int(y))+" "+str(q))
elif x == 0 and y == 0:
print ("0 0")
else:
print ("0 0")
| Title: Monitor
Time Limit: 0 seconds
Memory Limit: 64 megabytes
Problem Description:
Reca company makes monitors, the most popular of their models is AB999 with the screen size *a*<=×<=*b* centimeters. Because of some production peculiarities a screen parameters are integer numbers. Recently the screen sides ratio *x*:<=*y* became popular with users. That's why the company wants to reduce monitor AB999 size so that its screen sides ratio becomes *x*:<=*y*, at the same time they want its total area to be maximal of all possible variants. Your task is to find the screen parameters of the reduced size model, or find out that such a reduction can't be performed.
Input Specification:
The first line of the input contains 4 integers — *a*, *b*, *x* and *y* (1<=≤<=*a*,<=*b*,<=*x*,<=*y*<=≤<=2·109).
Output Specification:
If the answer exists, output 2 positive integers — screen parameters of the reduced size model. Output 0 0 otherwise.
Demo Input:
['800 600 4 3\n', '1920 1200 16 9\n', '1 1 1 2\n']
Demo Output:
['800 600\n', '1920 1080\n', '0 0\n']
Note:
none | ```python
def inp(s):
j = 0
a = []
for i in range(len(s)):
if s[i] == " ":
a.append(int(s[j:i]))
j = i+1
if i == len(s)-1:
a.append(int(s[j:]))
return a
s = input()
a = inp(s)
p = 0
q = 0
for i in range(a[0],-1,-1):
x = (i*a[3])/a[2]
if x%1 == 0:
p = i
break
for j in range(a[1],-1,-1):
y = (i*a[2])/a[3]
if y%1 == 0:
q = j
break
if x <= a[1] and y<= a[0]:
if q*y > p*x:
print (str(int(y))+" "+str(q))
else:
print (str(p)+" "+str(int(x)))
elif x <= a[1] and y > a[0]:
print (str(int(p))+" "+str(int(x)))
elif x > a[1] and y <= a[0]:
print (str(int(y))+" "+str(q))
elif x == 0 and y == 0:
print ("0 0")
else:
print ("0 0")
``` | 0 |
71 | A | Way Too Long Words | PROGRAMMING | 800 | [
"strings"
] | A. Way Too Long Words | 1 | 256 | Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters. | Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data. | [
"4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n"
] | [
"word\nl10n\ni18n\np43s\n"
] | none | 500 | [
{
"input": "4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis",
"output": "word\nl10n\ni18n\np43s"
},
{
"input": "5\nabcdefgh\nabcdefghi\nabcdefghij\nabcdefghijk\nabcdefghijklm",
"output": "abcdefgh\nabcdefghi\nabcdefghij\na9k\na11m"
},
{
"input": "3\nnjfngnrurunrgunrunvurn\njfvnjfdnvjdbfvsbdubruvbubvkdb\nksdnvidnviudbvibd",
"output": "n20n\nj27b\nk15d"
},
{
"input": "1\ntcyctkktcctrcyvbyiuhihhhgyvyvyvyvjvytchjckt",
"output": "t41t"
},
{
"input": "24\nyou\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nunofficially\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings",
"output": "you\nare\nregistered\nfor\npractice\nyou\ncan\nsolve\nproblems\nu10y\nresults\ncan\nbe\nfound\nin\nthe\ncontest\nstatus\nand\nin\nthe\nbottom\nof\nstandings"
},
{
"input": "1\na",
"output": "a"
},
{
"input": "26\na\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz",
"output": "a\nb\nc\nd\ne\nf\ng\nh\ni\nj\nk\nl\nm\nn\no\np\nq\nr\ns\nt\nu\nv\nw\nx\ny\nz"
},
{
"input": "1\nabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij",
"output": "a98j"
},
{
"input": "10\ngyartjdxxlcl\nfzsck\nuidwu\nxbymclornemdmtj\nilppyoapitawgje\ncibzc\ndrgbeu\nhezplmsdekhhbo\nfeuzlrimbqbytdu\nkgdco",
"output": "g10l\nfzsck\nuidwu\nx13j\ni13e\ncibzc\ndrgbeu\nh12o\nf13u\nkgdco"
},
{
"input": "20\nlkpmx\nkovxmxorlgwaomlswjxlpnbvltfv\nhykasjxqyjrmybejnmeumzha\ntuevlumpqbbhbww\nqgqsphvrmupxxc\ntrissbaf\nqfgrlinkzvzqdryckaizutd\nzzqtoaxkvwoscyx\noswytrlnhpjvvnwookx\nlpuzqgec\ngyzqfwxggtvpjhzmzmdw\nrlxjgmvdftvrmvbdwudra\nvsntnjpepnvdaxiporggmglhagv\nxlvcqkqgcrbgtgglj\nlyxwxbiszyhlsrgzeedzprbmcpduvq\nyrmqqvrkqskqukzqrwukpsifgtdc\nxpuohcsjhhuhvr\nvvlfrlxpvqejngwrbfbpmqeirxlw\nsvmasocxdvadmaxtrpakysmeaympy\nyuflqboqfdt",
"output": "lkpmx\nk26v\nh22a\nt13w\nq12c\ntrissbaf\nq21d\nz13x\no17x\nlpuzqgec\ng18w\nr19a\nv25v\nx15j\nl28q\ny26c\nx12r\nv26w\ns27y\ny9t"
},
{
"input": "100\nm\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr",
"output": "m\nz\ns\nv\nd\nr\nv\ny\ny\ne\np\nt\nc\na\nn\nm\np\ng\ni\nj\nc\na\nb\nq\ne\nn\nv\no\nk\nx\nf\ni\nl\na\nq\nr\nu\nb\ns\nl\nc\nl\ne\nv\nj\nm\nx\nb\na\nq\nb\na\nf\nj\nv\nm\nq\nc\nt\nt\nn\nx\no\ny\nr\nu\nh\nm\nj\np\nj\nq\nz\ns\nj\no\ng\nc\nm\nn\no\nm\nr\no\ns\nt\nh\nr\np\nk\nb\nz\ng\no\nc\nc\nz\nz\ng\nr"
}
] | 1,670,213,640 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 30 | 0 | n = int(input())
w = list()
for i in range(n):
word = input()
w.append(word)
for j in range(n):
l = len(w[j])
if l>10:
print(w[j][0]+str(l)+w[j][-1])
else:
print(w)
| Title: Way Too Long Words
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Sometimes some words like "localization" or "internationalization" are so long that writing them many times in one text is quite tiresome.
Let's consider a word too long, if its length is strictly more than 10 characters. All too long words should be replaced with a special abbreviation.
This abbreviation is made like this: we write down the first and the last letter of a word and between them we write the number of letters between the first and the last letters. That number is in decimal system and doesn't contain any leading zeroes.
Thus, "localization" will be spelt as "l10n", and "internationalization» will be spelt as "i18n".
You are suggested to automatize the process of changing the words with abbreviations. At that all too long words should be replaced by the abbreviation and the words that are not too long should not undergo any changes.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Each of the following *n* lines contains one word. All the words consist of lowercase Latin letters and possess the lengths of from 1 to 100 characters.
Output Specification:
Print *n* lines. The *i*-th line should contain the result of replacing of the *i*-th word from the input data.
Demo Input:
['4\nword\nlocalization\ninternationalization\npneumonoultramicroscopicsilicovolcanoconiosis\n']
Demo Output:
['word\nl10n\ni18n\np43s\n']
Note:
none | ```python
n = int(input())
w = list()
for i in range(n):
word = input()
w.append(word)
for j in range(n):
l = len(w[j])
if l>10:
print(w[j][0]+str(l)+w[j][-1])
else:
print(w)
``` | 0 |
355 | A | Vasya and Digital Root | PROGRAMMING | 1,100 | [
"constructive algorithms",
"implementation"
] | null | null | Vasya has recently found out what a digital root of a number is and he decided to share his knowledge with you.
Let's assume that *S*(*n*) is the sum of digits of number *n*, for example, *S*(4098)<==<=4<=+<=0<=+<=9<=+<=8<==<=21. Then the digital root of number *n* equals to:
1. *dr*(*n*)<==<=*S*(*n*), if *S*(*n*)<=<<=10; 1. *dr*(*n*)<==<=*dr*(<=*S*(*n*)<=), if *S*(*n*)<=≥<=10.
For example, *dr*(4098)<=<==<=<=*dr*(21)<=<==<=<=3.
Vasya is afraid of large numbers, so the numbers he works with are at most 101000. For all such numbers, he has proved that *dr*(*n*)<=<==<=<=*S*(<=*S*(<=*S*(<=*S*(*n*)<=)<=)<=) (*n*<=≤<=101000).
Now Vasya wants to quickly find numbers with the given digital root. The problem is, he hasn't learned how to do that and he asked you to help him. You task is, given numbers *k* and *d*, find the number consisting of exactly *k* digits (the leading zeroes are not allowed), with digital root equal to *d*, or else state that such number does not exist. | The first line contains two integers *k* and *d* (1<=≤<=*k*<=≤<=1000; 0<=≤<=*d*<=≤<=9). | In a single line print either any number that meets the requirements (without the leading zeroes) or "No solution" (without the quotes), if the corresponding number does not exist.
The chosen number must consist of exactly *k* digits. We assume that number 0 doesn't contain any leading zeroes. | [
"4 4\n",
"5 1\n",
"1 0\n"
] | [
"5881\n",
"36172\n",
"0\n"
] | For the first test sample *dr*(5881) = *dr*(22) = 4.
For the second test sample *dr*(36172) = *dr*(19) = *dr*(10) = 1. | 500 | [
{
"input": "4 4",
"output": "5881"
},
{
"input": "5 1",
"output": "36172"
},
{
"input": "1 0",
"output": "0"
},
{
"input": "8 7",
"output": "49722154"
},
{
"input": "487 0",
"output": "No solution"
},
{
"input": "1000 5",
"output": "8541939554067890866522280268745476436249986028349767396372181155840878549622667946850256234534972693110974918858266403731194206972478044933297639886527448596769215803533001453375065914421371731616055420973164037664278812596299678416020519508892847037891229851414508562230407367486468987019052183250172396304562086008837592345867873765321840214188417303688776985319268802181355472294386101622570417737061113209187893810568585166094583478900129912239498334853726870963804475563182775380744565964067602555515611220..."
},
{
"input": "22 9",
"output": "1583569962049529809017"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1 9",
"output": "9"
},
{
"input": "13 5",
"output": "1381199538344"
},
{
"input": "100 4",
"output": "6334594910586850938286642284598905674550356974741186703111536643493065423553455569335256292313330478"
},
{
"input": "123 6",
"output": "928024873067884441426263446866614165147002631091527531801777528825238463822318502518751375671158771476735217071878592158343"
},
{
"input": "1000 1",
"output": "8286301124628812353504240076754144327937426329149605334362213339655339076564408659154706137278060590992944494591503606137350736487608756923833530346502466262820452589925067370165968733865814927433418675056573256434073937686361155637721866942352171450747045834987797118866710087297111065178077368748085213082452303815796793489599773148508108295035303578345492871662297456131736137780231762177312635688688714815857818196180724774924848693916003108422682889382923194020205691379066085156078824413573001257245677878..."
},
{
"input": "2 0",
"output": "No solution"
},
{
"input": "734 9",
"output": "5509849803670339733829077693143634799621955270111335907079347964026719040571586127009915057683769302171314977999063915868539391500563742827163274052101515706840652002966522709635011152141196057419086708927225560622675363856445980167733179728663010064912099615416068178748694469047950713834326493597331720572208847439692450327661109751421257198843242305082523510866664350537162158359215265173356615680034808012842300294492281197211603826994471586252822908597603049772690875861970190564793056757768783375525854981..."
},
{
"input": "678 8",
"output": "3301967993506605598118564082793505826927835671912383741219911930496842130418974223636865915672261642456247377827650506657877850580145623499927271391838907804651235401527392426584047219626357010023552497909436550723659221336486898100975437974320483591226280567200180225706948265372905918038750624429412331582504280650041845010449084641487447573160867860208332424835101416924485616494780952529083292227777966546236453553361466209621076748915774965082618181512654546592160909206650552581723190500273752213154329310..."
},
{
"input": "955 7",
"output": "4875434946733568640983465009954221247849488705968833681097920555785434899849497268074436910608289709905212840964404347113134616236366794383005890642796609027376389191650656756216171636192669456464756898600086886269167613161503734300581107122411830728903919402846291350458047685924037685489537178939190129043010338580479169957795695942333133962326316127076129681213167918954090336000635320714955444899171270809399782177230616239894234246885245402806465700760528496316658100834632585364274381823984214942419830421..."
},
{
"input": "893 3",
"output": "3154491812688062338683413382839715419754844054478504300541293341098785797116419835470049101334759365561276155814822131363018164033585874216523127145546903121862283071300185033613164338905028463571111541628115658108609505120357131336651371062955497690723492519748325195227665653129911625684144804656937323976632567108677478936761775342496303735237936919652618323430255701996987753367609559178855599470625167628439986055634187527493497208780060336400261449926469512996188738133678473883670714775784527941804249702..."
},
{
"input": "998 2",
"output": "8948712698877635315965401396781625629035528026219922557326466734622505808493494219669540192792500692387387200924494124219975316993592377253517258369463882172533672158172302951620486954085880606055358057621166471042557383036617719864238933843342304818076672889894622975857106353903546493307325157763617269195570831067239463586554245706859061059010215520785892192165179414199200952765077228454366556358805840526959104496983177402562569401945586771345953166346316987259989961516385311376707950154520512125143059966..."
},
{
"input": "960 6",
"output": "7291446744949293530598651243840704118065364362420848463900543089429494124955982767375712583398715647208330285855809398453361266463042342917037983463277320070057956978767965467358862479678812136400444143489366786562672928727263605336304125661306952421127807059398289873947797478996261161224877129724944902005212399176751167053423457968483336961277157597291131065544350665072172392437597673561840137077580044817979332136630042866681837917711758227272499659805765131669208911408670581308412686469802437930679571593..."
}
] | 1,634,658,579 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 4 | 61 | 0 | k, d = map(int, input().split())
if k == 1:
print(d)
else:
a = 1
for i in range (k - 1):
a = a * 10
if d >= 1:
a = a + (d - 1)
else:
a = a + 8
print(a + 81) | Title: Vasya and Digital Root
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has recently found out what a digital root of a number is and he decided to share his knowledge with you.
Let's assume that *S*(*n*) is the sum of digits of number *n*, for example, *S*(4098)<==<=4<=+<=0<=+<=9<=+<=8<==<=21. Then the digital root of number *n* equals to:
1. *dr*(*n*)<==<=*S*(*n*), if *S*(*n*)<=<<=10; 1. *dr*(*n*)<==<=*dr*(<=*S*(*n*)<=), if *S*(*n*)<=≥<=10.
For example, *dr*(4098)<=<==<=<=*dr*(21)<=<==<=<=3.
Vasya is afraid of large numbers, so the numbers he works with are at most 101000. For all such numbers, he has proved that *dr*(*n*)<=<==<=<=*S*(<=*S*(<=*S*(<=*S*(*n*)<=)<=)<=) (*n*<=≤<=101000).
Now Vasya wants to quickly find numbers with the given digital root. The problem is, he hasn't learned how to do that and he asked you to help him. You task is, given numbers *k* and *d*, find the number consisting of exactly *k* digits (the leading zeroes are not allowed), with digital root equal to *d*, or else state that such number does not exist.
Input Specification:
The first line contains two integers *k* and *d* (1<=≤<=*k*<=≤<=1000; 0<=≤<=*d*<=≤<=9).
Output Specification:
In a single line print either any number that meets the requirements (without the leading zeroes) or "No solution" (without the quotes), if the corresponding number does not exist.
The chosen number must consist of exactly *k* digits. We assume that number 0 doesn't contain any leading zeroes.
Demo Input:
['4 4\n', '5 1\n', '1 0\n']
Demo Output:
['5881\n', '36172\n', '0\n']
Note:
For the first test sample *dr*(5881) = *dr*(22) = 4.
For the second test sample *dr*(36172) = *dr*(19) = *dr*(10) = 1. | ```python
k, d = map(int, input().split())
if k == 1:
print(d)
else:
a = 1
for i in range (k - 1):
a = a * 10
if d >= 1:
a = a + (d - 1)
else:
a = a + 8
print(a + 81)
``` | 0 |
|
507 | B | Amr and Pins | PROGRAMMING | 1,400 | [
"geometry",
"math"
] | null | null | Amr loves Geometry. One day he came up with a very interesting problem.
Amr has a circle of radius *r* and center in point (*x*,<=*y*). He wants the circle center to be in new position (*x*',<=*y*').
In one step Amr can put a pin to the border of the circle in a certain point, then rotate the circle around that pin by any angle and finally remove the pin.
Help Amr to achieve his goal in minimum number of steps. | Input consists of 5 space-separated integers *r*, *x*, *y*, *x*' *y*' (1<=≤<=*r*<=≤<=105, <=-<=105<=≤<=*x*,<=*y*,<=*x*',<=*y*'<=≤<=105), circle radius, coordinates of original center of the circle and coordinates of destination center of the circle respectively. | Output a single integer — minimum number of steps required to move the center of the circle to the destination point. | [
"2 0 0 0 4\n",
"1 1 1 4 4\n",
"4 5 6 5 6\n"
] | [
"1\n",
"3\n",
"0\n"
] | In the first sample test the optimal way is to put a pin at point (0, 2) and rotate the circle by 180 degrees counter-clockwise (or clockwise, no matter).
<img class="tex-graphics" src="https://espresso.codeforces.com/4e40fd4cc24a2050a0488aa131e6244369328039.png" style="max-width: 100.0%;max-height: 100.0%;"/> | 1,000 | [
{
"input": "2 0 0 0 4",
"output": "1"
},
{
"input": "1 1 1 4 4",
"output": "3"
},
{
"input": "4 5 6 5 6",
"output": "0"
},
{
"input": "10 20 0 40 0",
"output": "1"
},
{
"input": "9 20 0 40 0",
"output": "2"
},
{
"input": "5 -1 -6 -5 1",
"output": "1"
},
{
"input": "99125 26876 -21414 14176 17443",
"output": "1"
},
{
"input": "8066 7339 19155 -90534 -60666",
"output": "8"
},
{
"input": "100000 -100000 -100000 100000 100000",
"output": "2"
},
{
"input": "10 20 0 41 0",
"output": "2"
},
{
"input": "25 -64 -6 -56 64",
"output": "2"
},
{
"input": "125 455 450 439 721",
"output": "2"
},
{
"input": "5 6 3 7 2",
"output": "1"
},
{
"input": "24 130 14786 3147 2140",
"output": "271"
},
{
"input": "125 -363 176 93 330",
"output": "2"
},
{
"input": "1 14 30 30 14",
"output": "12"
},
{
"input": "25 96 13 7 2",
"output": "2"
},
{
"input": "4 100000 -100000 100000 -100000",
"output": "0"
},
{
"input": "1 3 4 2 5",
"output": "1"
},
{
"input": "1 -3 3 2 6",
"output": "3"
},
{
"input": "2 7 20 13 -5",
"output": "7"
},
{
"input": "1 1 1 1 4",
"output": "2"
},
{
"input": "249 -54242 -30537 -45023 -89682",
"output": "121"
},
{
"input": "4 100000 -100000 100000 -99999",
"output": "1"
},
{
"input": "97741 23818 78751 97583 26933",
"output": "1"
},
{
"input": "56767 -29030 51625 79823 -56297",
"output": "2"
},
{
"input": "98260 13729 74998 23701 9253",
"output": "1"
},
{
"input": "67377 -80131 -90254 -57320 14102",
"output": "1"
},
{
"input": "1 100000 100000 100000 -100000",
"output": "100000"
},
{
"input": "19312 19470 82059 58064 62231",
"output": "2"
},
{
"input": "67398 -68747 -79056 -34193 29400",
"output": "1"
},
{
"input": "91099 37184 -71137 75650 -3655",
"output": "1"
},
{
"input": "46456 -2621 -23623 -98302 -99305",
"output": "2"
},
{
"input": "100 100000 -100000 100000 -99999",
"output": "1"
},
{
"input": "1 100000 -100000 100000 -100000",
"output": "0"
},
{
"input": "8 0 0 0 32",
"output": "2"
},
{
"input": "100000 100000 1 -100000 0",
"output": "2"
}
] | 1,645,220,418 | 2,147,483,647 | PyPy 3 | OK | TESTS | 37 | 93 | 0 | from math import *
r,x,y,a,b=map(int,input().split())
print(ceil((((x-a)**2+(y-b)**2)**0.5)/(r*2)))
| Title: Amr and Pins
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Amr loves Geometry. One day he came up with a very interesting problem.
Amr has a circle of radius *r* and center in point (*x*,<=*y*). He wants the circle center to be in new position (*x*',<=*y*').
In one step Amr can put a pin to the border of the circle in a certain point, then rotate the circle around that pin by any angle and finally remove the pin.
Help Amr to achieve his goal in minimum number of steps.
Input Specification:
Input consists of 5 space-separated integers *r*, *x*, *y*, *x*' *y*' (1<=≤<=*r*<=≤<=105, <=-<=105<=≤<=*x*,<=*y*,<=*x*',<=*y*'<=≤<=105), circle radius, coordinates of original center of the circle and coordinates of destination center of the circle respectively.
Output Specification:
Output a single integer — minimum number of steps required to move the center of the circle to the destination point.
Demo Input:
['2 0 0 0 4\n', '1 1 1 4 4\n', '4 5 6 5 6\n']
Demo Output:
['1\n', '3\n', '0\n']
Note:
In the first sample test the optimal way is to put a pin at point (0, 2) and rotate the circle by 180 degrees counter-clockwise (or clockwise, no matter).
<img class="tex-graphics" src="https://espresso.codeforces.com/4e40fd4cc24a2050a0488aa131e6244369328039.png" style="max-width: 100.0%;max-height: 100.0%;"/> | ```python
from math import *
r,x,y,a,b=map(int,input().split())
print(ceil((((x-a)**2+(y-b)**2)**0.5)/(r*2)))
``` | 3 |
|
112 | A | Petya and Strings | PROGRAMMING | 800 | [
"implementation",
"strings"
] | A. Petya and Strings | 2 | 256 | Little Petya loves presents. His mum bought him two strings of the same size for his birthday. The strings consist of uppercase and lowercase Latin letters. Now Petya wants to compare those two strings lexicographically. The letters' case does not matter, that is an uppercase letter is considered equivalent to the corresponding lowercase letter. Help Petya perform the comparison. | Each of the first two lines contains a bought string. The strings' lengths range from 1 to 100 inclusive. It is guaranteed that the strings are of the same length and also consist of uppercase and lowercase Latin letters. | If the first string is less than the second one, print "-1". If the second string is less than the first one, print "1". If the strings are equal, print "0". Note that the letters' case is not taken into consideration when the strings are compared. | [
"aaaa\naaaA\n",
"abs\nAbz\n",
"abcdefg\nAbCdEfF\n"
] | [
"0\n",
"-1\n",
"1\n"
] | If you want more formal information about the lexicographical order (also known as the "dictionary order" or "alphabetical order"), you can visit the following site:
- http://en.wikipedia.org/wiki/Lexicographical_order | 500 | [
{
"input": "aaaa\naaaA",
"output": "0"
},
{
"input": "abs\nAbz",
"output": "-1"
},
{
"input": "abcdefg\nAbCdEfF",
"output": "1"
},
{
"input": "asadasdasd\nasdwasdawd",
"output": "-1"
},
{
"input": "aslkjlkasdd\nasdlkjdajwi",
"output": "1"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "0"
},
{
"input": "aAaaaAAaAaaAzZsssSsdDfeEaeqZlpP\nAaaaAaaAaaAaZzSSSSsDdFeeAeQZLpp",
"output": "0"
},
{
"input": "bwuEhEveouaTECagLZiqmUdxEmhRSOzMauJRWLQMppZOumxhAmwuGeDIkvkBLvMXwUoFmpAfDprBcFtEwOULcZWRQhcTbTbX\nHhoDWbcxwiMnCNexOsKsujLiSGcLllXOkRSbnOzThAjnnliLYFFmsYkOfpTxRNEfBsoUHfoLTiqAINRPxWRqrTJhgfkKcDOH",
"output": "-1"
},
{
"input": "kGWUuguKzcvxqKTNpxeDWXpXkrXDvGMFGoXKDfPBZvWSDUyIYBynbKOUonHvmZaKeirUhfmVRKtGhAdBfKMWXDUoqvbfpfHYcg\ncvOULleuIIiYVVxcLZmHVpNGXuEpzcWZZWyMOwIwbpkKPwCfkVbKkUuosvxYCKjqfVmHfJKbdrsAcatPYgrCABaFcoBuOmMfFt",
"output": "1"
},
{
"input": "nCeNVIzHqPceNhjHeHvJvgBsNFiXBATRrjSTXJzhLMDMxiJztphxBRlDlqwDFImWeEPkggZCXSRwelOdpNrYnTepiOqpvkr\nHJbjJFtlvNxIbkKlxQUwmZHJFVNMwPAPDRslIoXISBYHHfymyIaQHLgECPxAmqnOCizwXnIUBRmpYUBVPenoUKhCobKdOjL",
"output": "1"
},
{
"input": "ttXjenUAlfixytHEOrPkgXmkKTSGYuyVXGIHYmWWYGlBYpHkujueqBSgjLguSgiMGJWATIGEUjjAjKXdMiVbHozZUmqQtFrT\nJziDBFBDmDJCcGqFsQwDFBYdOidLxxhBCtScznnDgnsiStlWFnEXQrJxqTXKPxZyIGfLIToETKWZBPUIBmLeImrlSBWCkTNo",
"output": "1"
},
{
"input": "AjQhPqSVhwQQjcgCycjKorWBgFCRuQBwgdVuAPSMJAvTyxGVuFHjfJzkKfsmfhFbKqFrFIohSZBbpjgEHebezmVlGLTPSCTMf\nXhxWuSnMmKFrCUOwkTUmvKAfbTbHWzzOTzxJatLLCdlGnHVaBUnxDlsqpvjLHMThOPAFBggVKDyKBrZAmjnjrhHlrnSkyzBja",
"output": "-1"
},
{
"input": "HCIgYtnqcMyjVngziNflxKHtdTmcRJhzMAjFAsNdWXFJYEhiTzsQUtFNkAbdrFBRmvLirkuirqTDvIpEfyiIqkrwsjvpPWTEdI\nErqiiWKsmIjyZuzgTlTqxYZwlrpvRyaVhRTOYUqtPMVGGtWOkDCOOQRKrkkRzPftyQCkYkzKkzTPqqXmeZhvvEEiEhkdOmoMvy",
"output": "1"
},
{
"input": "mtBeJYILXcECGyEVSyzLFdQJbiVnnfkbsYYsdUJSIRmyzLfTTtFwIBmRLVnwcewIqcuydkcLpflHAFyDaToLiFMgeHvQorTVbI\nClLvyejznjbRfCDcrCzkLvqQaGzTjwmWONBdCctJAPJBcQrcYvHaSLQgPIJbmkFBhFzuQLBiRzAdNHulCjIAkBvZxxlkdzUWLR",
"output": "1"
},
{
"input": "tjucSbGESVmVridTBjTmpVBCwwdWKBPeBvmgdxgIVLwQxveETnSdxkTVJpXoperWSgdpPMKNmwDiGeHfxnuqaDissgXPlMuNZIr\nHfjOOJhomqNIKHvqSgfySjlsWJQBuWYwhLQhlZYlpZwboMpoLoluGsBmhhlYgeIouwdkPfiaAIrkYRlxtiFazOPOllPsNZHcIZd",
"output": "1"
},
{
"input": "AanbDfbZNlUodtBQlvPMyomStKNhgvSGhSbTdabxGFGGXCdpsJDimsAykKjfBDPMulkhBMsqLmVKLDoesHZsRAEEdEzqigueXInY\ncwfyjoppiJNrjrOLNZkqcGimrpTsiyFBVgMWEPXsMrxLJDDbtYzerXiFGuLBcQYitLdqhGHBpdjRnkUegmnwhGHAKXGyFtscWDSI",
"output": "-1"
},
{
"input": "HRfxniwuJCaHOcaOVgjOGHXKrwxrDQxJpppeGDXnTAowyKbCsCQPbchCKeTWOcKbySSYnoaTJDnmRcyGPbfXJyZoPcARHBu\nxkLXvwkvGIWSQaFTznLOctUXNuzzBBOlqvzmVfTSejekTAlwidRrsxkbZTsGGeEWxCXHzqWVuLGoCyrGjKkQoHqduXwYQKC",
"output": "-1"
},
{
"input": "OjYwwNuPESIazoyLFREpObIaMKhCaKAMWMfRGgucEuyNYRantwdwQkmflzfqbcFRaXBnZoIUGsFqXZHGKwlaBUXABBcQEWWPvkjW\nRxLqGcTTpBwHrHltCOllnTpRKLDofBUqqHxnOtVWPgvGaeHIevgUSOeeDOJubfqonFpVNGVbHFcAhjnyFvrrqnRgKhkYqQZmRfUl",
"output": "-1"
},
{
"input": "tatuhQPIzjptlzzJpCAPXSRTKZRlwgfoCIsFjJquRoIDyZZYRSPdFUTjjUPhLBBfeEIfLQpygKXRcyQFiQsEtRtLnZErBqW\ntkHUjllbafLUWhVCnvblKjgYIEoHhsjVmrDBmAWbvtkHxDbRFvsXAjHIrujaDbYwOZmacknhZPeCcorbRgHjjgAgoJdjvLo",
"output": "-1"
},
{
"input": "cymCPGqdXKUdADEWDdUaLEEMHiXHsdAZuDnJDMUvxvrLRBrPSDpXPAgMRoGplLtniFRTomDTAHXWAdgUveTxaqKVSvnOyhOwiRN\nuhmyEWzapiRNPFDisvHTbenXMfeZaHqOFlKjrfQjUBwdFktNpeiRoDWuBftZLcCZZAVfioOihZVNqiNCNDIsUdIhvbcaxpTRWoV",
"output": "-1"
},
{
"input": "sSvpcITJAwghVfJaLKBmyjOkhltTGjYJVLWCYMFUomiJaKQYhXTajvZVHIMHbyckYROGQZzjWyWCcnmDmrkvTKfHSSzCIhsXgEZa\nvhCXkCwAmErGVBPBAnkSYEYvseFKbWSktoqaHYXUmYkHfOkRwuEyBRoGoBrOXBKVxXycjZGStuvDarnXMbZLWrbjrisDoJBdSvWJ",
"output": "-1"
},
{
"input": "hJDANKUNBisOOINDsTixJmYgHNogtpwswwcvVMptfGwIjvqgwTYFcqTdyAqaqlnhOCMtsnWXQqtjFwQlEcBtMFAtSqnqthVb\nrNquIcjNWESjpPVWmzUJFrelpUZeGDmSvCurCqVmKHKVAAPkaHksniOlzjiKYIJtvbuQWZRufMebpTFPqyxIWWjfPaWYiNlK",
"output": "-1"
},
{
"input": "ycLoapxsfsDTHMSfAAPIUpiEhQKUIXUcXEiopMBuuZLHtfPpLmCHwNMNQUwsEXxCEmKHTBSnKhtQhGWUvppUFZUgSpbeChX\ndCZhgVXofkGousCzObxZSJwXcHIaqUDSCPKzXntcVmPxtNcXmVcjsetZYxedmgQzXTZHMvzjoaXCMKsncGciSDqQWIIRlys",
"output": "1"
},
{
"input": "nvUbnrywIePXcoukIhwTfUVcHUEgXcsMyNQhmMlTltZiCooyZiIKRIGVHMCnTKgzXXIuvoNDEZswKoACOBGSyVNqTNQqMhAG\nplxuGSsyyJjdvpddrSebOARSAYcZKEaKjqbCwvjhNykuaECoQVHTVFMKXwvrQXRaqXsHsBaGVhCxGRxNyGUbMlxOarMZNXxy",
"output": "-1"
},
{
"input": "EncmXtAblQzcVRzMQqdDqXfAhXbtJKQwZVWyHoWUckohnZqfoCmNJDzexFgFJYrwNHGgzCJTzQQFnxGlhmvQTpicTkEeVICKac\nNIUNZoMLFMyAjVgQLITELJSodIXcGSDWfhFypRoGYuogJpnqGTotWxVqpvBHjFOWcDRDtARsaHarHaOkeNWEHGTaGOFCOFEwvK",
"output": "-1"
},
{
"input": "UG\nak",
"output": "1"
},
{
"input": "JZR\nVae",
"output": "-1"
},
{
"input": "a\nZ",
"output": "-1"
},
{
"input": "rk\nkv",
"output": "1"
},
{
"input": "RvuT\nbJzE",
"output": "1"
},
{
"input": "PPS\nydq",
"output": "-1"
},
{
"input": "q\nq",
"output": "0"
},
{
"input": "peOw\nIgSJ",
"output": "1"
},
{
"input": "PyK\noKN",
"output": "1"
},
{
"input": "O\ni",
"output": "1"
},
{
"input": "NmGY\npDlP",
"output": "-1"
},
{
"input": "nG\nZf",
"output": "-1"
},
{
"input": "m\na",
"output": "1"
},
{
"input": "MWyB\nWZEV",
"output": "-1"
},
{
"input": "Gre\nfxc",
"output": "1"
},
{
"input": "Ooq\nwap",
"output": "-1"
},
{
"input": "XId\nlbB",
"output": "1"
},
{
"input": "lfFpECEqUMEOJhipvkZjDPcpDNJedOVXiSMgBvBZbtfzIKekcvpWPCazKAhJyHircRtgcBIJwwstpHaLAgxFOngAWUZRgCef\nLfFPEcequmeojHIpVkzjDPcpdNJEDOVXiSmGBVBZBtfZikEKcvPwpCAzKAHJyHIrCRTgCbIJWwSTphALagXfOnGAwUzRGcEF",
"output": "0"
},
{
"input": "DQBdtSEDtFGiNRUeJNbOIfDZnsryUlzJHGTXGFXnwsVyxNtLgmklmFvRCzYETBVdmkpJJIvIOkMDgCFHZOTODiYrkwXd\nDQbDtsEdTFginRUEJNBOIfdZnsryulZJHGtxGFxnwSvYxnTLgmKlmFVRCzyEtBVdmKpJjiVioKMDgCFhzoTODiYrKwXD",
"output": "0"
},
{
"input": "tYWRijFQSzHBpCjUzqBtNvBKyzZRnIdWEuyqnORBQTLyOQglIGfYJIRjuxnbLvkqZakNqPiGDvgpWYkfxYNXsdoKXZtRkSasfa\nTYwRiJfqsZHBPcJuZQBTnVbkyZZRnidwEuYQnorbQTLYOqGligFyjirJUxnblVKqZaknQpigDVGPwyKfxyNXSDoKxztRKSaSFA",
"output": "0"
},
{
"input": "KhScXYiErQIUtmVhNTCXSLAviefIeHIIdiGhsYnPkSBaDTvMkyanfMLBOvDWgRybLtDqvXVdVjccNunDyijhhZEAKBrdz\nkHsCXyiErqIuTMVHNTCxSLaViEFIEhIIDiGHsYNpKsBAdTvMKyANFMLBovdwGRYbLtdQVxvDVJCcNUndYiJHhzeakBrdZ",
"output": "0"
},
{
"input": "cpPQMpjRQJKQVXjWDYECXbagSmNcVfOuBWNZxihdERraVuiOpSVDCPgTGuSQALNoVjySceHcKXwOEpSzXrEqWwwrYeppNiWhDVg\nCPPqmPjRqJkQvxJwdyECXBAGsMNcVfOuBWNzxIhderRavUiOpSvDCpGTgusqAlNovjyScEhCKXwoePSZxrEQwWwryEPPniWHDvG",
"output": "0"
},
{
"input": "SajcCGMepaLjZIWLRBGFcrZRCRvvoCsIyKsQerbrwsIamxxpRmQSZSalasJLVFbCHCuXJlubciQAvLxXYBazLsMKLHLdDQ\nsaJcCgmEpaLJziWlrBgFcRzrCrVVOcSIykSQerBrwSIamxxPrMqSzSalASjLVFbChCUxjLUbCIQAVlxxybAZLsmkLhLDdQ",
"output": "0"
},
{
"input": "kigPrWNTOUNDBskAfefjhHYZNYdnfZWuXWzHiBxFQryBbAkPtenFwWvCSTYGpzOntUNzNUhxRWjKmicTwLwJAnbAxj\nkigpRWntOUNdBsKaFEFjhhYZnYDNfzWuXwZhibxFQRybbakPteNfwwvcStyGPzoNTunznuHXrWjKMIctWLWJANBAxJ",
"output": "0"
},
{
"input": "nTomZZuTTRTAAPoUsySVFGElrpQRNLjqvFmcYytiheQnjUhPLnqNBiYtQkljbcvmjuNAVKbvQOWpqqFlQhAhULIhquoCnjUI\nntOmzZuttrtAAPOUSySVFgeLRPQrNLjQvfmCyYTiHEQnjuHPlNQNbIYtqKLJBCVmjunavkbvQOWPQQFlqHaHULIHQuOcnJUi",
"output": "0"
},
{
"input": "abac\nadaa",
"output": "-1"
},
{
"input": "Bbc\nabc",
"output": "1"
},
{
"input": "aaaba\naaaab",
"output": "1"
}
] | 1,695,295,819 | 2,147,483,647 | Python 3 | OK | TESTS | 53 | 92 | 0 | s1 = input().lower()
s2 = input().lower()
if s1==s2:
print(0)
if s1<s2:
print(-1)
if s1>s2:
print(1)
| Title: Petya and Strings
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Little Petya loves presents. His mum bought him two strings of the same size for his birthday. The strings consist of uppercase and lowercase Latin letters. Now Petya wants to compare those two strings lexicographically. The letters' case does not matter, that is an uppercase letter is considered equivalent to the corresponding lowercase letter. Help Petya perform the comparison.
Input Specification:
Each of the first two lines contains a bought string. The strings' lengths range from 1 to 100 inclusive. It is guaranteed that the strings are of the same length and also consist of uppercase and lowercase Latin letters.
Output Specification:
If the first string is less than the second one, print "-1". If the second string is less than the first one, print "1". If the strings are equal, print "0". Note that the letters' case is not taken into consideration when the strings are compared.
Demo Input:
['aaaa\naaaA\n', 'abs\nAbz\n', 'abcdefg\nAbCdEfF\n']
Demo Output:
['0\n', '-1\n', '1\n']
Note:
If you want more formal information about the lexicographical order (also known as the "dictionary order" or "alphabetical order"), you can visit the following site:
- http://en.wikipedia.org/wiki/Lexicographical_order | ```python
s1 = input().lower()
s2 = input().lower()
if s1==s2:
print(0)
if s1<s2:
print(-1)
if s1>s2:
print(1)
``` | 3.977 |
551 | A | GukiZ and Contest | PROGRAMMING | 800 | [
"brute force",
"implementation",
"sortings"
] | null | null | Professor GukiZ likes programming contests. He especially likes to rate his students on the contests he prepares. Now, he has decided to prepare a new contest.
In total, *n* students will attend, and before the start, every one of them has some positive integer rating. Students are indexed from 1 to *n*. Let's denote the rating of *i*-th student as *a**i*. After the contest ends, every student will end up with some positive integer position. GukiZ expects that his students will take places according to their ratings.
He thinks that each student will take place equal to . In particular, if student *A* has rating strictly lower then student *B*, *A* will get the strictly better position than *B*, and if two students have equal ratings, they will share the same position.
GukiZ would like you to reconstruct the results by following his expectations. Help him and determine the position after the end of the contest for each of his students if everything goes as expected. | The first line contains integer *n* (1<=≤<=*n*<=≤<=2000), number of GukiZ's students.
The second line contains *n* numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=2000) where *a**i* is the rating of *i*-th student (1<=≤<=*i*<=≤<=*n*). | In a single line, print the position after the end of the contest for each of *n* students in the same order as they appear in the input. | [
"3\n1 3 3\n",
"1\n1\n",
"5\n3 5 3 4 5\n"
] | [
"3 1 1\n",
"1\n",
"4 1 4 3 1\n"
] | In the first sample, students 2 and 3 are positioned first (there is no other student with higher rating), and student 1 is positioned third since there are two students with higher rating.
In the second sample, first student is the only one on the contest.
In the third sample, students 2 and 5 share the first position with highest rating, student 4 is next with third position, and students 1 and 3 are the last sharing fourth position. | 500 | [
{
"input": "3\n1 3 3",
"output": "3 1 1"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "5\n3 5 3 4 5",
"output": "4 1 4 3 1"
},
{
"input": "7\n1 3 5 4 2 2 1",
"output": "6 3 1 2 4 4 6"
},
{
"input": "11\n5 6 4 2 9 7 6 6 6 6 7",
"output": "9 4 10 11 1 2 4 4 4 4 2"
},
{
"input": "1\n2000",
"output": "1"
},
{
"input": "2\n2000 2000",
"output": "1 1"
},
{
"input": "3\n500 501 502",
"output": "3 2 1"
},
{
"input": "10\n105 106 1 1 1 11 1000 999 1000 999",
"output": "6 5 8 8 8 7 1 3 1 3"
},
{
"input": "6\n1 2 3 4 5 6",
"output": "6 5 4 3 2 1"
},
{
"input": "7\n6 5 4 3 2 1 1",
"output": "1 2 3 4 5 6 6"
},
{
"input": "8\n153 100 87 14 10 8 6 5",
"output": "1 2 3 4 5 6 7 8"
},
{
"input": "70\n11 54 37 62 1 46 13 17 38 47 28 15 63 5 61 34 49 66 32 59 3 41 58 28 23 62 41 64 20 5 14 41 10 37 51 32 65 46 61 8 15 19 16 44 31 42 19 46 66 25 26 58 60 5 19 18 69 53 20 40 45 27 24 41 32 23 57 56 62 10",
"output": "62 18 35 7 70 23 61 56 34 22 42 58 6 66 10 37 21 2 38 13 69 29 14 42 48 7 29 5 50 66 60 29 63 35 20 38 4 23 10 65 58 52 57 27 41 28 52 23 2 46 45 14 12 66 52 55 1 19 50 33 26 44 47 29 38 48 16 17 7 63"
},
{
"input": "5\n1 2000 1 1 2000",
"output": "3 1 3 3 1"
}
] | 1,550,066,865 | 2,147,483,647 | Python 3 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | #include <bits/stdc++.h>
using namespace std;
#define mod 1000000007
#define ll long long
#define ull unsigned long long
#define mp make_pair
#define pb push_back
#define rep(n) for(long i=0;i<n;i++)
#define mset(a,i) memset(a,i,sizeof(a))
#define minv(a) min_element(a.begin(),a.end())
#define maxv(a) max_element(a.begin(),a.end())
#define min3(a,b,c) min(a,min(b,c))
#define max3(a,b,c) max(a,max(b,c))
#define ff first
#define ss second
#define endl "\n"
#define len(s) s.length()
#define NL cout<<endl;
#define printmat(a,m,n) for(int i=0;i<m;i++){ \
for(int j=0;j<n;j++){ \
cout<<a[i][j]<<" "; \
} \
cout<<endl; \
}
#define dbgn(x) cout<<" $ "<<x<<" $ "<<endl;
#define dbg(x) cout<<" $ "<<x<<" $ ";
#define all(v) v.begin(),v.end()
#define ub upper_bound
#define lb lower_bound
#define maxheap priority_queue<ll>
#define minheap priority_queue<ll, vi, greater<ll>>
#define fast_io() cin.sync_with_stdio(false);cout.sync_with_stdio(false); cin.tie(NULL);
int main() {
ll n;
cin>>n;
ll a[n];
ll b[2001],c[2001];
mset(b,0);
mset(c,0);
rep(n){
cin>>a[i];
b[a[i]]++;
}
for(int i=1999;i>=0;i--){
c[i]=c[i+1]+b[i+1];
}
rep(n){
cout<<c[a[i]]+1<<" ";
}
return 0; | Title: GukiZ and Contest
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Professor GukiZ likes programming contests. He especially likes to rate his students on the contests he prepares. Now, he has decided to prepare a new contest.
In total, *n* students will attend, and before the start, every one of them has some positive integer rating. Students are indexed from 1 to *n*. Let's denote the rating of *i*-th student as *a**i*. After the contest ends, every student will end up with some positive integer position. GukiZ expects that his students will take places according to their ratings.
He thinks that each student will take place equal to . In particular, if student *A* has rating strictly lower then student *B*, *A* will get the strictly better position than *B*, and if two students have equal ratings, they will share the same position.
GukiZ would like you to reconstruct the results by following his expectations. Help him and determine the position after the end of the contest for each of his students if everything goes as expected.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=2000), number of GukiZ's students.
The second line contains *n* numbers *a*1,<=*a*2,<=... *a**n* (1<=≤<=*a**i*<=≤<=2000) where *a**i* is the rating of *i*-th student (1<=≤<=*i*<=≤<=*n*).
Output Specification:
In a single line, print the position after the end of the contest for each of *n* students in the same order as they appear in the input.
Demo Input:
['3\n1 3 3\n', '1\n1\n', '5\n3 5 3 4 5\n']
Demo Output:
['3 1 1\n', '1\n', '4 1 4 3 1\n']
Note:
In the first sample, students 2 and 3 are positioned first (there is no other student with higher rating), and student 1 is positioned third since there are two students with higher rating.
In the second sample, first student is the only one on the contest.
In the third sample, students 2 and 5 share the first position with highest rating, student 4 is next with third position, and students 1 and 3 are the last sharing fourth position. | ```python
#include <bits/stdc++.h>
using namespace std;
#define mod 1000000007
#define ll long long
#define ull unsigned long long
#define mp make_pair
#define pb push_back
#define rep(n) for(long i=0;i<n;i++)
#define mset(a,i) memset(a,i,sizeof(a))
#define minv(a) min_element(a.begin(),a.end())
#define maxv(a) max_element(a.begin(),a.end())
#define min3(a,b,c) min(a,min(b,c))
#define max3(a,b,c) max(a,max(b,c))
#define ff first
#define ss second
#define endl "\n"
#define len(s) s.length()
#define NL cout<<endl;
#define printmat(a,m,n) for(int i=0;i<m;i++){ \
for(int j=0;j<n;j++){ \
cout<<a[i][j]<<" "; \
} \
cout<<endl; \
}
#define dbgn(x) cout<<" $ "<<x<<" $ "<<endl;
#define dbg(x) cout<<" $ "<<x<<" $ ";
#define all(v) v.begin(),v.end()
#define ub upper_bound
#define lb lower_bound
#define maxheap priority_queue<ll>
#define minheap priority_queue<ll, vi, greater<ll>>
#define fast_io() cin.sync_with_stdio(false);cout.sync_with_stdio(false); cin.tie(NULL);
int main() {
ll n;
cin>>n;
ll a[n];
ll b[2001],c[2001];
mset(b,0);
mset(c,0);
rep(n){
cin>>a[i];
b[a[i]]++;
}
for(int i=1999;i>=0;i--){
c[i]=c[i+1]+b[i+1];
}
rep(n){
cout<<c[a[i]]+1<<" ";
}
return 0;
``` | -1 |
|
798 | A | Mike and palindrome | PROGRAMMING | 1,000 | [
"brute force",
"constructive algorithms",
"strings"
] | null | null | Mike has a string *s* consisting of only lowercase English letters. He wants to change exactly one character from the string so that the resulting one is a palindrome.
A palindrome is a string that reads the same backward as forward, for example strings "z", "aaa", "aba", "abccba" are palindromes, but strings "codeforces", "reality", "ab" are not. | The first and single line contains string *s* (1<=≤<=|*s*|<=≤<=15). | Print "YES" (without quotes) if Mike can change exactly one character so that the resulting string is palindrome or "NO" (without quotes) otherwise. | [
"abccaa\n",
"abbcca\n",
"abcda\n"
] | [
"YES\n",
"NO\n",
"YES\n"
] | none | 500 | [
{
"input": "abccaa",
"output": "YES"
},
{
"input": "abbcca",
"output": "NO"
},
{
"input": "abcda",
"output": "YES"
},
{
"input": "kyw",
"output": "YES"
},
{
"input": "fccf",
"output": "NO"
},
{
"input": "mnlm",
"output": "YES"
},
{
"input": "gqrk",
"output": "NO"
},
{
"input": "glxlg",
"output": "YES"
},
{
"input": "czhfc",
"output": "YES"
},
{
"input": "broon",
"output": "NO"
},
{
"input": "rmggmr",
"output": "NO"
},
{
"input": "wvxxzw",
"output": "YES"
},
{
"input": "ukvciu",
"output": "NO"
},
{
"input": "vrnwnrv",
"output": "YES"
},
{
"input": "vlkjkav",
"output": "YES"
},
{
"input": "guayhmg",
"output": "NO"
},
{
"input": "lkvhhvkl",
"output": "NO"
},
{
"input": "ffdsslff",
"output": "YES"
},
{
"input": "galjjtyw",
"output": "NO"
},
{
"input": "uosgwgsou",
"output": "YES"
},
{
"input": "qjwmjmljq",
"output": "YES"
},
{
"input": "ustrvrodf",
"output": "NO"
},
{
"input": "a",
"output": "YES"
},
{
"input": "qjfyjjyfjq",
"output": "NO"
},
{
"input": "ysxibbixsq",
"output": "YES"
},
{
"input": "howfslfwmh",
"output": "NO"
},
{
"input": "ekhajrjahke",
"output": "YES"
},
{
"input": "ucnolsloncw",
"output": "YES"
},
{
"input": "jrzsfrrkrtj",
"output": "NO"
},
{
"input": "typayzzyapyt",
"output": "NO"
},
{
"input": "uwdhkzokhdwu",
"output": "YES"
},
{
"input": "xokxpyyuafij",
"output": "NO"
},
{
"input": "eusneioiensue",
"output": "YES"
},
{
"input": "fuxpuajabpxuf",
"output": "YES"
},
{
"input": "guvggtfhlgruy",
"output": "NO"
},
{
"input": "cojhkhxxhkhjoc",
"output": "NO"
},
{
"input": "mhifbmmmmbmihm",
"output": "YES"
},
{
"input": "kxfqqncnebpami",
"output": "NO"
},
{
"input": "scfwrjevejrwfcs",
"output": "YES"
},
{
"input": "thdaonpepdoadht",
"output": "YES"
},
{
"input": "jsfzcbnhsccuqsj",
"output": "NO"
},
{
"input": "nn",
"output": "NO"
},
{
"input": "nm",
"output": "YES"
},
{
"input": "jdj",
"output": "YES"
},
{
"input": "bbcaa",
"output": "NO"
},
{
"input": "abcde",
"output": "NO"
},
{
"input": "abcdf",
"output": "NO"
},
{
"input": "aa",
"output": "NO"
},
{
"input": "abecd",
"output": "NO"
},
{
"input": "abccacb",
"output": "NO"
},
{
"input": "aabc",
"output": "NO"
},
{
"input": "anpqb",
"output": "NO"
},
{
"input": "c",
"output": "YES"
},
{
"input": "abcdefg",
"output": "NO"
},
{
"input": "aanbb",
"output": "NO"
},
{
"input": "aabbb",
"output": "NO"
},
{
"input": "aaabbab",
"output": "NO"
},
{
"input": "ab",
"output": "YES"
},
{
"input": "aabbc",
"output": "NO"
},
{
"input": "ecabd",
"output": "NO"
},
{
"input": "abcdrty",
"output": "NO"
},
{
"input": "abcdmnp",
"output": "NO"
},
{
"input": "bbbbbb",
"output": "NO"
},
{
"input": "abcxuio",
"output": "NO"
},
{
"input": "abcdabcde",
"output": "NO"
},
{
"input": "abcxpoi",
"output": "NO"
},
{
"input": "aba",
"output": "YES"
},
{
"input": "aacbb",
"output": "NO"
},
{
"input": "abcedca",
"output": "NO"
},
{
"input": "abcdd",
"output": "NO"
},
{
"input": "abbcs",
"output": "NO"
},
{
"input": "aaabccc",
"output": "NO"
},
{
"input": "paxkxbq",
"output": "NO"
},
{
"input": "z",
"output": "YES"
},
{
"input": "b",
"output": "YES"
},
{
"input": "abcdefghi",
"output": "NO"
},
{
"input": "abcqr",
"output": "NO"
},
{
"input": "abcdc",
"output": "NO"
},
{
"input": "abcb",
"output": "NO"
},
{
"input": "aabcd",
"output": "NO"
},
{
"input": "abbba",
"output": "YES"
},
{
"input": "aaabbb",
"output": "NO"
},
{
"input": "bb",
"output": "NO"
},
{
"input": "aaacbbb",
"output": "NO"
},
{
"input": "abbzcca",
"output": "NO"
},
{
"input": "abxab",
"output": "NO"
},
{
"input": "bbb",
"output": "YES"
},
{
"input": "abcrtyu",
"output": "NO"
},
{
"input": "cbacb",
"output": "NO"
},
{
"input": "acbb",
"output": "NO"
},
{
"input": "ww",
"output": "NO"
},
{
"input": "aaaaaa",
"output": "NO"
},
{
"input": "jizzz",
"output": "NO"
},
{
"input": "aaakcba",
"output": "NO"
},
{
"input": "acbak",
"output": "NO"
},
{
"input": "bddeffd",
"output": "NO"
},
{
"input": "aaa",
"output": "YES"
},
{
"input": "afghqwe",
"output": "NO"
},
{
"input": "abcdfga",
"output": "NO"
}
] | 1,660,561,049 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 4 | 46 | 0 | word = input()
counter = 0
for i in range(0, int(len(word) / 2)):
if word[i] != word[-(i + 1)]:
counter += 1
if counter == 0 or counter == 1:
print("YES")
else:
print("NO")
| Title: Mike and palindrome
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Mike has a string *s* consisting of only lowercase English letters. He wants to change exactly one character from the string so that the resulting one is a palindrome.
A palindrome is a string that reads the same backward as forward, for example strings "z", "aaa", "aba", "abccba" are palindromes, but strings "codeforces", "reality", "ab" are not.
Input Specification:
The first and single line contains string *s* (1<=≤<=|*s*|<=≤<=15).
Output Specification:
Print "YES" (without quotes) if Mike can change exactly one character so that the resulting string is palindrome or "NO" (without quotes) otherwise.
Demo Input:
['abccaa\n', 'abbcca\n', 'abcda\n']
Demo Output:
['YES\n', 'NO\n', 'YES\n']
Note:
none | ```python
word = input()
counter = 0
for i in range(0, int(len(word) / 2)):
if word[i] != word[-(i + 1)]:
counter += 1
if counter == 0 or counter == 1:
print("YES")
else:
print("NO")
``` | 0 |
|
499 | B | Lecture | PROGRAMMING | 1,000 | [
"implementation",
"strings"
] | null | null | You have a new professor of graph theory and he speaks very quickly. You come up with the following plan to keep up with his lecture and make notes.
You know two languages, and the professor is giving the lecture in the first one. The words in both languages consist of lowercase English characters, each language consists of several words. For each language, all words are distinct, i.e. they are spelled differently. Moreover, the words of these languages have a one-to-one correspondence, that is, for each word in each language, there exists exactly one word in the other language having has the same meaning.
You can write down every word the professor says in either the first language or the second language. Of course, during the lecture you write down each word in the language in which the word is shorter. In case of equal lengths of the corresponding words you prefer the word of the first language.
You are given the text of the lecture the professor is going to read. Find out how the lecture will be recorded in your notes. | The first line contains two integers, *n* and *m* (1<=≤<=*n*<=≤<=3000, 1<=≤<=*m*<=≤<=3000) — the number of words in the professor's lecture and the number of words in each of these languages.
The following *m* lines contain the words. The *i*-th line contains two strings *a**i*, *b**i* meaning that the word *a**i* belongs to the first language, the word *b**i* belongs to the second language, and these two words have the same meaning. It is guaranteed that no word occurs in both languages, and each word occurs in its language exactly once.
The next line contains *n* space-separated strings *c*1,<=*c*2,<=...,<=*c**n* — the text of the lecture. It is guaranteed that each of the strings *c**i* belongs to the set of strings {*a*1,<=*a*2,<=... *a**m*}.
All the strings in the input are non-empty, each consisting of no more than 10 lowercase English letters. | Output exactly *n* words: how you will record the lecture in your notebook. Output the words of the lecture in the same order as in the input. | [
"4 3\ncodeforces codesecrof\ncontest round\nletter message\ncodeforces contest letter contest\n",
"5 3\njoll wuqrd\neuzf un\nhbnyiyc rsoqqveh\nhbnyiyc joll joll euzf joll\n"
] | [
"codeforces round letter round\n",
"hbnyiyc joll joll un joll\n"
] | none | 500 | [
{
"input": "4 3\ncodeforces codesecrof\ncontest round\nletter message\ncodeforces contest letter contest",
"output": "codeforces round letter round"
},
{
"input": "5 3\njoll wuqrd\neuzf un\nhbnyiyc rsoqqveh\nhbnyiyc joll joll euzf joll",
"output": "hbnyiyc joll joll un joll"
},
{
"input": "5 5\nqueyqj f\nb vn\ntabzvk qpfzoqx\nytnyonoc hnxsd\njpggvr lchinjmt\nqueyqj jpggvr b ytnyonoc b",
"output": "f jpggvr b hnxsd b"
},
{
"input": "10 22\nazbrll oen\ngh vdyayei\njphveblohx vfglv\nmfyxib jepnvhcuwo\nrpikazqj uam\nl rx\nokjenof qpnyi\nj tixqrno\nod itozmfct\nikkdxmirx ev\nqexftojc p\nkdazb zjs\nmbk ykvqjrxaxu\nhbcwhouzq pwt\nmirpsz zfaegpl\nuhkkvcj rlvwj\nef iqnnwtolrc\npjzfcpmeag ecdayth\nsa qcthz\ncbfhfxi qrnbvdryz\nwqel tj\natx smkbid\nef hbcwhouzq cbfhfxi hbcwhouzq mirpsz cbfhfxi cbfhfxi okjenof pjzfcpmeag kdazb",
"output": "ef pwt cbfhfxi pwt mirpsz cbfhfxi cbfhfxi qpnyi ecdayth zjs"
},
{
"input": "1 1\namit am\namit",
"output": "am"
},
{
"input": "1 1\na c\na",
"output": "a"
}
] | 1,639,733,904 | 2,147,483,647 | Python 3 | OK | TESTS | 37 | 62 | 409,600 | n , m = map(int, input().split(" "))
notes = {}
final = []
for i in range(m):
a,b = map(str, input().split())
notes[a]=b
c = list(map(str, input().split(" ")[:n]))
for i in c:
if len(notes[i])>=len(i):
final.append(i)
else:
final.append(notes[i])
print(" ".join(final)) | Title: Lecture
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You have a new professor of graph theory and he speaks very quickly. You come up with the following plan to keep up with his lecture and make notes.
You know two languages, and the professor is giving the lecture in the first one. The words in both languages consist of lowercase English characters, each language consists of several words. For each language, all words are distinct, i.e. they are spelled differently. Moreover, the words of these languages have a one-to-one correspondence, that is, for each word in each language, there exists exactly one word in the other language having has the same meaning.
You can write down every word the professor says in either the first language or the second language. Of course, during the lecture you write down each word in the language in which the word is shorter. In case of equal lengths of the corresponding words you prefer the word of the first language.
You are given the text of the lecture the professor is going to read. Find out how the lecture will be recorded in your notes.
Input Specification:
The first line contains two integers, *n* and *m* (1<=≤<=*n*<=≤<=3000, 1<=≤<=*m*<=≤<=3000) — the number of words in the professor's lecture and the number of words in each of these languages.
The following *m* lines contain the words. The *i*-th line contains two strings *a**i*, *b**i* meaning that the word *a**i* belongs to the first language, the word *b**i* belongs to the second language, and these two words have the same meaning. It is guaranteed that no word occurs in both languages, and each word occurs in its language exactly once.
The next line contains *n* space-separated strings *c*1,<=*c*2,<=...,<=*c**n* — the text of the lecture. It is guaranteed that each of the strings *c**i* belongs to the set of strings {*a*1,<=*a*2,<=... *a**m*}.
All the strings in the input are non-empty, each consisting of no more than 10 lowercase English letters.
Output Specification:
Output exactly *n* words: how you will record the lecture in your notebook. Output the words of the lecture in the same order as in the input.
Demo Input:
['4 3\ncodeforces codesecrof\ncontest round\nletter message\ncodeforces contest letter contest\n', '5 3\njoll wuqrd\neuzf un\nhbnyiyc rsoqqveh\nhbnyiyc joll joll euzf joll\n']
Demo Output:
['codeforces round letter round\n', 'hbnyiyc joll joll un joll\n']
Note:
none | ```python
n , m = map(int, input().split(" "))
notes = {}
final = []
for i in range(m):
a,b = map(str, input().split())
notes[a]=b
c = list(map(str, input().split(" ")[:n]))
for i in c:
if len(notes[i])>=len(i):
final.append(i)
else:
final.append(notes[i])
print(" ".join(final))
``` | 3 |
|
80 | A | Panoramix's Prediction | PROGRAMMING | 800 | [
"brute force"
] | A. Panoramix's Prediction | 2 | 256 | A prime number is a number which has exactly two distinct divisors: one and itself. For example, numbers 2, 7, 3 are prime, and 1, 6, 4 are not.
The next prime number after *x* is the smallest prime number greater than *x*. For example, the next prime number after 2 is 3, and the next prime number after 3 is 5. Note that there is exactly one next prime number after each number. So 5 is not the next prime number for 2.
One cold April morning Panoramix predicted that soon Kakofonix will break free from his straitjacket, and this will be a black day for the residents of the Gallic countryside.
Panoramix's prophecy tells that if some day Asterix and Obelix beat exactly *x* Roman soldiers, where *x* is a prime number, and next day they beat exactly *y* Roman soldiers, where *y* is the next prime number after *x*, then it's time to wait for Armageddon, for nothing can shut Kakofonix up while he sings his infernal song.
Yesterday the Gauls beat *n* Roman soldiers and it turned out that the number *n* was prime! Today their victims were a troop of *m* Romans (*m*<=><=*n*). Determine whether the Gauls should wait for the black day after today's victory of Asterix and Obelix? | The first and only input line contains two positive integers — *n* and *m* (2<=≤<=*n*<=<<=*m*<=≤<=50). It is guaranteed that *n* is prime.
Pretests contain all the cases with restrictions 2<=≤<=*n*<=<<=*m*<=≤<=4. | Print YES, if *m* is the next prime number after *n*, or NO otherwise. | [
"3 5\n",
"7 11\n",
"7 9\n"
] | [
"YES",
"YES",
"NO"
] | none | 500 | [
{
"input": "3 5",
"output": "YES"
},
{
"input": "7 11",
"output": "YES"
},
{
"input": "7 9",
"output": "NO"
},
{
"input": "2 3",
"output": "YES"
},
{
"input": "2 4",
"output": "NO"
},
{
"input": "3 4",
"output": "NO"
},
{
"input": "3 5",
"output": "YES"
},
{
"input": "5 7",
"output": "YES"
},
{
"input": "7 11",
"output": "YES"
},
{
"input": "11 13",
"output": "YES"
},
{
"input": "13 17",
"output": "YES"
},
{
"input": "17 19",
"output": "YES"
},
{
"input": "19 23",
"output": "YES"
},
{
"input": "23 29",
"output": "YES"
},
{
"input": "29 31",
"output": "YES"
},
{
"input": "31 37",
"output": "YES"
},
{
"input": "37 41",
"output": "YES"
},
{
"input": "41 43",
"output": "YES"
},
{
"input": "43 47",
"output": "YES"
},
{
"input": "2 5",
"output": "NO"
},
{
"input": "2 7",
"output": "NO"
},
{
"input": "2 6",
"output": "NO"
},
{
"input": "2 11",
"output": "NO"
},
{
"input": "3 6",
"output": "NO"
},
{
"input": "3 7",
"output": "NO"
},
{
"input": "3 9",
"output": "NO"
},
{
"input": "5 6",
"output": "NO"
},
{
"input": "5 9",
"output": "NO"
},
{
"input": "5 11",
"output": "NO"
},
{
"input": "5 13",
"output": "NO"
},
{
"input": "5 15",
"output": "NO"
},
{
"input": "7 8",
"output": "NO"
},
{
"input": "7 13",
"output": "NO"
},
{
"input": "13 15",
"output": "NO"
},
{
"input": "13 17",
"output": "YES"
},
{
"input": "19 21",
"output": "NO"
},
{
"input": "13 20",
"output": "NO"
},
{
"input": "41 49",
"output": "NO"
},
{
"input": "43 49",
"output": "NO"
},
{
"input": "47 50",
"output": "NO"
},
{
"input": "47 49",
"output": "NO"
},
{
"input": "47 48",
"output": "NO"
},
{
"input": "23 25",
"output": "NO"
},
{
"input": "2 50",
"output": "NO"
},
{
"input": "31 33",
"output": "NO"
}
] | 1,691,174,309 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 3 | 62 | 0 | a,b = map(int,input().split())
c = [3,5,7,11,13,17,19,23,29,31,37,41,43,47]
if c[c.index(a)+1] == b:
print("YES")
else:
print("NO") | Title: Panoramix's Prediction
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A prime number is a number which has exactly two distinct divisors: one and itself. For example, numbers 2, 7, 3 are prime, and 1, 6, 4 are not.
The next prime number after *x* is the smallest prime number greater than *x*. For example, the next prime number after 2 is 3, and the next prime number after 3 is 5. Note that there is exactly one next prime number after each number. So 5 is not the next prime number for 2.
One cold April morning Panoramix predicted that soon Kakofonix will break free from his straitjacket, and this will be a black day for the residents of the Gallic countryside.
Panoramix's prophecy tells that if some day Asterix and Obelix beat exactly *x* Roman soldiers, where *x* is a prime number, and next day they beat exactly *y* Roman soldiers, where *y* is the next prime number after *x*, then it's time to wait for Armageddon, for nothing can shut Kakofonix up while he sings his infernal song.
Yesterday the Gauls beat *n* Roman soldiers and it turned out that the number *n* was prime! Today their victims were a troop of *m* Romans (*m*<=><=*n*). Determine whether the Gauls should wait for the black day after today's victory of Asterix and Obelix?
Input Specification:
The first and only input line contains two positive integers — *n* and *m* (2<=≤<=*n*<=<<=*m*<=≤<=50). It is guaranteed that *n* is prime.
Pretests contain all the cases with restrictions 2<=≤<=*n*<=<<=*m*<=≤<=4.
Output Specification:
Print YES, if *m* is the next prime number after *n*, or NO otherwise.
Demo Input:
['3 5\n', '7 11\n', '7 9\n']
Demo Output:
['YES', 'YES', 'NO']
Note:
none | ```python
a,b = map(int,input().split())
c = [3,5,7,11,13,17,19,23,29,31,37,41,43,47]
if c[c.index(a)+1] == b:
print("YES")
else:
print("NO")
``` | -1 |
1 | A | Theatre Square | PROGRAMMING | 1,000 | [
"math"
] | A. Theatre Square | 1 | 256 | Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square. | The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109). | Write the needed number of flagstones. | [
"6 6 4\n"
] | [
"4\n"
] | none | 0 | [
{
"input": "6 6 4",
"output": "4"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "2 1 1",
"output": "2"
},
{
"input": "1 2 1",
"output": "2"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "1 1 3",
"output": "1"
},
{
"input": "2 3 4",
"output": "1"
},
{
"input": "1000000000 1000000000 1",
"output": "1000000000000000000"
},
{
"input": "12 13 4",
"output": "12"
},
{
"input": "222 332 5",
"output": "3015"
},
{
"input": "1000 1000 10",
"output": "10000"
},
{
"input": "1001 1000 10",
"output": "10100"
},
{
"input": "100 10001 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 999999999",
"output": "4"
},
{
"input": "1000000000 1000000000 192",
"output": "27126743055556"
},
{
"input": "1000000000 987654321 1",
"output": "987654321000000000"
},
{
"input": "456784567 1000000000 51",
"output": "175618850864484"
},
{
"input": "39916800 134217728 40320",
"output": "3295710"
}
] | 1,648,553,592 | 2,147,483,647 | Python 3 | OK | TESTS | 20 | 31 | 0 | n, m, a = input().split()
n, m, a = int(n), int(m), int(a)
x = (n + a - 1) / a
y = (m + a - 1) / a
print(int(x)*int(y))
| Title: Theatre Square
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
Input Specification:
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Output Specification:
Write the needed number of flagstones.
Demo Input:
['6 6 4\n']
Demo Output:
['4\n']
Note:
none | ```python
n, m, a = input().split()
n, m, a = int(n), int(m), int(a)
x = (n + a - 1) / a
y = (m + a - 1) / a
print(int(x)*int(y))
``` | 3.9845 |
329 | A | Purification | PROGRAMMING | 1,500 | [
"constructive algorithms",
"greedy"
] | null | null | You are an adventurer currently journeying inside an evil temple. After defeating a couple of weak zombies, you arrived at a square room consisting of tiles forming an *n*<=×<=*n* grid. The rows are numbered 1 through *n* from top to bottom, and the columns are numbered 1 through *n* from left to right. At the far side of the room lies a door locked with evil magical forces. The following inscriptions are written on the door:
Being a very senior adventurer, you immediately realize what this means. You notice that every single cell in the grid are initially evil. You should purify all of these cells.
The only method of tile purification known to you is by casting the "Purification" spell. You cast this spell on a single tile — then, all cells that are located in the same row and all cells that are located in the same column as the selected tile become purified (including the selected tile)! It is allowed to purify a cell more than once.
You would like to purify all *n*<=×<=*n* cells while minimizing the number of times you cast the "Purification" spell. This sounds very easy, but you just noticed that some tiles are particularly more evil than the other tiles. You cannot cast the "Purification" spell on those particularly more evil tiles, not even after they have been purified. They can still be purified if a cell sharing the same row or the same column gets selected by the "Purification" spell.
Please find some way to purify all the cells with the minimum number of spells cast. Print -1 if there is no such way. | The first line will contain a single integer *n* (1<=≤<=*n*<=≤<=100). Then, *n* lines follows, each contains *n* characters. The *j*-th character in the *i*-th row represents the cell located at row *i* and column *j*. It will be the character 'E' if it is a particularly more evil cell, and '.' otherwise. | If there exists no way to purify all the cells, output -1. Otherwise, if your solution casts *x* "Purification" spells (where *x* is the minimum possible number of spells), output *x* lines. Each line should consist of two integers denoting the row and column numbers of the cell on which you should cast the "Purification" spell. | [
"3\n.E.\nE.E\n.E.\n",
"3\nEEE\nE..\nE.E\n",
"5\nEE.EE\nE.EE.\nE...E\n.EE.E\nEE.EE\n"
] | [
"1 1\n2 2\n3 3\n",
"-1\n",
"3 3\n1 3\n2 2\n4 4\n5 3"
] | The first example is illustrated as follows. Purple tiles are evil tiles that have not yet been purified. Red tile is the tile on which "Purification" is cast. Yellow tiles are the tiles being purified as a result of the current "Purification" spell. Green tiles are tiles that have been purified previously.
In the second example, it is impossible to purify the cell located at row 1 and column 1.
For the third example: | 500 | [
{
"input": "3\n.E.\nE.E\n.E.",
"output": "1 1\n2 2\n3 1"
},
{
"input": "3\nEEE\nE..\nE.E",
"output": "-1"
},
{
"input": "5\nEE.EE\nE.EE.\nE...E\n.EE.E\nEE.EE",
"output": "1 3\n2 2\n3 2\n4 1\n5 3"
},
{
"input": "3\n.EE\n.EE\n.EE",
"output": "1 1\n2 1\n3 1"
},
{
"input": "5\nEE.EE\nEE..E\nEEE..\nEE..E\nEE.EE",
"output": "1 3\n2 3\n3 4\n4 3\n5 3"
},
{
"input": "1\nE",
"output": "-1"
},
{
"input": "8\nE.EEE..E\nEEE.E.E.\nEEE.E.E.\nEE.E.E..\nE...EE..\nE.EE....\n..EE....\nE..E.EE.",
"output": "1 2\n2 4\n3 4\n4 3\n5 2\n6 2\n7 1\n8 2"
},
{
"input": "17\nEE...E.EE.EE..E..\nE.....EE..E..E..E\nEEEE.EEEE..E..E.E\n.E.E.EEE.EEEEE...\nEEEEEEEEEEEEEEEEE\nEE.E.EEEEE.E.....\n..E.EE.EEE.E....E\n.E..E..E...EE.E.E\nEEEE.EEE.E.EEEE..\n...E...EEEEEEE.E.\n..E.E.EE..E.EE..E\n.E..E..E.EEE.....\n.E.....E..EEE.EE.\nEE.E...E.EEEE.EE.\n...EEEEEEE.E..E.E\nEEEE.EEEEEE....E.\n..EEEEEEE....EEEE",
"output": "-1"
},
{
"input": "17\n.EEEEE...EEEE..EE\nEEE..E...EEEEE..E\n.E..E..EEE.EE...E\n.EEE.EE..EE...E..\nE..EEEEEE.EE.....\nE.EE...EEEEEEE.E.\nEEEE....EE..E.EEE\n...EEEEE.E..EE...\nEEE.E..EEEE.EEE..\n..E.E....EEE.....\nEE..E..E.E..EEEEE\nEEE..E.EEEEE.E...\n..EEEEE.E..EE.EE.\nEE.E...E..E..E.EE\n..E.EEE.EE..EE.E.\nE..EE........E.E.\nE..E..EEE.E...E..",
"output": "1 1\n2 4\n3 1\n4 1\n5 2\n6 2\n7 5\n8 1\n9 4\n10 1\n11 3\n12 4\n13 1\n14 3\n15 1\n16 2\n17 2"
},
{
"input": "1\n.",
"output": "1 1"
},
{
"input": "2\nEE\nEE",
"output": "-1"
},
{
"input": "2\n.E\n.E",
"output": "1 1\n2 1"
},
{
"input": "3\n.EE\nEEE\nEEE",
"output": "-1"
},
{
"input": "3\n...\nEEE\n..E",
"output": "1 1\n1 2\n1 3"
},
{
"input": "4\nE...\nE.EE\nEEEE\nEEEE",
"output": "-1"
},
{
"input": "4\n....\nE..E\nEEE.\n.EE.",
"output": "1 1\n2 2\n3 4\n4 1"
},
{
"input": "8\nE..EEEEE\nEE..EEE.\nEE..E...\nEEE.E..E\n.E.EEEE.\nEEEEEEEE\n.EEEE.EE\n.EE.E.E.",
"output": "-1"
},
{
"input": "3\nE..\nEEE\nE..",
"output": "-1"
},
{
"input": "4\nEEEE\n..E.\n..E.\n..E.",
"output": "-1"
},
{
"input": "3\n..E\n.EE\n.EE",
"output": "1 1\n2 1\n3 1"
},
{
"input": "6\n.EEEEE\n.EEEEE\n......\n......\n......\nEEEEEE",
"output": "1 1\n3 2\n3 3\n3 4\n3 5\n3 6"
}
] | 1,597,839,187 | 2,147,483,647 | Python 3 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | n=int(input())
s=[]
for i in range(n):
s.append(input())
r,cl=0,0
for i in range(n):
c=0
for j in range(n):
if s[i][j]=='E':
c=c+1
r=max(r,c)
for i in range(n):
c=0
for j in range(n):
if s[j][i]=='E':
c=c+1
cl=max(cl,c)
if r==n and cl==n:
print(-1)
else:
ans=[]
for i in range(n):
if s[i][i]!='E':
ans.append([i+1,i+1])
else:
for j in range(n):
if s[i][j]=='.':
ans.append([i+1,j+1])
break
for i in range(n):
print(ans[i][0],ans[i][1]) | Title: Purification
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are an adventurer currently journeying inside an evil temple. After defeating a couple of weak zombies, you arrived at a square room consisting of tiles forming an *n*<=×<=*n* grid. The rows are numbered 1 through *n* from top to bottom, and the columns are numbered 1 through *n* from left to right. At the far side of the room lies a door locked with evil magical forces. The following inscriptions are written on the door:
Being a very senior adventurer, you immediately realize what this means. You notice that every single cell in the grid are initially evil. You should purify all of these cells.
The only method of tile purification known to you is by casting the "Purification" spell. You cast this spell on a single tile — then, all cells that are located in the same row and all cells that are located in the same column as the selected tile become purified (including the selected tile)! It is allowed to purify a cell more than once.
You would like to purify all *n*<=×<=*n* cells while minimizing the number of times you cast the "Purification" spell. This sounds very easy, but you just noticed that some tiles are particularly more evil than the other tiles. You cannot cast the "Purification" spell on those particularly more evil tiles, not even after they have been purified. They can still be purified if a cell sharing the same row or the same column gets selected by the "Purification" spell.
Please find some way to purify all the cells with the minimum number of spells cast. Print -1 if there is no such way.
Input Specification:
The first line will contain a single integer *n* (1<=≤<=*n*<=≤<=100). Then, *n* lines follows, each contains *n* characters. The *j*-th character in the *i*-th row represents the cell located at row *i* and column *j*. It will be the character 'E' if it is a particularly more evil cell, and '.' otherwise.
Output Specification:
If there exists no way to purify all the cells, output -1. Otherwise, if your solution casts *x* "Purification" spells (where *x* is the minimum possible number of spells), output *x* lines. Each line should consist of two integers denoting the row and column numbers of the cell on which you should cast the "Purification" spell.
Demo Input:
['3\n.E.\nE.E\n.E.\n', '3\nEEE\nE..\nE.E\n', '5\nEE.EE\nE.EE.\nE...E\n.EE.E\nEE.EE\n']
Demo Output:
['1 1\n2 2\n3 3\n', '-1\n', '3 3\n1 3\n2 2\n4 4\n5 3']
Note:
The first example is illustrated as follows. Purple tiles are evil tiles that have not yet been purified. Red tile is the tile on which "Purification" is cast. Yellow tiles are the tiles being purified as a result of the current "Purification" spell. Green tiles are tiles that have been purified previously.
In the second example, it is impossible to purify the cell located at row 1 and column 1.
For the third example: | ```python
n=int(input())
s=[]
for i in range(n):
s.append(input())
r,cl=0,0
for i in range(n):
c=0
for j in range(n):
if s[i][j]=='E':
c=c+1
r=max(r,c)
for i in range(n):
c=0
for j in range(n):
if s[j][i]=='E':
c=c+1
cl=max(cl,c)
if r==n and cl==n:
print(-1)
else:
ans=[]
for i in range(n):
if s[i][i]!='E':
ans.append([i+1,i+1])
else:
for j in range(n):
if s[i][j]=='.':
ans.append([i+1,j+1])
break
for i in range(n):
print(ans[i][0],ans[i][1])
``` | -1 |
|
182 | A | Battlefield | PROGRAMMING | 2,200 | [
"geometry",
"graphs",
"implementation",
"shortest paths"
] | null | null | Vasya lagged behind at the University and got to the battlefield. Just joking! He's simply playing some computer game. The field is a flat platform with *n* trenches dug on it. The trenches are segments on a plane parallel to the coordinate axes. No two trenches intersect.
There is a huge enemy laser far away from Vasya. The laser charges for *a* seconds, and then shoots continuously for *b* seconds. Then, it charges for *a* seconds again. Then it shoots continuously for *b* seconds again and so on. Vasya knows numbers *a* and *b*. He also knows that while the laser is shooting, Vasya must be in the trench, but while the laser is charging, Vasya can safely move around the field. The main thing is to have time to hide in the trench before the shot. If Vasya reaches the trench exactly at the moment when the laser starts shooting, we believe that Vasya managed to hide. Coincidentally, the length of any trench in meters numerically does not exceed *b*.
Initially, Vasya is at point *A*. He needs to get to point *B*. Vasya moves at speed 1 meter per second in either direction. You can get in or out of the trench at any its point. Getting in or out of the trench takes no time. It is also possible to move in the trench, without leaving it.
What is the minimum time Vasya needs to get from point *A* to point *B*, if at the initial time the laser has just started charging? If Vasya cannot get from point *A* to point *B*, print -1. If Vasya reaches point *B* at the moment when the laser begins to shoot, it is believed that Vasya managed to reach point *B*. | The first line contains two space-separated integers: *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=1000), — the duration of charging and the duration of shooting, in seconds.
The second line contains four space-separated integers: *A**x*, *A**y*, *B**x*, *B**y* (<=-<=104<=≤<=*A**x*,<=*A**y*,<=*B**x*,<=*B**y*<=≤<=104) — the coordinates of points *А* and *B*. It is guaranteed that points *A* and *B* do not belong to any trench.
The third line contains a single integer: *n* (1<=≤<=*n*<=≤<=1000), — the number of trenches.
Each of the following *n* lines contains four space-separated integers: *x*1, *y*1, *x*2, *y*2 (<=-<=104<=≤<=*x**i*,<=*y**i*<=≤<=104) — the coordinates of ends of the corresponding trench.
All coordinates are given in meters. It is guaranteed that for any trench either *x*1<==<=*x*2, or *y*1<==<=*y*2. No two trenches intersect. The length of any trench in meters doesn't exceed *b* numerically. | If Vasya can get from point *A* to point *B*, print the minimum time he will need for it. Otherwise, print number -1.
The answer will be considered correct if the absolute or relative error does not exceed 10<=-<=4 | [
"2 4\n0 5 6 5\n3\n0 0 0 4\n1 1 4 1\n6 0 6 4\n",
"5 10\n0 0 10 10\n1\n5 0 5 9\n"
] | [
"19.0000000000\n",
"-1\n"
] | none | 3,000 | [] | 1,691,930,207 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 0 | 60 | 0 | print("_RANDOM_GUESS_1691930207.6039705")# 1691930207.603982 | Title: Battlefield
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya lagged behind at the University and got to the battlefield. Just joking! He's simply playing some computer game. The field is a flat platform with *n* trenches dug on it. The trenches are segments on a plane parallel to the coordinate axes. No two trenches intersect.
There is a huge enemy laser far away from Vasya. The laser charges for *a* seconds, and then shoots continuously for *b* seconds. Then, it charges for *a* seconds again. Then it shoots continuously for *b* seconds again and so on. Vasya knows numbers *a* and *b*. He also knows that while the laser is shooting, Vasya must be in the trench, but while the laser is charging, Vasya can safely move around the field. The main thing is to have time to hide in the trench before the shot. If Vasya reaches the trench exactly at the moment when the laser starts shooting, we believe that Vasya managed to hide. Coincidentally, the length of any trench in meters numerically does not exceed *b*.
Initially, Vasya is at point *A*. He needs to get to point *B*. Vasya moves at speed 1 meter per second in either direction. You can get in or out of the trench at any its point. Getting in or out of the trench takes no time. It is also possible to move in the trench, without leaving it.
What is the minimum time Vasya needs to get from point *A* to point *B*, if at the initial time the laser has just started charging? If Vasya cannot get from point *A* to point *B*, print -1. If Vasya reaches point *B* at the moment when the laser begins to shoot, it is believed that Vasya managed to reach point *B*.
Input Specification:
The first line contains two space-separated integers: *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=1000), — the duration of charging and the duration of shooting, in seconds.
The second line contains four space-separated integers: *A**x*, *A**y*, *B**x*, *B**y* (<=-<=104<=≤<=*A**x*,<=*A**y*,<=*B**x*,<=*B**y*<=≤<=104) — the coordinates of points *А* and *B*. It is guaranteed that points *A* and *B* do not belong to any trench.
The third line contains a single integer: *n* (1<=≤<=*n*<=≤<=1000), — the number of trenches.
Each of the following *n* lines contains four space-separated integers: *x*1, *y*1, *x*2, *y*2 (<=-<=104<=≤<=*x**i*,<=*y**i*<=≤<=104) — the coordinates of ends of the corresponding trench.
All coordinates are given in meters. It is guaranteed that for any trench either *x*1<==<=*x*2, or *y*1<==<=*y*2. No two trenches intersect. The length of any trench in meters doesn't exceed *b* numerically.
Output Specification:
If Vasya can get from point *A* to point *B*, print the minimum time he will need for it. Otherwise, print number -1.
The answer will be considered correct if the absolute or relative error does not exceed 10<=-<=4
Demo Input:
['2 4\n0 5 6 5\n3\n0 0 0 4\n1 1 4 1\n6 0 6 4\n', '5 10\n0 0 10 10\n1\n5 0 5 9\n']
Demo Output:
['19.0000000000\n', '-1\n']
Note:
none | ```python
print("_RANDOM_GUESS_1691930207.6039705")# 1691930207.603982
``` | 0 |
|
535 | B | Tavas and SaDDas | PROGRAMMING | 1,100 | [
"bitmasks",
"brute force",
"combinatorics",
"implementation"
] | null | null | Once again Tavas started eating coffee mix without water! Keione told him that it smells awful, but he didn't stop doing that. That's why Keione told his smart friend, SaDDas to punish him! SaDDas took Tavas' headphones and told him: "If you solve the following problem, I'll return it to you."
The problem is:
You are given a lucky number *n*. Lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
If we sort all lucky numbers in increasing order, what's the 1-based index of *n*?
Tavas is not as smart as SaDDas, so he asked you to do him a favor and solve this problem so he can have his headphones back. | The first and only line of input contains a lucky number *n* (1<=≤<=*n*<=≤<=109). | Print the index of *n* among all lucky numbers. | [
"4\n",
"7\n",
"77\n"
] | [
"1\n",
"2\n",
"6\n"
] | none | 1,000 | [
{
"input": "4",
"output": "1"
},
{
"input": "7",
"output": "2"
},
{
"input": "77",
"output": "6"
},
{
"input": "4",
"output": "1"
},
{
"input": "474744",
"output": "83"
},
{
"input": "777774",
"output": "125"
},
{
"input": "447",
"output": "8"
},
{
"input": "774",
"output": "13"
},
{
"input": "4",
"output": "1"
},
{
"input": "4447747",
"output": "140"
},
{
"input": "7747474",
"output": "233"
},
{
"input": "4444",
"output": "15"
},
{
"input": "4447",
"output": "16"
},
{
"input": "7",
"output": "2"
},
{
"input": "4",
"output": "1"
},
{
"input": "4447744",
"output": "139"
},
{
"input": "77474",
"output": "57"
},
{
"input": "7747",
"output": "28"
},
{
"input": "444",
"output": "7"
},
{
"input": "7",
"output": "2"
},
{
"input": "7774477",
"output": "242"
},
{
"input": "4477774",
"output": "157"
},
{
"input": "7444",
"output": "23"
},
{
"input": "7474747",
"output": "212"
},
{
"input": "77",
"output": "6"
},
{
"input": "774477",
"output": "114"
},
{
"input": "7",
"output": "2"
},
{
"input": "47",
"output": "4"
},
{
"input": "747777",
"output": "110"
},
{
"input": "444444444",
"output": "511"
},
{
"input": "777777777",
"output": "1022"
},
{
"input": "477477447",
"output": "728"
},
{
"input": "777744747",
"output": "996"
}
] | 1,592,690,410 | 2,147,483,647 | PyPy 3 | OK | TESTS | 33 | 155 | 0 | import math
def fact(n):
ans = 1
for i in range(2, n+1):
ans*= i
return ans
def comb(n, c):
return fact(n)//(fact(n-c)*c)
n= int(input())
if(n==4):
print(1)
elif(n==7):
print(2)
else:
add = 2
ans = 0
n = str(n)
for i in range(len(n)):
ans+=(2**i)
pos = (2**len(n))
left = 1
right = pos
i = 0
while(left < right and i < len(n)):
mid = (left+right)//2
if(n[i]=='4'):
right = mid
else:
left = mid+1
i+=1
ans+=left-1
print(ans) | Title: Tavas and SaDDas
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Once again Tavas started eating coffee mix without water! Keione told him that it smells awful, but he didn't stop doing that. That's why Keione told his smart friend, SaDDas to punish him! SaDDas took Tavas' headphones and told him: "If you solve the following problem, I'll return it to you."
The problem is:
You are given a lucky number *n*. Lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
If we sort all lucky numbers in increasing order, what's the 1-based index of *n*?
Tavas is not as smart as SaDDas, so he asked you to do him a favor and solve this problem so he can have his headphones back.
Input Specification:
The first and only line of input contains a lucky number *n* (1<=≤<=*n*<=≤<=109).
Output Specification:
Print the index of *n* among all lucky numbers.
Demo Input:
['4\n', '7\n', '77\n']
Demo Output:
['1\n', '2\n', '6\n']
Note:
none | ```python
import math
def fact(n):
ans = 1
for i in range(2, n+1):
ans*= i
return ans
def comb(n, c):
return fact(n)//(fact(n-c)*c)
n= int(input())
if(n==4):
print(1)
elif(n==7):
print(2)
else:
add = 2
ans = 0
n = str(n)
for i in range(len(n)):
ans+=(2**i)
pos = (2**len(n))
left = 1
right = pos
i = 0
while(left < right and i < len(n)):
mid = (left+right)//2
if(n[i]=='4'):
right = mid
else:
left = mid+1
i+=1
ans+=left-1
print(ans)
``` | 3 |
|
519 | C | A and B and Team Training | PROGRAMMING | 1,300 | [
"greedy",
"implementation",
"math",
"number theory"
] | null | null | A and B are preparing themselves for programming contests.
An important part of preparing for a competition is sharing programming knowledge from the experienced members to those who are just beginning to deal with the contests. Therefore, during the next team training A decided to make teams so that newbies are solving problems together with experienced participants.
A believes that the optimal team of three people should consist of one experienced participant and two newbies. Thus, each experienced participant can share the experience with a large number of people.
However, B believes that the optimal team should have two experienced members plus one newbie. Thus, each newbie can gain more knowledge and experience.
As a result, A and B have decided that all the teams during the training session should belong to one of the two types described above. Furthermore, they agree that the total number of teams should be as much as possible.
There are *n* experienced members and *m* newbies on the training session. Can you calculate what maximum number of teams can be formed? | The first line contains two integers *n* and *m* (0<=≤<=*n*,<=*m*<=≤<=5·105) — the number of experienced participants and newbies that are present at the training session. | Print the maximum number of teams that can be formed. | [
"2 6\n",
"4 5\n"
] | [
"2\n",
"3\n"
] | Let's represent the experienced players as XP and newbies as NB.
In the first test the teams look as follows: (XP, NB, NB), (XP, NB, NB).
In the second test sample the teams look as follows: (XP, NB, NB), (XP, NB, NB), (XP, XP, NB). | 1,500 | [
{
"input": "2 6",
"output": "2"
},
{
"input": "4 5",
"output": "3"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "3 3",
"output": "2"
},
{
"input": "500000 500000",
"output": "333333"
},
{
"input": "70 100",
"output": "56"
},
{
"input": "5 12525",
"output": "5"
},
{
"input": "10 5",
"output": "5"
},
{
"input": "5 10",
"output": "5"
},
{
"input": "0 0",
"output": "0"
},
{
"input": "0 1",
"output": "0"
},
{
"input": "1 0",
"output": "0"
},
{
"input": "0 21233",
"output": "0"
},
{
"input": "12523 0",
"output": "0"
},
{
"input": "1231 1253",
"output": "828"
},
{
"input": "500000 0",
"output": "0"
},
{
"input": "1 500000",
"output": "1"
},
{
"input": "250000 500000",
"output": "250000"
},
{
"input": "500000 250000",
"output": "250000"
},
{
"input": "33333 77777",
"output": "33333"
},
{
"input": "30900 174529",
"output": "30900"
},
{
"input": "89979 57154",
"output": "49044"
},
{
"input": "231646 398487",
"output": "210044"
},
{
"input": "332019 281112",
"output": "204377"
},
{
"input": "473686 122443",
"output": "122443"
},
{
"input": "481245 86879",
"output": "86879"
},
{
"input": "39935 123534",
"output": "39935"
},
{
"input": "10000 20000",
"output": "10000"
},
{
"input": "10000 20001",
"output": "10000"
},
{
"input": "10000 20002",
"output": "10000"
},
{
"input": "10000 20003",
"output": "10000"
},
{
"input": "10000 20004",
"output": "10000"
},
{
"input": "10001 20000",
"output": "10000"
},
{
"input": "10001 20001",
"output": "10000"
},
{
"input": "10001 20002",
"output": "10001"
},
{
"input": "10001 20003",
"output": "10001"
},
{
"input": "10001 20004",
"output": "10001"
},
{
"input": "20000 10000",
"output": "10000"
},
{
"input": "20001 10000",
"output": "10000"
},
{
"input": "20002 10000",
"output": "10000"
},
{
"input": "20003 10000",
"output": "10000"
},
{
"input": "20004 10000",
"output": "10000"
},
{
"input": "20000 10001",
"output": "10000"
},
{
"input": "20001 10001",
"output": "10000"
},
{
"input": "20002 10001",
"output": "10001"
},
{
"input": "20003 10001",
"output": "10001"
},
{
"input": "20004 10001",
"output": "10001"
},
{
"input": "10 0",
"output": "0"
},
{
"input": "0 6",
"output": "0"
},
{
"input": "2 3",
"output": "1"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "0 0",
"output": "0"
}
] | 1,630,038,165 | 2,147,483,647 | PyPy 3 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | #include <bits/stdc++.h>
#define ll long long
//#define int ll
#define pb push_back
#define fi first
#define se second
#define debug(x) cout << x << "\n"
#define yes() cout << "YES\n"
#define no() cout << "NO\n"
#define pi 3.1415926535897932384626433832795028841971693993751
using namespace std;
void solve () {
int n, m; cin >> n >> m;
int ans = 0;
for (int i = 0; i <= n; i++) {
if (m - 2 * i >= 0) {
ans = max(ans, i + min((n - i) / 2, m - 2 * i));
}
}
debug(ans);
}
signed main () {
ios::sync_with_stdio(0);
cin.tie(0); cout.tie(0);
int t = 1;
// cin >> t;
while (t--) {
solve();
}
} | Title: A and B and Team Training
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A and B are preparing themselves for programming contests.
An important part of preparing for a competition is sharing programming knowledge from the experienced members to those who are just beginning to deal with the contests. Therefore, during the next team training A decided to make teams so that newbies are solving problems together with experienced participants.
A believes that the optimal team of three people should consist of one experienced participant and two newbies. Thus, each experienced participant can share the experience with a large number of people.
However, B believes that the optimal team should have two experienced members plus one newbie. Thus, each newbie can gain more knowledge and experience.
As a result, A and B have decided that all the teams during the training session should belong to one of the two types described above. Furthermore, they agree that the total number of teams should be as much as possible.
There are *n* experienced members and *m* newbies on the training session. Can you calculate what maximum number of teams can be formed?
Input Specification:
The first line contains two integers *n* and *m* (0<=≤<=*n*,<=*m*<=≤<=5·105) — the number of experienced participants and newbies that are present at the training session.
Output Specification:
Print the maximum number of teams that can be formed.
Demo Input:
['2 6\n', '4 5\n']
Demo Output:
['2\n', '3\n']
Note:
Let's represent the experienced players as XP and newbies as NB.
In the first test the teams look as follows: (XP, NB, NB), (XP, NB, NB).
In the second test sample the teams look as follows: (XP, NB, NB), (XP, NB, NB), (XP, XP, NB). | ```python
#include <bits/stdc++.h>
#define ll long long
//#define int ll
#define pb push_back
#define fi first
#define se second
#define debug(x) cout << x << "\n"
#define yes() cout << "YES\n"
#define no() cout << "NO\n"
#define pi 3.1415926535897932384626433832795028841971693993751
using namespace std;
void solve () {
int n, m; cin >> n >> m;
int ans = 0;
for (int i = 0; i <= n; i++) {
if (m - 2 * i >= 0) {
ans = max(ans, i + min((n - i) / 2, m - 2 * i));
}
}
debug(ans);
}
signed main () {
ios::sync_with_stdio(0);
cin.tie(0); cout.tie(0);
int t = 1;
// cin >> t;
while (t--) {
solve();
}
}
``` | -1 |
|
791 | A | Bear and Big Brother | PROGRAMMING | 800 | [
"implementation"
] | null | null | Bear Limak wants to become the largest of bears, or at least to become larger than his brother Bob.
Right now, Limak and Bob weigh *a* and *b* respectively. It's guaranteed that Limak's weight is smaller than or equal to his brother's weight.
Limak eats a lot and his weight is tripled after every year, while Bob's weight is doubled after every year.
After how many full years will Limak become strictly larger (strictly heavier) than Bob? | The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10) — the weight of Limak and the weight of Bob respectively. | Print one integer, denoting the integer number of years after which Limak will become strictly larger than Bob. | [
"4 7\n",
"4 9\n",
"1 1\n"
] | [
"2\n",
"3\n",
"1\n"
] | In the first sample, Limak weighs 4 and Bob weighs 7 initially. After one year their weights are 4·3 = 12 and 7·2 = 14 respectively (one weight is tripled while the other one is doubled). Limak isn't larger than Bob yet. After the second year weights are 36 and 28, so the first weight is greater than the second one. Limak became larger than Bob after two years so you should print 2.
In the second sample, Limak's and Bob's weights in next years are: 12 and 18, then 36 and 36, and finally 108 and 72 (after three years). The answer is 3. Remember that Limak wants to be larger than Bob and he won't be satisfied with equal weights.
In the third sample, Limak becomes larger than Bob after the first year. Their weights will be 3 and 2 then. | 500 | [
{
"input": "4 7",
"output": "2"
},
{
"input": "4 9",
"output": "3"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "4 6",
"output": "2"
},
{
"input": "1 10",
"output": "6"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1 2",
"output": "2"
},
{
"input": "1 3",
"output": "3"
},
{
"input": "1 4",
"output": "4"
},
{
"input": "1 5",
"output": "4"
},
{
"input": "1 6",
"output": "5"
},
{
"input": "1 7",
"output": "5"
},
{
"input": "1 8",
"output": "6"
},
{
"input": "1 9",
"output": "6"
},
{
"input": "1 10",
"output": "6"
},
{
"input": "2 2",
"output": "1"
},
{
"input": "2 3",
"output": "2"
},
{
"input": "2 4",
"output": "2"
},
{
"input": "2 5",
"output": "3"
},
{
"input": "2 6",
"output": "3"
},
{
"input": "2 7",
"output": "4"
},
{
"input": "2 8",
"output": "4"
},
{
"input": "2 9",
"output": "4"
},
{
"input": "2 10",
"output": "4"
},
{
"input": "3 3",
"output": "1"
},
{
"input": "3 4",
"output": "1"
},
{
"input": "3 5",
"output": "2"
},
{
"input": "3 6",
"output": "2"
},
{
"input": "3 7",
"output": "3"
},
{
"input": "3 8",
"output": "3"
},
{
"input": "3 9",
"output": "3"
},
{
"input": "3 10",
"output": "3"
},
{
"input": "4 4",
"output": "1"
},
{
"input": "4 5",
"output": "1"
},
{
"input": "4 6",
"output": "2"
},
{
"input": "4 7",
"output": "2"
},
{
"input": "4 8",
"output": "2"
},
{
"input": "4 9",
"output": "3"
},
{
"input": "4 10",
"output": "3"
},
{
"input": "5 5",
"output": "1"
},
{
"input": "5 6",
"output": "1"
},
{
"input": "5 7",
"output": "1"
},
{
"input": "5 8",
"output": "2"
},
{
"input": "5 9",
"output": "2"
},
{
"input": "5 10",
"output": "2"
},
{
"input": "6 6",
"output": "1"
},
{
"input": "6 7",
"output": "1"
},
{
"input": "6 8",
"output": "1"
},
{
"input": "6 9",
"output": "2"
},
{
"input": "6 10",
"output": "2"
},
{
"input": "7 7",
"output": "1"
},
{
"input": "7 8",
"output": "1"
},
{
"input": "7 9",
"output": "1"
},
{
"input": "7 10",
"output": "1"
},
{
"input": "8 8",
"output": "1"
},
{
"input": "8 9",
"output": "1"
},
{
"input": "8 10",
"output": "1"
},
{
"input": "9 9",
"output": "1"
},
{
"input": "9 10",
"output": "1"
},
{
"input": "10 10",
"output": "1"
},
{
"input": "10 10",
"output": "1"
},
{
"input": "1 2",
"output": "2"
}
] | 1,699,221,255 | 2,147,483,647 | Python 3 | MEMORY_LIMIT_EXCEEDED | TESTS | 0 | 249 | 268,390,400 | def eat(L, B):
years = 0
while L < B:
L = L * 3
B = B * 2
years += 1
return (years)
Limak, Bob = input().split()
print (eat(Limak, Bob)) | Title: Bear and Big Brother
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bear Limak wants to become the largest of bears, or at least to become larger than his brother Bob.
Right now, Limak and Bob weigh *a* and *b* respectively. It's guaranteed that Limak's weight is smaller than or equal to his brother's weight.
Limak eats a lot and his weight is tripled after every year, while Bob's weight is doubled after every year.
After how many full years will Limak become strictly larger (strictly heavier) than Bob?
Input Specification:
The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10) — the weight of Limak and the weight of Bob respectively.
Output Specification:
Print one integer, denoting the integer number of years after which Limak will become strictly larger than Bob.
Demo Input:
['4 7\n', '4 9\n', '1 1\n']
Demo Output:
['2\n', '3\n', '1\n']
Note:
In the first sample, Limak weighs 4 and Bob weighs 7 initially. After one year their weights are 4·3 = 12 and 7·2 = 14 respectively (one weight is tripled while the other one is doubled). Limak isn't larger than Bob yet. After the second year weights are 36 and 28, so the first weight is greater than the second one. Limak became larger than Bob after two years so you should print 2.
In the second sample, Limak's and Bob's weights in next years are: 12 and 18, then 36 and 36, and finally 108 and 72 (after three years). The answer is 3. Remember that Limak wants to be larger than Bob and he won't be satisfied with equal weights.
In the third sample, Limak becomes larger than Bob after the first year. Their weights will be 3 and 2 then. | ```python
def eat(L, B):
years = 0
while L < B:
L = L * 3
B = B * 2
years += 1
return (years)
Limak, Bob = input().split()
print (eat(Limak, Bob))
``` | 0 |
|
322 | B | Ciel and Flowers | PROGRAMMING | 1,600 | [
"combinatorics",
"math"
] | null | null | Fox Ciel has some flowers: *r* red flowers, *g* green flowers and *b* blue flowers. She wants to use these flowers to make several bouquets. There are 4 types of bouquets:
- To make a "red bouquet", it needs 3 red flowers. - To make a "green bouquet", it needs 3 green flowers. - To make a "blue bouquet", it needs 3 blue flowers. - To make a "mixing bouquet", it needs 1 red, 1 green and 1 blue flower.
Help Fox Ciel to find the maximal number of bouquets she can make. | The first line contains three integers *r*, *g* and *b* (0<=≤<=*r*,<=*g*,<=*b*<=≤<=109) — the number of red, green and blue flowers. | Print the maximal number of bouquets Fox Ciel can make. | [
"3 6 9\n",
"4 4 4\n",
"0 0 0\n"
] | [
"6\n",
"4\n",
"0\n"
] | In test case 1, we can make 1 red bouquet, 2 green bouquets and 3 blue bouquets.
In test case 2, we can make 1 red, 1 green, 1 blue and 1 mixing bouquet. | 1,000 | [
{
"input": "3 6 9",
"output": "6"
},
{
"input": "4 4 4",
"output": "4"
},
{
"input": "0 0 0",
"output": "0"
},
{
"input": "0 3 6",
"output": "3"
},
{
"input": "7 8 9",
"output": "7"
},
{
"input": "8 8 9",
"output": "8"
},
{
"input": "15 3 999",
"output": "339"
},
{
"input": "32 62 92",
"output": "62"
},
{
"input": "123456789 123456789 123456789",
"output": "123456789"
},
{
"input": "3 5 5",
"output": "4"
},
{
"input": "666806767 385540591 357848286",
"output": "470065214"
},
{
"input": "80010646 727118126 817880463",
"output": "541669744"
},
{
"input": "829651016 732259171 572879931",
"output": "711596705"
},
{
"input": "242854896 442432924 180395753",
"output": "288561190"
},
{
"input": "139978911 5123031 935395222",
"output": "360165721"
},
{
"input": "553182792 10264076 395427398",
"output": "319624755"
},
{
"input": "597790453 720437830 855459575",
"output": "724562619"
},
{
"input": "494914467 356982656 757942689",
"output": "536613270"
},
{
"input": "908118348 67156409 217974865",
"output": "397749873"
},
{
"input": "952726009 629846517 972974334",
"output": "851848953"
},
{
"input": "775140200 616574841 630329230",
"output": "674014756"
},
{
"input": "524780569 326748594 90361407",
"output": "313963523"
},
{
"input": "937984449 184405994 992844522",
"output": "705078321"
},
{
"input": "835108464 525983528 452876698",
"output": "604656229"
},
{
"input": "879716125 531124573 207876166",
"output": "539572288"
},
{
"input": "292920005 241298326 667908343",
"output": "400708891"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1000000000"
},
{
"input": "1000000000 999999999 999999998",
"output": "999999998"
},
{
"input": "999999998 999999998 999999999",
"output": "999999998"
},
{
"input": "0 1 1",
"output": "0"
},
{
"input": "0 1000000000 0",
"output": "333333333"
},
{
"input": "0 1 0",
"output": "0"
},
{
"input": "1 0 0",
"output": "0"
},
{
"input": "0 2 2",
"output": "0"
},
{
"input": "3 3 5",
"output": "3"
},
{
"input": "2 2 0",
"output": "0"
},
{
"input": "0 5 5",
"output": "2"
},
{
"input": "2 0 11",
"output": "3"
},
{
"input": "9 9 7",
"output": "8"
},
{
"input": "65 30 74",
"output": "56"
}
] | 1,586,513,175 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 4 | 186 | 0 | f = list(map(int,input().split()))
count = f[0]//3
c = f[0]%3
count1 = f[1]//3
c1 = f[1]%3
count2 = f[2]//3
c2 = f[2]%3
g = (c+c1+c2)//3
print(g+count+count1+count2)
| Title: Ciel and Flowers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Fox Ciel has some flowers: *r* red flowers, *g* green flowers and *b* blue flowers. She wants to use these flowers to make several bouquets. There are 4 types of bouquets:
- To make a "red bouquet", it needs 3 red flowers. - To make a "green bouquet", it needs 3 green flowers. - To make a "blue bouquet", it needs 3 blue flowers. - To make a "mixing bouquet", it needs 1 red, 1 green and 1 blue flower.
Help Fox Ciel to find the maximal number of bouquets she can make.
Input Specification:
The first line contains three integers *r*, *g* and *b* (0<=≤<=*r*,<=*g*,<=*b*<=≤<=109) — the number of red, green and blue flowers.
Output Specification:
Print the maximal number of bouquets Fox Ciel can make.
Demo Input:
['3 6 9\n', '4 4 4\n', '0 0 0\n']
Demo Output:
['6\n', '4\n', '0\n']
Note:
In test case 1, we can make 1 red bouquet, 2 green bouquets and 3 blue bouquets.
In test case 2, we can make 1 red, 1 green, 1 blue and 1 mixing bouquet. | ```python
f = list(map(int,input().split()))
count = f[0]//3
c = f[0]%3
count1 = f[1]//3
c1 = f[1]%3
count2 = f[2]//3
c2 = f[2]%3
g = (c+c1+c2)//3
print(g+count+count1+count2)
``` | 0 |
|
801 | B | Valued Keys | PROGRAMMING | 900 | [
"constructive algorithms",
"greedy",
"strings"
] | null | null | You found a mysterious function *f*. The function takes two strings *s*1 and *s*2. These strings must consist only of lowercase English letters, and must be the same length.
The output of the function *f* is another string of the same length. The *i*-th character of the output is equal to the minimum of the *i*-th character of *s*1 and the *i*-th character of *s*2.
For example, *f*("ab", "ba") = "aa", and *f*("nzwzl", "zizez") = "niwel".
You found two strings *x* and *y* of the same length and consisting of only lowercase English letters. Find any string *z* such that *f*(*x*,<=*z*)<==<=*y*, or print -1 if no such string *z* exists. | The first line of input contains the string *x*.
The second line of input contains the string *y*.
Both *x* and *y* consist only of lowercase English letters, *x* and *y* have same length and this length is between 1 and 100. | If there is no string *z* such that *f*(*x*,<=*z*)<==<=*y*, print -1.
Otherwise, print a string *z* such that *f*(*x*,<=*z*)<==<=*y*. If there are multiple possible answers, print any of them. The string *z* should be the same length as *x* and *y* and consist only of lowercase English letters. | [
"ab\naa\n",
"nzwzl\nniwel\n",
"ab\nba\n"
] | [
"ba\n",
"xiyez\n",
"-1\n"
] | The first case is from the statement.
Another solution for the second case is "zizez"
There is no solution for the third case. That is, there is no *z* such that *f*("ab", *z*) = "ba". | 1,000 | [
{
"input": "ab\naa",
"output": "ba"
},
{
"input": "nzwzl\nniwel",
"output": "xiyez"
},
{
"input": "ab\nba",
"output": "-1"
},
{
"input": "r\nl",
"output": "l"
},
{
"input": "d\ny",
"output": "-1"
},
{
"input": "yvowz\ncajav",
"output": "cajav"
},
{
"input": "lwzjp\ninjit",
"output": "-1"
},
{
"input": "epqnlxmiicdidyscjaxqznwur\neodnlemiicdedmkcgavqbnqmm",
"output": "eodnlemiicdedmkcgavqbnqmm"
},
{
"input": "qqdabbsxiibnnjgsgxllfvdqj\nuxmypqtwfdezewdxfgplannrs",
"output": "-1"
},
{
"input": "aanerbaqslfmqmuciqbxyznkevukvznpkmxlcorpmrenwxhzfgbmlfpxtkqpxdrmcqcmbf\naanebbaqkgfiimcciqbaoznkeqqkrgapdillccrfeienwbcvfgbmlfbimkqchcrmclcmbf",
"output": "aanebbaqkgfiimcciqbaoznkeqqkrgapdillccrfeienwbcvfgbmlfbimkqchcrmclcmbf"
},
{
"input": "mbyrkhjctrcrayisflptgfudwgrtegidhqicsjqafvdloritbjhciyxuwavxknezwwudnk\nvvixsutlbdewqoabqhpuerfkzrddcqptfwmxdlxwbvsaqfjoxztlddvwgflcteqbwaiaen",
"output": "-1"
},
{
"input": "eufycwztywhbjrpqobvknwfqmnboqcfdiahkagykeibbsqpljcghhmsgfmswwsanzyiwtvuirwmppfivtekaywkzskyydfvkjgxb\necfwavookadbcilfobojnweqinbcpcfdiahkabwkeibbacpljcghhksgfajgmianfnivmhfifogpffiheegayfkxkkcmdfvihgdb",
"output": "ecfwavookadbcilfobojnweqinbcpcfdiahkabwkeibbacpljcghhksgfajgmianfnivmhfifogpffiheegayfkxkkcmdfvihgdb"
},
{
"input": "qvpltcffyeghtbdhjyhfteojezyzziardduzrbwuxmzzkkoehfnxecafizxglboauhynfbawlfxenmykquyhrxswhjuovvogntok\nchvkcvzxptbcepdjfezcpuvtehewbnvqeoezlcnzhpfwujbmhafoeqmjhtwisnobauinkzyigrvahpuetkgpdjfgbzficsmuqnym",
"output": "-1"
},
{
"input": "nmuwjdihouqrnsuahimssnrbxdpwvxiyqtenahtrlshjkmnfuttnpqhgcagoptinnaptxaccptparldzrhpgbyrzedghudtsswxi\nnilhbdghosqnbebafimconrbvdodjsipqmekahhrllhjkemeketapfhgcagopfidnahtlaccpfpafedqicpcbvfgedghudhddwib",
"output": "nilhbdghosqnbebafimconrbvdodjsipqmekahhrllhjkemeketapfhgcagopfidnahtlaccpfpafedqicpcbvfgedghudhddwib"
},
{
"input": "dyxgwupoauwqtcfoyfjdotzirwztdfrueqiypxoqvkmhiehdppwtdoxrbfvtairdbuvlqohjflznggjpifhwjrshcrfbjtklpykx\ngzqlnoizhxolnditjdhlhptjsbczehicudoybzilwnshmywozwnwuipcgirgzldtvtowdsokfeafggwserzdazkxyddjttiopeew",
"output": "-1"
},
{
"input": "hbgwuqzougqzlxemvyjpeizjfwhgugrfnhbrlxkmkdalikfyunppwgdzmalbwewybnjzqsohwhjkdcyhhzmysflambvhpsjilsyv\nfbdjdqjojdafarakvcjpeipjfehgfgrfehbolxkmkdagikflunnpvadocalbkedibhbflmohnhjkdcthhaigsfjaibqhbcjelirv",
"output": "fbdjdqjojdafarakvcjpeipjfehgfgrfehbolxkmkdagikflunnpvadocalbkedibhbflmohnhjkdcthhaigsfjaibqhbcjelirv"
},
{
"input": "xnjjhjfuhgyxqhpzmvgbaohqarugdoaczcfecofltwemieyxolswkcwhlfagfrgmoiqrgftokbqwtxgxzweozzlikrvafiabivlk\npjfosalbsitcnqiazhmepfifjxvmazvdgffcnozmnqubhonwjldmpdsjagmamniylzjdbklcyrzivjyzgnogahobpkwpwpvraqns",
"output": "-1"
},
{
"input": "zrvzedssbsrfldqvjpgmsefrmsatspzoitwvymahiptphiystjlsauzquzqqbmljobdhijcpdvatorwmyojqgnezvzlgjibxepcf\npesoedmqbmffldqsjggmhefkadaesijointrkmahapaahiysfjdiaupqujngbjhjobdhiecadeatgjvelojjgnepvajgeibfepaf",
"output": "pesoedmqbmffldqsjggmhefkadaesijointrkmahapaahiysfjdiaupqujngbjhjobdhiecadeatgjvelojjgnepvajgeibfepaf"
},
{
"input": "pdvkuwyzntzfqpblzmbynknyhlnqbxijuqaincviugxohcsrofozrrsategwkbwxcvkyzxhurokefpbdnmcfogfhsojayysqbrow\nbvxruombdrywlcjkrltyayaazwpauuhbtgwfzdrmfwwucgffucwelzvpsdgtapogchblzahsrfymjlaghkbmbssghrpxalkslcvp",
"output": "-1"
},
{
"input": "tgharsjyihroiiahwgbjezlxvlterxivdhtzjcqegzmtigqmrehvhiyjeywegxaseoyoacouijudbiruoghgxvxadwzgdxtnxlds\ntghaksjsdhkoiiahegbjexlfrctercipdhmvjbgegxdtggqdpbhvhiseehhegnaseoooacnsijubbirjnghgsvpadhaadrtimfdp",
"output": "tghaksjsdhkoiiahegbjexlfrctercipdhmvjbgegxdtggqdpbhvhiseehhegnaseoooacnsijubbirjnghgsvpadhaadrtimfdp"
},
{
"input": "jsinejpfwhzloulxndzvzftgogfdagrsscxmatldssqsgaknnbkcvhptebjjpkjhrjegrotzwcdosezkedzxeoyibmyzunkguoqj\nkfmvybobocdpipiripysioruqvloopvbggpjksgmwzyqwyxnesmvhsawnbbmntulspvsysfkjqwpvoelliopbaukyagedextzoej",
"output": "-1"
},
{
"input": "nttdcfceptruiomtmwzestrfchnqpgqeztpcvthzelfyggjgqadylzubpvbrlgndrcsursczpxlnoyoadxezncqalupfzmjeqihe\nkttdcfceohrjiaahmoldanpfchnfpgheqpdahqhxecfpbgigqadrkjubjfbrlgndbcgcgmcjpeleinaadretncqaiqpfkmjeqihe",
"output": "kttdcfceohrjiaahmoldanpfchnfpgheqpdahqhxecfpbgigqadrkjubjfbrlgndbcgcgmcjpeleinaadretncqaiqpfkmjeqihe"
},
{
"input": "diuopwglduasnaxgduwslbzoyayoypzznqspljcyqehweydhlwifcvnjmaowuvyqfwynjghecqvxdvuquuwpvwrjljozocaxnktv\ntrdydprdzmjhgbhzytelrfjpgsebijicsigmwhynmcyjtqrvojcndodchzxfcvyqjxqzwibccdvsjqhsnectdjyrrhzkeamukang",
"output": "-1"
},
{
"input": "ftfr\nftfr",
"output": "ftfr"
},
{
"input": "ftr\nftr",
"output": "ftr"
},
{
"input": "shftr\nshftr",
"output": "shftr"
},
{
"input": "vkvkkv\nvkvkkv",
"output": "vkvkkv"
},
{
"input": "ftrd\nftrd",
"output": "ftrd"
},
{
"input": "fztr\nfztr",
"output": "fztr"
},
{
"input": "frtr\nfrtr",
"output": "frtr"
},
{
"input": "shdftr\nshdftr",
"output": "shdftr"
},
{
"input": "zzz\nzzz",
"output": "zzz"
},
{
"input": "shtr\nshtr",
"output": "shtr"
},
{
"input": "aaaaa\nzzzzz",
"output": "-1"
},
{
"input": "efr\nefr",
"output": "efr"
}
] | 1,555,572,580 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 3 | 93 | 0 | x=input()
y=input()
z=''
for i in range(len(x)):
if(x[i]==y[i]):
z+='z'
elif(x[i]!=y[i]):
z+=y[i]
if(z==y):
print("-1")
else:
print(z)
| Title: Valued Keys
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You found a mysterious function *f*. The function takes two strings *s*1 and *s*2. These strings must consist only of lowercase English letters, and must be the same length.
The output of the function *f* is another string of the same length. The *i*-th character of the output is equal to the minimum of the *i*-th character of *s*1 and the *i*-th character of *s*2.
For example, *f*("ab", "ba") = "aa", and *f*("nzwzl", "zizez") = "niwel".
You found two strings *x* and *y* of the same length and consisting of only lowercase English letters. Find any string *z* such that *f*(*x*,<=*z*)<==<=*y*, or print -1 if no such string *z* exists.
Input Specification:
The first line of input contains the string *x*.
The second line of input contains the string *y*.
Both *x* and *y* consist only of lowercase English letters, *x* and *y* have same length and this length is between 1 and 100.
Output Specification:
If there is no string *z* such that *f*(*x*,<=*z*)<==<=*y*, print -1.
Otherwise, print a string *z* such that *f*(*x*,<=*z*)<==<=*y*. If there are multiple possible answers, print any of them. The string *z* should be the same length as *x* and *y* and consist only of lowercase English letters.
Demo Input:
['ab\naa\n', 'nzwzl\nniwel\n', 'ab\nba\n']
Demo Output:
['ba\n', 'xiyez\n', '-1\n']
Note:
The first case is from the statement.
Another solution for the second case is "zizez"
There is no solution for the third case. That is, there is no *z* such that *f*("ab", *z*) = "ba". | ```python
x=input()
y=input()
z=''
for i in range(len(x)):
if(x[i]==y[i]):
z+='z'
elif(x[i]!=y[i]):
z+=y[i]
if(z==y):
print("-1")
else:
print(z)
``` | 0 |
|
796 | A | Buying A House | PROGRAMMING | 800 | [
"brute force",
"implementation"
] | null | null | Zane the wizard had never loved anyone before, until he fell in love with a girl, whose name remains unknown to us.
The girl lives in house *m* of a village. There are *n* houses in that village, lining in a straight line from left to right: house 1, house 2, ..., house *n*. The village is also well-structured: house *i* and house *i*<=+<=1 (1<=≤<=*i*<=<<=*n*) are exactly 10 meters away. In this village, some houses are occupied, and some are not. Indeed, unoccupied houses can be purchased.
You will be given *n* integers *a*1,<=*a*2,<=...,<=*a**n* that denote the availability and the prices of the houses. If house *i* is occupied, and therefore cannot be bought, then *a**i* equals 0. Otherwise, house *i* can be bought, and *a**i* represents the money required to buy it, in dollars.
As Zane has only *k* dollars to spare, it becomes a challenge for him to choose the house to purchase, so that he could live as near as possible to his crush. Help Zane determine the minimum distance from his crush's house to some house he can afford, to help him succeed in his love. | The first line contains three integers *n*, *m*, and *k* (2<=≤<=*n*<=≤<=100, 1<=≤<=*m*<=≤<=*n*, 1<=≤<=*k*<=≤<=100) — the number of houses in the village, the house where the girl lives, and the amount of money Zane has (in dollars), respectively.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=100) — denoting the availability and the prices of the houses.
It is guaranteed that *a**m*<==<=0 and that it is possible to purchase some house with no more than *k* dollars. | Print one integer — the minimum distance, in meters, from the house where the girl Zane likes lives to the house Zane can buy. | [
"5 1 20\n0 27 32 21 19\n",
"7 3 50\n62 0 0 0 99 33 22\n",
"10 5 100\n1 0 1 0 0 0 0 0 1 1\n"
] | [
"40",
"30",
"20"
] | In the first sample, with *k* = 20 dollars, Zane can buy only house 5. The distance from house *m* = 1 to house 5 is 10 + 10 + 10 + 10 = 40 meters.
In the second sample, Zane can buy houses 6 and 7. It is better to buy house 6 than house 7, since house *m* = 3 and house 6 are only 30 meters away, while house *m* = 3 and house 7 are 40 meters away. | 500 | [
{
"input": "5 1 20\n0 27 32 21 19",
"output": "40"
},
{
"input": "7 3 50\n62 0 0 0 99 33 22",
"output": "30"
},
{
"input": "10 5 100\n1 0 1 0 0 0 0 0 1 1",
"output": "20"
},
{
"input": "5 3 1\n1 1 0 0 1",
"output": "10"
},
{
"input": "5 5 5\n1 0 5 6 0",
"output": "20"
},
{
"input": "15 10 50\n20 0 49 50 50 50 50 50 50 0 50 50 49 0 20",
"output": "10"
},
{
"input": "7 5 1\n0 100 2 2 0 2 1",
"output": "20"
},
{
"input": "100 50 100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 0 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "10"
},
{
"input": "100 50 1\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 0 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "490"
},
{
"input": "100 77 50\n50 100 49 51 0 50 100 49 51 0 50 100 49 51 0 50 100 49 51 0 50 100 49 51 0 50 100 49 51 0 50 100 49 51 0 50 100 49 51 0 50 100 49 51 0 50 100 49 51 0 50 100 49 51 0 50 100 49 51 0 50 100 49 51 0 50 100 49 51 0 50 100 49 51 0 50 0 49 51 0 50 100 49 51 0 50 100 49 51 0 50 100 49 51 0 50 100 49 51 0",
"output": "10"
},
{
"input": "100 1 1\n0 98 97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 80 79 78 77 76 75 74 73 72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 0",
"output": "980"
},
{
"input": "100 1 100\n0 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "10"
},
{
"input": "100 10 99\n0 0 0 0 0 0 0 0 0 0 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 99 98",
"output": "890"
},
{
"input": "7 4 5\n1 0 6 0 5 6 0",
"output": "10"
},
{
"input": "7 4 5\n1 6 5 0 0 6 0",
"output": "10"
},
{
"input": "100 42 59\n50 50 50 50 50 50 50 50 50 50 59 59 59 59 59 59 59 59 59 59 59 59 59 59 59 59 59 59 59 59 59 59 59 60 60 60 60 60 60 60 60 0 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 60 0",
"output": "90"
},
{
"input": "2 1 100\n0 1",
"output": "10"
},
{
"input": "2 2 100\n1 0",
"output": "10"
},
{
"input": "10 1 88\n0 95 0 0 0 0 0 94 0 85",
"output": "90"
},
{
"input": "10 2 14\n2 0 1 26 77 39 41 100 13 32",
"output": "10"
},
{
"input": "10 3 11\n0 0 0 0 0 62 0 52 1 35",
"output": "60"
},
{
"input": "20 12 44\n27 40 58 69 53 38 31 39 75 95 8 0 28 81 77 90 38 61 21 88",
"output": "10"
},
{
"input": "30 29 10\n59 79 34 12 100 6 1 58 18 73 54 11 37 46 89 90 80 85 73 45 64 5 31 0 89 19 0 74 0 82",
"output": "70"
},
{
"input": "40 22 1\n7 95 44 53 0 0 19 93 0 68 65 0 24 91 10 58 17 0 71 0 100 0 94 90 79 73 0 73 4 61 54 81 7 13 21 84 5 41 0 1",
"output": "180"
},
{
"input": "40 22 99\n60 0 100 0 0 100 100 0 0 0 0 100 100 0 0 100 100 0 100 100 100 0 100 100 100 0 100 100 0 0 100 100 100 0 0 100 0 100 0 0",
"output": "210"
},
{
"input": "50 10 82\n56 54 0 0 0 0 88 93 0 0 83 93 0 0 91 89 0 30 62 52 24 84 80 8 38 13 92 78 16 87 23 30 71 55 16 63 15 99 4 93 24 6 3 35 4 42 73 27 86 37",
"output": "80"
},
{
"input": "63 49 22\n18 3 97 52 75 2 12 24 58 75 80 97 22 10 79 51 30 60 68 99 75 2 35 3 97 88 9 7 18 5 0 0 0 91 0 91 56 36 76 0 0 0 52 27 35 0 51 72 0 96 57 0 0 0 0 92 55 28 0 30 0 78 77",
"output": "190"
},
{
"input": "74 38 51\n53 36 55 42 64 5 87 9 0 16 86 78 9 22 19 1 25 72 1 0 0 0 79 0 0 0 77 58 70 0 0 100 64 0 99 59 0 0 0 0 65 74 0 96 0 58 89 93 61 88 0 0 82 89 0 0 49 24 7 77 89 87 94 61 100 31 93 70 39 49 39 14 20 84",
"output": "190"
},
{
"input": "89 22 11\n36 0 68 89 0 85 72 0 38 56 0 44 0 94 0 28 71 0 0 18 0 0 0 89 0 0 0 75 0 0 0 32 66 0 0 0 0 0 0 48 63 0 64 58 0 23 48 0 0 52 93 61 57 0 18 0 0 34 62 17 0 41 0 0 53 59 44 0 0 51 40 0 0 100 100 54 0 88 0 5 45 56 57 67 24 16 88 86 15",
"output": "580"
},
{
"input": "97 44 100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 51 19",
"output": "520"
},
{
"input": "100 1 1\n0 0 0 0 10 54 84 6 17 94 65 82 34 0 61 46 42 0 2 16 56 0 100 0 82 0 0 0 89 78 96 56 0 0 0 0 0 0 0 0 77 70 0 96 67 0 0 32 44 1 72 50 14 11 24 61 100 64 19 5 67 69 44 82 93 22 67 93 22 61 53 64 79 41 84 48 43 97 7 24 8 49 23 16 72 52 97 29 69 47 29 49 64 91 4 73 17 18 51 67",
"output": "490"
},
{
"input": "100 1 50\n0 0 0 60 0 0 54 0 80 0 0 0 97 0 68 97 84 0 0 93 0 0 0 0 68 0 0 62 0 0 55 68 65 87 0 69 0 0 0 0 0 52 61 100 0 71 0 82 88 78 0 81 0 95 0 57 0 67 0 0 0 55 86 0 60 72 0 0 73 0 83 0 0 60 64 0 56 0 0 77 84 0 58 63 84 0 0 67 0 16 3 88 0 98 31 52 40 35 85 23",
"output": "890"
},
{
"input": "100 1 100\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 91 70 14",
"output": "970"
},
{
"input": "100 1 29\n0 0 0 0 64 0 89 97 0 0 0 59 0 67 62 0 59 0 0 80 0 0 0 0 0 97 0 57 0 64 32 0 44 0 0 48 0 47 38 0 42 0 0 0 0 0 0 46 74 0 86 33 33 0 44 0 79 0 0 0 0 91 59 0 59 65 55 0 0 58 33 95 0 97 76 0 81 0 41 0 38 81 80 0 85 0 31 0 0 92 0 0 45 96 0 85 91 87 0 10",
"output": "990"
},
{
"input": "100 50 20\n3 0 32 0 48 32 64 0 54 26 0 0 0 0 0 28 0 0 54 0 0 45 49 0 38 74 0 0 39 42 62 48 75 96 89 42 0 44 0 0 30 21 76 0 50 0 79 0 0 0 0 99 0 84 62 0 0 0 0 53 80 0 28 0 0 53 0 0 38 0 62 0 0 62 0 0 88 0 44 32 0 81 35 45 49 0 69 73 38 27 72 0 96 72 69 0 0 22 76 10",
"output": "490"
},
{
"input": "100 50 20\n49 0 56 0 87 25 40 0 50 0 0 97 0 0 36 29 0 0 0 0 0 73 29 71 44 0 0 0 91 92 69 0 0 60 81 49 48 38 0 87 0 82 0 32 0 82 46 39 0 0 29 0 0 29 0 79 47 0 0 0 0 0 49 0 24 33 70 0 63 45 97 90 0 0 29 53 55 0 84 0 0 100 26 0 88 0 0 0 0 81 70 0 30 80 0 75 59 98 0 2",
"output": "500"
},
{
"input": "100 2 2\n0 0 43 90 47 5 2 97 52 69 21 48 64 10 34 97 97 74 8 19 68 56 55 24 47 38 43 73 72 72 60 60 51 36 33 44 100 45 13 54 72 52 0 15 3 6 50 8 88 4 78 26 40 27 30 63 67 83 61 91 33 97 54 20 92 27 89 35 10 7 84 50 11 95 74 88 24 44 74 100 18 56 34 91 41 34 51 51 11 91 89 54 19 100 83 89 10 17 76 20",
"output": "50"
},
{
"input": "100 100 34\n5 73 0 0 44 0 0 0 79 55 0 0 0 0 0 0 0 0 83 67 75 0 0 0 0 59 0 74 0 0 47 98 0 0 72 41 0 55 87 0 0 78 84 0 0 39 0 79 72 95 0 0 0 0 0 85 53 84 0 0 0 0 37 75 0 66 0 0 0 0 61 0 70 0 37 60 42 78 92 52 0 0 0 55 77 57 0 63 37 0 0 0 96 70 0 94 97 0 0 0",
"output": "990"
},
{
"input": "100 100 100\n43 79 21 87 84 14 28 69 92 16 3 71 79 37 48 37 72 58 12 72 62 49 37 17 60 54 41 99 15 72 40 89 76 1 99 87 14 56 63 48 69 37 96 64 7 14 1 73 85 33 98 70 97 71 96 28 49 71 56 2 67 22 100 2 98 100 62 77 92 76 98 98 47 26 22 47 50 56 9 16 72 47 5 62 29 78 81 1 0 63 32 65 87 3 40 53 8 80 93 0",
"output": "10"
},
{
"input": "100 38 1\n3 59 12 81 33 95 0 41 36 17 63 76 42 77 85 56 3 96 55 41 24 87 18 9 0 37 0 61 69 0 0 0 67 0 0 0 0 0 0 18 0 0 47 56 74 0 0 80 0 42 0 1 60 59 62 9 19 87 92 48 58 30 98 51 99 10 42 94 51 53 50 89 24 5 52 82 50 39 98 8 95 4 57 21 10 0 44 32 19 14 64 34 79 76 17 3 15 22 71 51",
"output": "140"
},
{
"input": "100 72 1\n56 98 8 27 9 23 16 76 56 1 34 43 96 73 75 49 62 20 18 23 51 55 30 84 4 20 89 40 75 16 69 35 1 0 16 0 80 0 41 17 0 0 76 23 0 92 0 34 0 91 82 54 0 0 0 63 85 59 98 24 29 0 8 77 26 0 34 95 39 0 0 0 74 0 0 0 0 12 0 92 0 0 55 95 66 30 0 0 29 98 0 0 0 47 0 0 80 0 0 4",
"output": "390"
},
{
"input": "100 66 1\n38 50 64 91 37 44 74 21 14 41 80 90 26 51 78 85 80 86 44 14 49 75 93 48 78 89 23 72 35 22 14 48 100 71 62 22 7 95 80 66 32 20 17 47 79 30 41 52 15 62 67 71 1 6 0 9 0 0 0 11 0 0 24 0 31 0 77 0 51 0 0 0 0 0 0 77 0 36 44 19 90 45 6 25 100 87 93 30 4 97 36 88 33 50 26 71 97 71 51 68",
"output": "130"
},
{
"input": "100 55 1\n0 33 45 83 56 96 58 24 45 30 38 60 39 69 21 87 59 21 72 73 27 46 61 61 11 97 77 5 39 3 3 35 76 37 53 84 24 75 9 48 31 90 100 84 74 81 83 83 42 23 29 94 18 1 0 53 52 99 86 37 94 54 28 75 28 80 17 14 98 68 76 20 32 23 42 31 57 79 60 14 18 27 1 98 32 3 96 25 15 38 2 6 3 28 59 54 63 2 43 59",
"output": "10"
},
{
"input": "100 55 1\n24 52 41 6 55 11 58 25 63 12 70 39 23 28 72 17 96 85 7 84 21 13 34 37 97 43 36 32 15 30 58 5 14 71 40 70 9 92 44 73 31 58 96 90 19 35 29 91 25 36 48 95 61 78 0 1 99 61 81 88 42 53 61 57 42 55 74 45 41 92 99 30 20 25 89 50 37 4 17 24 6 65 15 44 40 2 38 43 7 90 38 59 75 87 96 28 12 67 24 32",
"output": "10"
},
{
"input": "100 21 1\n62 5 97 80 81 28 83 0 26 0 0 0 0 23 0 0 90 0 0 0 0 0 0 0 0 54 71 8 0 0 42 0 73 0 17 0 1 31 71 78 58 72 84 39 54 59 13 29 16 41 71 35 88 55 70 50 33 100 100 60 52 90 7 66 44 55 51 42 90 17 86 44 46 8 52 74 8 22 2 92 34 37 58 98 70 74 19 91 74 25 4 38 71 68 50 68 63 14 60 98",
"output": "160"
},
{
"input": "5 2 20\n27 0 32 21 19",
"output": "30"
},
{
"input": "6 4 10\n10 0 0 0 0 10",
"output": "20"
},
{
"input": "8 7 100\n1 0 0 0 0 0 0 1",
"output": "10"
},
{
"input": "5 3 20\n1 21 0 0 1",
"output": "20"
},
{
"input": "4 3 1\n0 0 0 1",
"output": "10"
},
{
"input": "5 2 3\n4 0 5 6 1",
"output": "30"
},
{
"input": "5 3 87\n88 89 0 1 90",
"output": "10"
},
{
"input": "5 3 20\n15 30 0 15 35",
"output": "10"
},
{
"input": "6 3 50\n0 0 0 1 2 0",
"output": "10"
},
{
"input": "6 4 9\n100 9 10 0 0 9",
"output": "20"
},
{
"input": "5 4 20\n0 20 0 0 20",
"output": "10"
},
{
"input": "6 3 3\n1 5 0 2 2 0",
"output": "10"
},
{
"input": "5 4 100\n0 1 0 0 1",
"output": "10"
}
] | 1,497,513,713 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 4 | 62 | 0 | (n,m,k) = (int(i) for i in input().split())
dms = [int(i) for i in input().split()]
right = -1
rastr = -1
left = -1
rastl = -1
for i in range(m, n):
if dms[i]!=0 and dms[i]<=k:
right = i
rastr = i+1-m
break
for i in range(m-1,max(m-rastr,0)-1,-1):
if dms[i]!=0 and dms[i]<=k:
rastl = m-1-i
if (rastr!=-1) and (rastr<rastl or rastl==-1):
print(rastr*10)
else:
if rastl==-1:
print('False')
else:
print(rastl*10) | Title: Buying A House
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Zane the wizard had never loved anyone before, until he fell in love with a girl, whose name remains unknown to us.
The girl lives in house *m* of a village. There are *n* houses in that village, lining in a straight line from left to right: house 1, house 2, ..., house *n*. The village is also well-structured: house *i* and house *i*<=+<=1 (1<=≤<=*i*<=<<=*n*) are exactly 10 meters away. In this village, some houses are occupied, and some are not. Indeed, unoccupied houses can be purchased.
You will be given *n* integers *a*1,<=*a*2,<=...,<=*a**n* that denote the availability and the prices of the houses. If house *i* is occupied, and therefore cannot be bought, then *a**i* equals 0. Otherwise, house *i* can be bought, and *a**i* represents the money required to buy it, in dollars.
As Zane has only *k* dollars to spare, it becomes a challenge for him to choose the house to purchase, so that he could live as near as possible to his crush. Help Zane determine the minimum distance from his crush's house to some house he can afford, to help him succeed in his love.
Input Specification:
The first line contains three integers *n*, *m*, and *k* (2<=≤<=*n*<=≤<=100, 1<=≤<=*m*<=≤<=*n*, 1<=≤<=*k*<=≤<=100) — the number of houses in the village, the house where the girl lives, and the amount of money Zane has (in dollars), respectively.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=100) — denoting the availability and the prices of the houses.
It is guaranteed that *a**m*<==<=0 and that it is possible to purchase some house with no more than *k* dollars.
Output Specification:
Print one integer — the minimum distance, in meters, from the house where the girl Zane likes lives to the house Zane can buy.
Demo Input:
['5 1 20\n0 27 32 21 19\n', '7 3 50\n62 0 0 0 99 33 22\n', '10 5 100\n1 0 1 0 0 0 0 0 1 1\n']
Demo Output:
['40', '30', '20']
Note:
In the first sample, with *k* = 20 dollars, Zane can buy only house 5. The distance from house *m* = 1 to house 5 is 10 + 10 + 10 + 10 = 40 meters.
In the second sample, Zane can buy houses 6 and 7. It is better to buy house 6 than house 7, since house *m* = 3 and house 6 are only 30 meters away, while house *m* = 3 and house 7 are 40 meters away. | ```python
(n,m,k) = (int(i) for i in input().split())
dms = [int(i) for i in input().split()]
right = -1
rastr = -1
left = -1
rastl = -1
for i in range(m, n):
if dms[i]!=0 and dms[i]<=k:
right = i
rastr = i+1-m
break
for i in range(m-1,max(m-rastr,0)-1,-1):
if dms[i]!=0 and dms[i]<=k:
rastl = m-1-i
if (rastr!=-1) and (rastr<rastl or rastl==-1):
print(rastr*10)
else:
if rastl==-1:
print('False')
else:
print(rastl*10)
``` | 0 |
|
961 | A | Tetris | PROGRAMMING | 900 | [
"implementation"
] | null | null | You are given a following process.
There is a platform with $n$ columns. $1 \times 1$ squares are appearing one after another in some columns on this platform. If there are no squares in the column, a square will occupy the bottom row. Otherwise a square will appear at the top of the highest square of this column.
When all of the $n$ columns have at least one square in them, the bottom row is being removed. You will receive $1$ point for this, and all the squares left will fall down one row.
You task is to calculate the amount of points you will receive. | The first line of input contain 2 integer numbers $n$ and $m$ ($1 \le n, m \le 1000$) — the length of the platform and the number of the squares.
The next line contain $m$ integer numbers $c_1, c_2, \dots, c_m$ ($1 \le c_i \le n$) — column in which $i$-th square will appear. | Print one integer — the amount of points you will receive. | [
"3 9\n1 1 2 2 2 3 1 2 3\n"
] | [
"2\n"
] | In the sample case the answer will be equal to $2$ because after the appearing of $6$-th square will be removed one row (counts of the squares on the platform will look like $[2~ 3~ 1]$, and after removing one row will be $[1~ 2~ 0]$).
After the appearing of $9$-th square counts will be $[2~ 3~ 1]$, and after removing one row it will look like $[1~ 2~ 0]$.
So the answer will be equal to $2$. | 0 | [
{
"input": "3 9\n1 1 2 2 2 3 1 2 3",
"output": "2"
},
{
"input": "1 7\n1 1 1 1 1 1 1",
"output": "7"
},
{
"input": "1 1\n1",
"output": "1"
},
{
"input": "3 5\n1 1 1 2 3",
"output": "1"
},
{
"input": "4 6\n4 4 4 4 4 4",
"output": "0"
},
{
"input": "4 6\n2 3 4 4 4 4",
"output": "0"
},
{
"input": "3 12\n1 1 1 1 2 2 2 2 3 3 3 3",
"output": "4"
},
{
"input": "8 8\n2 2 3 4 5 6 7 8",
"output": "0"
},
{
"input": "100 1\n50",
"output": "0"
},
{
"input": "2 1\n2",
"output": "0"
},
{
"input": "2 1\n1",
"output": "0"
},
{
"input": "2 4\n1 2 1 1",
"output": "1"
},
{
"input": "3 4\n3 2 2 2",
"output": "0"
},
{
"input": "2 2\n2 2",
"output": "0"
},
{
"input": "2 5\n2 1 1 2 1",
"output": "2"
},
{
"input": "15 3\n13 14 15",
"output": "0"
},
{
"input": "4 9\n1 2 3 1 2 3 1 2 3",
"output": "0"
},
{
"input": "100 3\n1 2 3",
"output": "0"
},
{
"input": "1000 10\n999 999 998 34 454 546 343 35 34 1000",
"output": "0"
},
{
"input": "4 2\n1 2",
"output": "0"
}
] | 1,553,590,097 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 93 | 0 | n,m=map(int,input().split())
mas=[0]*(n)
mas[0]=10**5
a=list(map(int,input.split()))
for i in a:
mas[i]+=1
print(min(mas)) | Title: Tetris
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given a following process.
There is a platform with $n$ columns. $1 \times 1$ squares are appearing one after another in some columns on this platform. If there are no squares in the column, a square will occupy the bottom row. Otherwise a square will appear at the top of the highest square of this column.
When all of the $n$ columns have at least one square in them, the bottom row is being removed. You will receive $1$ point for this, and all the squares left will fall down one row.
You task is to calculate the amount of points you will receive.
Input Specification:
The first line of input contain 2 integer numbers $n$ and $m$ ($1 \le n, m \le 1000$) — the length of the platform and the number of the squares.
The next line contain $m$ integer numbers $c_1, c_2, \dots, c_m$ ($1 \le c_i \le n$) — column in which $i$-th square will appear.
Output Specification:
Print one integer — the amount of points you will receive.
Demo Input:
['3 9\n1 1 2 2 2 3 1 2 3\n']
Demo Output:
['2\n']
Note:
In the sample case the answer will be equal to $2$ because after the appearing of $6$-th square will be removed one row (counts of the squares on the platform will look like $[2~ 3~ 1]$, and after removing one row will be $[1~ 2~ 0]$).
After the appearing of $9$-th square counts will be $[2~ 3~ 1]$, and after removing one row it will look like $[1~ 2~ 0]$.
So the answer will be equal to $2$. | ```python
n,m=map(int,input().split())
mas=[0]*(n)
mas[0]=10**5
a=list(map(int,input.split()))
for i in a:
mas[i]+=1
print(min(mas))
``` | -1 |
|
620 | A | Professor GukiZ's Robot | PROGRAMMING | 800 | [
"implementation",
"math"
] | null | null | Professor GukiZ makes a new robot. The robot are in the point with coordinates (*x*1,<=*y*1) and should go to the point (*x*2,<=*y*2). In a single step the robot can change any of its coordinates (maybe both of them) by one (decrease or increase). So the robot can move in one of the 8 directions. Find the minimal number of steps the robot should make to get the finish position. | The first line contains two integers *x*1,<=*y*1 (<=-<=109<=≤<=*x*1,<=*y*1<=≤<=109) — the start position of the robot.
The second line contains two integers *x*2,<=*y*2 (<=-<=109<=≤<=*x*2,<=*y*2<=≤<=109) — the finish position of the robot. | Print the only integer *d* — the minimal number of steps to get the finish position. | [
"0 0\n4 5\n",
"3 4\n6 1\n"
] | [
"5\n",
"3\n"
] | In the first example robot should increase both of its coordinates by one four times, so it will be in position (4, 4). After that robot should simply increase its *y* coordinate and get the finish position.
In the second example robot should simultaneously increase *x* coordinate and decrease *y* coordinate by one three times. | 0 | [
{
"input": "0 0\n4 5",
"output": "5"
},
{
"input": "3 4\n6 1",
"output": "3"
},
{
"input": "0 0\n4 6",
"output": "6"
},
{
"input": "1 1\n-3 -5",
"output": "6"
},
{
"input": "-1 -1\n-10 100",
"output": "101"
},
{
"input": "1 -1\n100 -100",
"output": "99"
},
{
"input": "-1000000000 -1000000000\n1000000000 1000000000",
"output": "2000000000"
},
{
"input": "-1000000000 -1000000000\n0 999999999",
"output": "1999999999"
},
{
"input": "0 0\n2 1",
"output": "2"
},
{
"input": "10 0\n100 0",
"output": "90"
},
{
"input": "1 5\n6 4",
"output": "5"
},
{
"input": "0 0\n5 4",
"output": "5"
},
{
"input": "10 1\n20 1",
"output": "10"
},
{
"input": "1 1\n-3 4",
"output": "4"
},
{
"input": "-863407280 504312726\n786535210 -661703810",
"output": "1649942490"
},
{
"input": "-588306085 -741137832\n341385643 152943311",
"output": "929691728"
},
{
"input": "0 0\n4 0",
"output": "4"
},
{
"input": "93097194 -48405232\n-716984003 -428596062",
"output": "810081197"
},
{
"input": "9 1\n1 1",
"output": "8"
},
{
"input": "4 6\n0 4",
"output": "4"
},
{
"input": "2 4\n5 2",
"output": "3"
},
{
"input": "-100000000 -100000000\n100000000 100000123",
"output": "200000123"
},
{
"input": "5 6\n5 7",
"output": "1"
},
{
"input": "12 16\n12 1",
"output": "15"
},
{
"input": "0 0\n5 1",
"output": "5"
},
{
"input": "0 1\n1 1",
"output": "1"
},
{
"input": "-44602634 913365223\n-572368780 933284951",
"output": "527766146"
},
{
"input": "-2 0\n2 -2",
"output": "4"
},
{
"input": "0 0\n3 1",
"output": "3"
},
{
"input": "-458 2\n1255 4548",
"output": "4546"
},
{
"input": "-5 -4\n-3 -3",
"output": "2"
},
{
"input": "4 5\n7 3",
"output": "3"
},
{
"input": "-1000000000 -999999999\n1000000000 999999998",
"output": "2000000000"
},
{
"input": "-1000000000 -1000000000\n1000000000 -1000000000",
"output": "2000000000"
},
{
"input": "-464122675 -898521847\n656107323 -625340409",
"output": "1120229998"
},
{
"input": "-463154699 -654742385\n-699179052 -789004997",
"output": "236024353"
},
{
"input": "982747270 -593488945\n342286841 -593604186",
"output": "640460429"
},
{
"input": "-80625246 708958515\n468950878 574646184",
"output": "549576124"
},
{
"input": "0 0\n1 0",
"output": "1"
},
{
"input": "109810 1\n2 3",
"output": "109808"
},
{
"input": "-9 0\n9 9",
"output": "18"
},
{
"input": "9 9\n9 9",
"output": "0"
},
{
"input": "1 1\n4 3",
"output": "3"
},
{
"input": "1 2\n45 1",
"output": "44"
},
{
"input": "207558188 -313753260\n-211535387 -721675423",
"output": "419093575"
},
{
"input": "-11 0\n0 0",
"output": "11"
},
{
"input": "-1000000000 1000000000\n1000000000 -1000000000",
"output": "2000000000"
},
{
"input": "0 0\n1 1",
"output": "1"
},
{
"input": "0 0\n0 1",
"output": "1"
},
{
"input": "0 0\n-1 1",
"output": "1"
},
{
"input": "0 0\n-1 0",
"output": "1"
},
{
"input": "0 0\n-1 -1",
"output": "1"
},
{
"input": "0 0\n0 -1",
"output": "1"
},
{
"input": "0 0\n1 -1",
"output": "1"
},
{
"input": "10 90\n90 10",
"output": "80"
},
{
"input": "851016864 573579544\n-761410925 -380746263",
"output": "1612427789"
},
{
"input": "1 9\n9 9",
"output": "8"
},
{
"input": "1000 1000\n1000 1000",
"output": "0"
},
{
"input": "1 9\n9 1",
"output": "8"
},
{
"input": "1 90\n90 90",
"output": "89"
},
{
"input": "100 100\n1000 1000",
"output": "900"
},
{
"input": "-1 0\n0 0",
"output": "1"
},
{
"input": "-750595959 -2984043\n649569876 -749608783",
"output": "1400165835"
},
{
"input": "958048496 712083589\n423286949 810566863",
"output": "534761547"
},
{
"input": "146316710 53945094\n-523054748 147499505",
"output": "669371458"
},
{
"input": "50383856 -596516251\n-802950224 -557916272",
"output": "853334080"
},
{
"input": "-637204864 -280290367\n-119020929 153679771",
"output": "518183935"
},
{
"input": "-100 -100\n-60 -91",
"output": "40"
},
{
"input": "337537326 74909428\n-765558776 167951547",
"output": "1103096102"
},
{
"input": "0 81\n18 90",
"output": "18"
},
{
"input": "283722202 -902633305\n-831696497 -160868946",
"output": "1115418699"
},
{
"input": "1000 1000\n-1000 1000",
"output": "2000"
},
{
"input": "5 6\n4 8",
"output": "2"
},
{
"input": "40572000 597493595\n-935051731 368493185",
"output": "975623731"
},
{
"input": "-5 5\n5 5",
"output": "10"
}
] | 1,453,615,685 | 2,147,483,647 | Python 3 | OK | TESTS | 75 | 62 | 0 | x1, y1 = list(map(int, input().split()))
x2, y2 = list(map(int, input().split()))
print(max(abs(x1-x2), abs(y1-y2))) | Title: Professor GukiZ's Robot
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Professor GukiZ makes a new robot. The robot are in the point with coordinates (*x*1,<=*y*1) and should go to the point (*x*2,<=*y*2). In a single step the robot can change any of its coordinates (maybe both of them) by one (decrease or increase). So the robot can move in one of the 8 directions. Find the minimal number of steps the robot should make to get the finish position.
Input Specification:
The first line contains two integers *x*1,<=*y*1 (<=-<=109<=≤<=*x*1,<=*y*1<=≤<=109) — the start position of the robot.
The second line contains two integers *x*2,<=*y*2 (<=-<=109<=≤<=*x*2,<=*y*2<=≤<=109) — the finish position of the robot.
Output Specification:
Print the only integer *d* — the minimal number of steps to get the finish position.
Demo Input:
['0 0\n4 5\n', '3 4\n6 1\n']
Demo Output:
['5\n', '3\n']
Note:
In the first example robot should increase both of its coordinates by one four times, so it will be in position (4, 4). After that robot should simply increase its *y* coordinate and get the finish position.
In the second example robot should simultaneously increase *x* coordinate and decrease *y* coordinate by one three times. | ```python
x1, y1 = list(map(int, input().split()))
x2, y2 = list(map(int, input().split()))
print(max(abs(x1-x2), abs(y1-y2)))
``` | 3 |
|
856 | B | Similar Words | PROGRAMMING | 2,300 | [
"dp",
"hashing",
"strings",
"trees"
] | null | null | Let us call a non-empty sequence of lowercase English letters a word. Prefix of a word *x* is a word *y* that can be obtained from *x* by removing zero or more last letters of *x*.
Let us call two words similar, if one of them can be obtained from the other by removing its first letter.
You are given a set *S* of words. Find the maximal possible size of set of non-empty words *X* such that they satisfy the following:
- each word of *X* is prefix of some word from *S*; - *X* has no similar words. | Input data contains multiple test cases. The first line of the input data contains an integer *t* — the number of test cases. The descriptions of test cases follow.
The first line of each description contains an integer *n* — the number of words in the set *S* (1<=≤<=*n*<=≤<=106). Each of the following *n* lines contains one non-empty word — elements of *S*. All words in *S* are different.
It is guaranteed that the total length of all words in one input data doesn't exceed 106. | For each test case print one line that contains one integer *m* — the maximal number of words that *X* can contain. | [
"2\n3\naba\nbaba\naaab\n2\naa\na\n"
] | [
"6\n1\n"
] | none | 0 | [] | 1,691,862,211 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 0 | 30 | 0 | print("_RANDOM_GUESS_1691862211.6091032")# 1691862211.60912 | Title: Similar Words
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Let us call a non-empty sequence of lowercase English letters a word. Prefix of a word *x* is a word *y* that can be obtained from *x* by removing zero or more last letters of *x*.
Let us call two words similar, if one of them can be obtained from the other by removing its first letter.
You are given a set *S* of words. Find the maximal possible size of set of non-empty words *X* such that they satisfy the following:
- each word of *X* is prefix of some word from *S*; - *X* has no similar words.
Input Specification:
Input data contains multiple test cases. The first line of the input data contains an integer *t* — the number of test cases. The descriptions of test cases follow.
The first line of each description contains an integer *n* — the number of words in the set *S* (1<=≤<=*n*<=≤<=106). Each of the following *n* lines contains one non-empty word — elements of *S*. All words in *S* are different.
It is guaranteed that the total length of all words in one input data doesn't exceed 106.
Output Specification:
For each test case print one line that contains one integer *m* — the maximal number of words that *X* can contain.
Demo Input:
['2\n3\naba\nbaba\naaab\n2\naa\na\n']
Demo Output:
['6\n1\n']
Note:
none | ```python
print("_RANDOM_GUESS_1691862211.6091032")# 1691862211.60912
``` | 0 |
|
894 | A | QAQ | PROGRAMMING | 800 | [
"brute force",
"dp"
] | null | null | "QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth.
Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!).
Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact. | The only line contains a string of length *n* (1<=≤<=*n*<=≤<=100). It's guaranteed that the string only contains uppercase English letters. | Print a single integer — the number of subsequences "QAQ" in the string. | [
"QAQAQYSYIOIWIN\n",
"QAQQQZZYNOIWIN\n"
] | [
"4\n",
"3\n"
] | In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN". | 500 | [
{
"input": "QAQAQYSYIOIWIN",
"output": "4"
},
{
"input": "QAQQQZZYNOIWIN",
"output": "3"
},
{
"input": "QA",
"output": "0"
},
{
"input": "IAQVAQZLQBQVQFTQQQADAQJA",
"output": "24"
},
{
"input": "QQAAQASGAYAAAAKAKAQIQEAQAIAAIAQQQQQ",
"output": "378"
},
{
"input": "AMVFNFJIAVNQJWIVONQOAOOQSNQSONOASONAONQINAONAOIQONANOIQOANOQINAONOQINAONOXJCOIAQOAOQAQAQAQAQWWWAQQAQ",
"output": "1077"
},
{
"input": "AAQQAXBQQBQQXBNQRJAQKQNAQNQVDQASAGGANQQQQTJFFQQQTQQA",
"output": "568"
},
{
"input": "KAZXAVLPJQBQVQQQQQAPAQQGQTQVZQAAAOYA",
"output": "70"
},
{
"input": "W",
"output": "0"
},
{
"input": "DBA",
"output": "0"
},
{
"input": "RQAWNACASAAKAGAAAAQ",
"output": "10"
},
{
"input": "QJAWZAAOAAGIAAAAAOQATASQAEAAAAQFQQHPA",
"output": "111"
},
{
"input": "QQKWQAQAAAAAAAAGAAVAQUEQQUMQMAQQQNQLAMAAAUAEAAEMAAA",
"output": "411"
},
{
"input": "QQUMQAYAUAAGWAAAQSDAVAAQAAAASKQJJQQQQMAWAYYAAAAAAEAJAXWQQ",
"output": "625"
},
{
"input": "QORZOYAQ",
"output": "1"
},
{
"input": "QCQAQAGAWAQQQAQAVQAQQQQAQAQQQAQAAATQAAVAAAQQQQAAAUUQAQQNQQWQQWAQAAQQKQYAQAAQQQAAQRAQQQWBQQQQAPBAQGQA",
"output": "13174"
},
{
"input": "QQAQQAKQFAQLQAAWAMQAZQAJQAAQQOACQQAAAYANAQAQQAQAAQQAOBQQJQAQAQAQQQAAAAABQQQAVNZAQQQQAMQQAFAAEAQAQHQT",
"output": "10420"
},
{
"input": "AQEGQHQQKQAQQPQKAQQQAAAAQQQAQEQAAQAAQAQFSLAAQQAQOQQAVQAAAPQQAWAQAQAFQAXAQQQQTRLOQAQQJQNQXQQQQSQVDQQQ",
"output": "12488"
},
{
"input": "QNQKQQQLASQBAVQQQQAAQQOQRJQQAQQQEQZUOANAADAAQQJAQAQARAAAQQQEQBHTQAAQAAAAQQMKQQQIAOJJQQAQAAADADQUQQQA",
"output": "9114"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "35937"
},
{
"input": "AMQQAAQAAQAAAAAAQQQBOAAANAAKQJCYQAE",
"output": "254"
},
{
"input": "AYQBAEQGAQEOAKGIXLQJAIAKQAAAQPUAJAKAATFWQQAOQQQUFQYAQQMQHOKAAJXGFCARAQSATHAUQQAATQJJQDQRAANQQAE",
"output": "2174"
},
{
"input": "AAQXAAQAYQAAAAGAQHVQYAGIVACADFAAQAAAAQZAAQMAKZAADQAQDAAQDAAAMQQOXYAQQQAKQBAAQQKAXQBJZDDLAAHQQ",
"output": "2962"
},
{
"input": "AYQQYAVAMNIAUAAKBBQVACWKTQSAQZAAQAAASZJAWBCAALAARHACQAKQQAQAARPAQAAQAQAAZQUSHQAMFVFZQQQQSAQQXAA",
"output": "2482"
},
{
"input": "LQMAQQARQAQBJQQQAGAAZQQXALQQAARQAQQQQAAQQAQQQAQQCAQQAQQAYQQQRAAZATQALYQQAAHHAAQHAAAAAAAAQQMAAQNAKQ",
"output": "7768"
},
{
"input": "MAQQWAQOYQMAAAQAQPQZAOAAQAUAQNAAQAAAITQSAQAKAQKAQQWSQAAQQAGUCDQMQWKQUXKWQQAAQQAAQQZQDQQQAABXQUUXQOA",
"output": "5422"
},
{
"input": "QTAAQDAQXAQQJQQQGAAAQQQQSBQZKAQQAQQQQEAQNUQBZCQLYQZQEQQAAQHQVAORKQVAQYQNASZQAARZAAGAAAAOQDCQ",
"output": "3024"
},
{
"input": "QQWAQQGQQUZQQQLZAAQYQXQVAQFQUAQZUQZZQUKBHSHTQYLQAOQXAQQGAQQTQOAQARQADAJRAAQPQAQQUQAUAMAUVQAAAQQAWQ",
"output": "4527"
},
{
"input": "QQAAQQAQVAQZQQQQAOEAQZPQIBQZACQQAFQQLAAQDATZQANHKYQQAQTAAFQRQAIQAJPWQAQTEIRXAEQQAYWAAAUKQQAQAQQQSQQH",
"output": "6416"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAAAA",
"output": "14270"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQ",
"output": "13136"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA",
"output": "14270"
},
{
"input": "AQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQQAA",
"output": "14231"
},
{
"input": "QQQQQAQAAQQAQAQAAAAAAAAAQAQAAAAAQAQAQQQAQQQAAAQQQAAAAAAAQAAAAQQQQQQQAQQQQAQAAAQAAAAAQAQAAAAAQAQAA",
"output": "15296"
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "0"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "0"
},
{
"input": "QQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQQ",
"output": "0"
},
{
"input": "QAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQA",
"output": "20825"
},
{
"input": "AQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQAQ",
"output": "20825"
},
{
"input": "Q",
"output": "0"
},
{
"input": "A",
"output": "0"
},
{
"input": "FFF",
"output": "0"
},
{
"input": "AAAAAA",
"output": "0"
}
] | 1,594,393,783 | 2,147,483,647 | Python 3 | OK | TESTS | 43 | 109 | 6,963,200 | inputStr = input()
comb = [0,0,0]
count = 0
for i in range(len(inputStr)):
if inputStr[i] == 'Q':
comb[0] == 1
for j in range(i, len(inputStr)):
if inputStr[j] == 'A':
comb[1] == 1
for k in range(j, len(inputStr)):
if inputStr[k] == 'Q':
comb[2] += 1
count += 1
print(count) | Title: QAQ
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
"QAQ" is a word to denote an expression of crying. Imagine "Q" as eyes with tears and "A" as a mouth.
Now Diamond has given Bort a string consisting of only uppercase English letters of length *n*. There is a great number of "QAQ" in the string (Diamond is so cute!).
Bort wants to know how many subsequences "QAQ" are in the string Diamond has given. Note that the letters "QAQ" don't have to be consecutive, but the order of letters should be exact.
Input Specification:
The only line contains a string of length *n* (1<=≤<=*n*<=≤<=100). It's guaranteed that the string only contains uppercase English letters.
Output Specification:
Print a single integer — the number of subsequences "QAQ" in the string.
Demo Input:
['QAQAQYSYIOIWIN\n', 'QAQQQZZYNOIWIN\n']
Demo Output:
['4\n', '3\n']
Note:
In the first example there are 4 subsequences "QAQ": "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN", "QAQAQYSYIOIWIN". | ```python
inputStr = input()
comb = [0,0,0]
count = 0
for i in range(len(inputStr)):
if inputStr[i] == 'Q':
comb[0] == 1
for j in range(i, len(inputStr)):
if inputStr[j] == 'A':
comb[1] == 1
for k in range(j, len(inputStr)):
if inputStr[k] == 'Q':
comb[2] += 1
count += 1
print(count)
``` | 3 |
|
436 | B | Om Nom and Spiders | PROGRAMMING | 1,400 | [
"implementation",
"math"
] | null | null | Om Nom really likes candies and doesn't like spiders as they frequently steal candies. One day Om Nom fancied a walk in a park. Unfortunately, the park has some spiders and Om Nom doesn't want to see them at all.
The park can be represented as a rectangular *n*<=×<=*m* field. The park has *k* spiders, each spider at time 0 is at some cell of the field. The spiders move all the time, and each spider always moves in one of the four directions (left, right, down, up). In a unit of time, a spider crawls from his cell to the side-adjacent cell in the corresponding direction. If there is no cell in the given direction, then the spider leaves the park. The spiders do not interfere with each other as they move. Specifically, one cell can have multiple spiders at the same time.
Om Nom isn't yet sure where to start his walk from but he definitely wants:
- to start walking at time 0 at an upper row cell of the field (it is guaranteed that the cells in this row do not contain any spiders); - to walk by moving down the field towards the lowest row (the walk ends when Om Nom leaves the boundaries of the park).
We know that Om Nom moves by jumping. One jump takes one time unit and transports the little monster from his cell to either a side-adjacent cell on the lower row or outside the park boundaries.
Each time Om Nom lands in a cell he sees all the spiders that have come to that cell at this moment of time. Om Nom wants to choose the optimal cell to start the walk from. That's why he wonders: for each possible starting cell, how many spiders will he see during the walk if he starts from this cell? Help him and calculate the required value for each possible starting cell. | The first line contains three integers *n*,<=*m*,<=*k* (2<=≤<=*n*,<=*m*<=≤<=2000; 0<=≤<=*k*<=≤<=*m*(*n*<=-<=1)).
Each of the next *n* lines contains *m* characters — the description of the park. The characters in the *i*-th line describe the *i*-th row of the park field. If the character in the line equals ".", that means that the corresponding cell of the field is empty; otherwise, the character in the line will equal one of the four characters: "L" (meaning that this cell has a spider at time 0, moving left), "R" (a spider moving right), "U" (a spider moving up), "D" (a spider moving down).
It is guaranteed that the first row doesn't contain any spiders. It is guaranteed that the description of the field contains no extra characters. It is guaranteed that at time 0 the field contains exactly *k* spiders. | Print *m* integers: the *j*-th integer must show the number of spiders Om Nom will see if he starts his walk from the *j*-th cell of the first row. The cells in any row of the field are numbered from left to right. | [
"3 3 4\n...\nR.L\nR.U\n",
"2 2 2\n..\nRL\n",
"2 2 2\n..\nLR\n",
"3 4 8\n....\nRRLL\nUUUU\n",
"2 2 2\n..\nUU\n"
] | [
"0 2 2 ",
"1 1 ",
"0 0 ",
"1 3 3 1 ",
"0 0 "
] | Consider the first sample. The notes below show how the spider arrangement changes on the field over time:
Character "*" represents a cell that contains two spiders at the same time.
- If Om Nom starts from the first cell of the first row, he won't see any spiders. - If he starts from the second cell, he will see two spiders at time 1. - If he starts from the third cell, he will see two spiders: one at time 1, the other one at time 2. | 1,000 | [
{
"input": "3 3 4\n...\nR.L\nR.U",
"output": "0 2 2 "
},
{
"input": "2 2 2\n..\nRL",
"output": "1 1 "
},
{
"input": "2 2 2\n..\nLR",
"output": "0 0 "
},
{
"input": "3 4 8\n....\nRRLL\nUUUU",
"output": "1 3 3 1 "
},
{
"input": "2 2 2\n..\nUU",
"output": "0 0 "
},
{
"input": "2 2 0\n..\n..",
"output": "0 0 "
},
{
"input": "5 5 10\n.....\nRU.D.\n..DLL\n.D...\nRL..L",
"output": "1 2 1 0 1 "
},
{
"input": "5 6 20\n......\n.UURD.\nLUD.RR\nU.LDDD\nDDLDDU",
"output": "0 1 0 0 1 1 "
},
{
"input": "4 5 15\n.....\nDRRLR\nULDLD\nDLRRL",
"output": "1 2 2 1 0 "
},
{
"input": "3 7 14\n.......\nLDUDLLD\nDLRDDLD",
"output": "0 0 0 2 2 0 0 "
},
{
"input": "5 7 19\n.......\nRDLLLRL\nUUR..U.\n.D.DLLL\n..R..UU",
"output": "1 4 2 2 1 3 3 "
},
{
"input": "8 9 28\n.........\n.R.LDR.D.\n....UULU.\nR.D..DL.L\n.R..DLUDU\nR........\n.URU...UU\n.....D.L.",
"output": "1 2 2 3 2 4 2 2 3 "
},
{
"input": "2 100 59\n....................................................................................................\n.DR.D..DLLR.LDRR..L.LDRRRDLD.LDRR.LLR.R...DRLD.RRLL.L.D..R.LD.DL....LR.LR.DRLD.....L.D..RD...D.LL.R.",
"output": "0 0 0 1 0 0 0 1 1 0 0 2 0 0 0 1 1 1 0 1 0 0 0 1 1 2 0 0 1 0 0 0 1 2 1 0 0 1 0 1 0 0 0 1 1 0 0 0 2 2 0 1 0 0 0 0 0 0 2 0 0 0 1 0 0 0 0 1 0 0 2 0 0 1 0 1 1 0 0 0 0 0 1 0 0 0 0 0 0 1 0 0 0 0 1 1 0 0 0 1 "
},
{
"input": "100 2 45\n..\n.D\nU.\n..\nU.\n..\n..\n..\nU.\n..\n..\nD.\nU.\n..\n..\n.D\nDU\n..\nUD\n..\n..\n..\n..\n..\n..\nD.\nU.\n..\n..\nD.\nU.\n..\n..\n..\nU.\n..\n..\n.D\n..\n..\n.D\n..\n..\n.D\n.U\nD.\n..\n.D\n..\n..\nUD\n..\nU.\n..\nU.\n..\nUD\n..\nU.\n..\nU.\n..\n..\n..\nU.\n..\n..\nD.\n..\n..\nU.\n..\nU.\n..\nUU\n..\nU.\n..\nU.\n..\n..\n..\n..\n..\n..\n..\n..\n..\n.D\n..\n..\nD.\nU.\n.D\n..\n..\nU.\n.D\nU.\n..",
"output": "23 3 "
}
] | 1,660,110,056 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 36 | 170 | 8,704,000 | import sys
input = sys.stdin.readline
n, m, k = map(int, input().split())
g = [input()[:-1] for _ in range(n)]
d = [0]*m
for i in range(1, n):
for j in range(m):
if g[i][j] == 'R':
if j + i < m:
d[j+i] += 1
elif g[i][j] == 'L':
if j - i >= 0:
d[j-i] += 1
elif g[i][j] == 'U':
if i % 2 == 0:
d[j] += 1
print(' '.join(map(str, d)))
| Title: Om Nom and Spiders
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Om Nom really likes candies and doesn't like spiders as they frequently steal candies. One day Om Nom fancied a walk in a park. Unfortunately, the park has some spiders and Om Nom doesn't want to see them at all.
The park can be represented as a rectangular *n*<=×<=*m* field. The park has *k* spiders, each spider at time 0 is at some cell of the field. The spiders move all the time, and each spider always moves in one of the four directions (left, right, down, up). In a unit of time, a spider crawls from his cell to the side-adjacent cell in the corresponding direction. If there is no cell in the given direction, then the spider leaves the park. The spiders do not interfere with each other as they move. Specifically, one cell can have multiple spiders at the same time.
Om Nom isn't yet sure where to start his walk from but he definitely wants:
- to start walking at time 0 at an upper row cell of the field (it is guaranteed that the cells in this row do not contain any spiders); - to walk by moving down the field towards the lowest row (the walk ends when Om Nom leaves the boundaries of the park).
We know that Om Nom moves by jumping. One jump takes one time unit and transports the little monster from his cell to either a side-adjacent cell on the lower row or outside the park boundaries.
Each time Om Nom lands in a cell he sees all the spiders that have come to that cell at this moment of time. Om Nom wants to choose the optimal cell to start the walk from. That's why he wonders: for each possible starting cell, how many spiders will he see during the walk if he starts from this cell? Help him and calculate the required value for each possible starting cell.
Input Specification:
The first line contains three integers *n*,<=*m*,<=*k* (2<=≤<=*n*,<=*m*<=≤<=2000; 0<=≤<=*k*<=≤<=*m*(*n*<=-<=1)).
Each of the next *n* lines contains *m* characters — the description of the park. The characters in the *i*-th line describe the *i*-th row of the park field. If the character in the line equals ".", that means that the corresponding cell of the field is empty; otherwise, the character in the line will equal one of the four characters: "L" (meaning that this cell has a spider at time 0, moving left), "R" (a spider moving right), "U" (a spider moving up), "D" (a spider moving down).
It is guaranteed that the first row doesn't contain any spiders. It is guaranteed that the description of the field contains no extra characters. It is guaranteed that at time 0 the field contains exactly *k* spiders.
Output Specification:
Print *m* integers: the *j*-th integer must show the number of spiders Om Nom will see if he starts his walk from the *j*-th cell of the first row. The cells in any row of the field are numbered from left to right.
Demo Input:
['3 3 4\n...\nR.L\nR.U\n', '2 2 2\n..\nRL\n', '2 2 2\n..\nLR\n', '3 4 8\n....\nRRLL\nUUUU\n', '2 2 2\n..\nUU\n']
Demo Output:
['0 2 2 ', '1 1 ', '0 0 ', '1 3 3 1 ', '0 0 ']
Note:
Consider the first sample. The notes below show how the spider arrangement changes on the field over time:
Character "*" represents a cell that contains two spiders at the same time.
- If Om Nom starts from the first cell of the first row, he won't see any spiders. - If he starts from the second cell, he will see two spiders at time 1. - If he starts from the third cell, he will see two spiders: one at time 1, the other one at time 2. | ```python
import sys
input = sys.stdin.readline
n, m, k = map(int, input().split())
g = [input()[:-1] for _ in range(n)]
d = [0]*m
for i in range(1, n):
for j in range(m):
if g[i][j] == 'R':
if j + i < m:
d[j+i] += 1
elif g[i][j] == 'L':
if j - i >= 0:
d[j-i] += 1
elif g[i][j] == 'U':
if i % 2 == 0:
d[j] += 1
print(' '.join(map(str, d)))
``` | 3 |
|
33 | A | What is for dinner? | PROGRAMMING | 1,200 | [
"greedy",
"implementation"
] | A. What is for dinner? | 2 | 256 | In one little known, but very beautiful country called Waterland, lives a lovely shark Valerie. Like all the sharks, she has several rows of teeth, and feeds on crucians. One of Valerie's distinguishing features is that while eating one crucian she uses only one row of her teeth, the rest of the teeth are "relaxing".
For a long time our heroine had been searching the sea for crucians, but a great misfortune happened. Her teeth started to ache, and she had to see the local dentist, lobster Ashot. As a professional, Ashot quickly relieved Valerie from her toothache. Moreover, he managed to determine the cause of Valerie's developing caries (for what he was later nicknamed Cap).
It turned that Valerie eats too many crucians. To help Valerie avoid further reoccurrence of toothache, Ashot found for each Valerie's tooth its residual viability. Residual viability of a tooth is a value equal to the amount of crucians that Valerie can eat with this tooth. Every time Valerie eats a crucian, viability of all the teeth used for it will decrease by one. When the viability of at least one tooth becomes negative, the shark will have to see the dentist again.
Unhappy, Valerie came back home, where a portion of crucians was waiting for her. For sure, the shark couldn't say no to her favourite meal, but she had no desire to go back to the dentist. That's why she decided to eat the maximum amount of crucians from the portion but so that the viability of no tooth becomes negative.
As Valerie is not good at mathematics, she asked you to help her to find out the total amount of crucians that she can consume for dinner.
We should remind you that while eating one crucian Valerie uses exactly one row of teeth and the viability of each tooth from this row decreases by one. | The first line contains three integers *n*, *m*, *k* (1<=≤<=*m*<=≤<=*n*<=≤<=1000,<=0<=≤<=*k*<=≤<=106) — total amount of Valerie's teeth, amount of tooth rows and amount of crucians in Valerie's portion for dinner. Then follow *n* lines, each containing two integers: *r* (1<=≤<=*r*<=≤<=*m*) — index of the row, where belongs the corresponding tooth, and *c* (0<=≤<=*c*<=≤<=106) — its residual viability.
It's guaranteed that each tooth row has positive amount of teeth. | In the first line output the maximum amount of crucians that Valerie can consume for dinner. | [
"4 3 18\n2 3\n1 2\n3 6\n2 3\n",
"2 2 13\n1 13\n2 12\n"
] | [
"11\n",
"13\n"
] | none | 500 | [
{
"input": "4 3 18\n2 3\n1 2\n3 6\n2 3",
"output": "11"
},
{
"input": "2 2 13\n1 13\n2 12",
"output": "13"
},
{
"input": "5 4 8\n4 6\n4 5\n1 3\n2 0\n3 3",
"output": "8"
},
{
"input": "1 1 0\n1 3",
"output": "0"
},
{
"input": "7 1 30\n1 8\n1 15\n1 5\n1 17\n1 9\n1 16\n1 16",
"output": "5"
},
{
"input": "4 2 8\n1 9\n1 10\n1 4\n2 6",
"output": "8"
},
{
"input": "10 4 14\n2 6\n1 5\n2 8\n2 6\n2 5\n4 1\n4 0\n2 4\n3 4\n1 0",
"output": "8"
},
{
"input": "54 22 1009\n15 7\n17 7\n11 9\n5 11\n12 9\n13 8\n13 12\n22 11\n20 9\n20 7\n16 11\n19 12\n3 12\n15 9\n1 12\n2 10\n16 10\n16 10\n14 10\n9 11\n9 9\n14 8\n10 10\n16 12\n1 8\n3 8\n21 11\n18 12\n2 6\n9 11\n11 7\n15 9\n20 11\n6 8\n8 8\n19 11\n15 7\n9 9\n22 7\n12 9\n17 9\n17 11\n12 7\n15 9\n5 11\n11 6\n18 8\n7 10\n4 10\n13 12\n4 8\n20 6\n15 12\n9 7",
"output": "180"
},
{
"input": "1 1 1000000\n1 1000000",
"output": "1000000"
},
{
"input": "4 3 181818\n3 1299\n1 1694\n3 1164\n2 1278",
"output": "4136"
},
{
"input": "50 50 0\n33 0\n26 0\n30 0\n41 0\n38 0\n36 0\n16 0\n7 0\n23 0\n5 0\n39 0\n29 0\n40 0\n47 0\n24 0\n43 0\n14 0\n10 0\n20 0\n3 0\n6 0\n34 0\n13 0\n18 0\n21 0\n9 0\n8 0\n22 0\n25 0\n4 0\n11 0\n17 0\n32 0\n44 0\n49 0\n50 0\n27 0\n28 0\n45 0\n12 0\n35 0\n15 0\n42 0\n31 0\n2 0\n1 0\n48 0\n19 0\n37 0\n46 0",
"output": "0"
},
{
"input": "19 12 199\n7 1\n8 6\n6 14\n1 7\n4 1\n6 6\n3 4\n1 5\n9 2\n5 3\n11 3\n9 4\n1 12\n4 7\n7 3\n12 14\n2 1\n10 8\n6 12",
"output": "54"
}
] | 1,613,704,771 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 92 | 512,000 | import os
import sys
import numpy as np
import torch
import torch.nn as nn
import torch.nn.functional as F
from torch.autograd import Variable
sys.path.append(os.path.dirname(os.path.abspath(__file__)))
from utils import to_one_hot, mixup_process, get_lambda
from load_data import per_image_standardization
import random
class PreActBlock(nn.Module):
'''Pre-activation version of the BasicBlock.'''
expansion = 1
def __init__(self, in_planes, planes, stride=1):
super(PreActBlock, self).__init__()
self.bn1 = nn.BatchNorm2d(in_planes)
self.conv1 = nn.Conv2d(in_planes, planes, kernel_size=3, stride=stride, padding=1, bias=False)
self.bn2 = nn.BatchNorm2d(planes)
self.conv2 = nn.Conv2d(planes, planes, kernel_size=3, stride=1, padding=1, bias=False)
if stride != 1 or in_planes != self.expansion * planes:
self.shortcut = nn.Sequential(
nn.Conv2d(in_planes, self.expansion * planes, kernel_size=1, stride=stride, bias=False)
)
def forward(self, x):
out = F.relu(self.bn1(x))
shortcut = self.shortcut(out) if hasattr(self, 'shortcut') else x
out = self.conv1(out)
out = self.conv2(F.relu(self.bn2(out)))
out += shortcut
return out
class PreActBottleneck(nn.Module):
'''Pre-activation version of the original Bottleneck module.'''
expansion = 4
def __init__(self, in_planes, planes, stride=1):
super(PreActBottleneck, self).__init__()
self.bn1 = nn.BatchNorm2d(in_planes)
self.conv1 = nn.Conv2d(in_planes, planes, kernel_size=1, bias=False)
self.bn2 = nn.BatchNorm2d(planes)
self.conv2 = nn.Conv2d(planes, planes, kernel_size=3, stride=stride, padding=1, bias=False)
self.bn3 = nn.BatchNorm2d(planes)
self.conv3 = nn.Conv2d(planes, self.expansion * planes, kernel_size=1, bias=False)
if stride != 1 or in_planes != self.expansion * planes:
self.shortcut = nn.Sequential(
nn.Conv2d(in_planes, self.expansion * planes, kernel_size=1, stride=stride, bias=False)
)
def forward(self, x):
out = F.relu(self.bn1(x))
shortcut = self.shortcut(out) if hasattr(self, 'shortcut') else x
out = self.conv1(out)
out = self.conv2(F.relu(self.bn2(out)))
out = self.conv3(F.relu(self.bn3(out)))
out += shortcut
return out
class PreActResNet(nn.Module):
def __init__(self, block, num_blocks, initial_channels, num_classes, device, per_img_std=False, stride=1):
super(PreActResNet, self).__init__()
self.in_planes = initial_channels
self.num_classes = num_classes
self.per_img_std = per_img_std
self.device = device
# import pdb; pdb.set_trace()
self.conv1 = nn.Conv2d(3, initial_channels, kernel_size=3, stride=stride, padding=1, bias=False)
self.layer1 = self._make_layer(block, initial_channels, num_blocks[0], stride=1)
self.layer2 = self._make_layer(block, initial_channels * 2, num_blocks[1], stride=2)
self.layer3 = self._make_layer(block, initial_channels * 4, num_blocks[2], stride=2)
self.layer4 = self._make_layer(block, initial_channels * 8, num_blocks[3], stride=2)
self.linear = nn.Linear(initial_channels * 8 * block.expansion, num_classes)
def _make_layer(self, block, planes, num_blocks, stride):
strides = [stride] + [1] * (num_blocks - 1)
layers = []
for stride in strides:
layers.append(block(self.in_planes, planes, stride))
self.in_planes = planes * block.expansion
return nn.Sequential(*layers)
def compute_h1(self, x):
out = x
out = self.conv1(out)
out = self.layer1(out)
return out
def compute_h2(self, x):
out = x
out = self.conv1(out)
out = self.layer1(out)
out = self.layer2(out)
return out
def forward(self, x, target=None, mixup=False, mixup_hidden=False, mixup_alpha=None):
# import pdb; pdb.set_trace()
if self.per_img_std:
x = per_image_standardization(x)
if mixup_hidden:
layer_mix = random.randint(0, 2)
elif mixup:
layer_mix = 0
else:
layer_mix = None
out = x
if mixup_alpha is not None:
lam = get_lambda(mixup_alpha)
lam = torch.from_numpy(np.array([lam]).astype('float32')).to(self.device)
lam = Variable(lam)
if target is not None:
target_reweighted = to_one_hot(target, self.num_classes, device=self.device)
if layer_mix == 0:
out, target_reweighted = mixup_process(out, target_reweighted, lam=lam)
out = self.conv1(out)
out = self.layer1(out)
if layer_mix == 1:
out, target_reweighted = mixup_process(out, target_reweighted, lam=lam)
out = self.layer2(out)
if layer_mix == 2:
out, target_reweighted = mixup_process(out, target_reweighted, lam=lam)
out = self.layer3(out)
if layer_mix == 3:
out, target_reweighted = mixup_process(out, target_reweighted, lam=lam)
out = self.layer4(out)
out = F.avg_pool2d(out, 4)
out = out.view(out.size(0), -1)
out = self.linear(out)
if target is not None:
return out, target_reweighted
else:
return out
def preactresnet18(num_classes=10, dropout=False, device='cpu', per_img_std=False, stride=1):
return PreActResNet(PreActBlock, [2, 2, 2, 2], 64, num_classes, device=device, per_img_std=per_img_std,
stride=stride)
def preactresnet34(num_classes=10, dropout=False, device='cpu', per_img_std=False, stride=1):
return PreActResNet(PreActBlock, [3, 4, 6, 3], 64, num_classes, device='cpu', per_img_std=per_img_std,
stride=stride)
def preactresnet50(num_classes=10, dropout=False, device='cpu', per_img_std=False, stride=1):
return PreActResNet(PreActBottleneck, [3, 4, 6, 3], 64, num_classes, device='cpu', per_img_std=per_img_std,
stride=stride)
def preactresnet101(num_classes=10, dropout=False, device='cpu', per_img_std=False, stride=1):
return PreActResNet(PreActBottleneck, [3, 4, 23, 3], 64, num_classes, device='cpu', per_img_std=per_img_std,
stride=stride)
def preactresnet152(num_classes=10, dropout=False, device='cpu', per_img_std=False, stride=1):
return PreActResNet(PreActBottleneck, [3, 8, 36, 3], 64, num_classes, device='cpu', per_img_std=per_img_std,
stride=stride)
def test():
net = preactresnet152(True, 10)
y = net(Variable(torch.randn(1, 3, 32, 32)))
print(y.size())
if __name__ == "__main__":
test()
# test()
| Title: What is for dinner?
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
In one little known, but very beautiful country called Waterland, lives a lovely shark Valerie. Like all the sharks, she has several rows of teeth, and feeds on crucians. One of Valerie's distinguishing features is that while eating one crucian she uses only one row of her teeth, the rest of the teeth are "relaxing".
For a long time our heroine had been searching the sea for crucians, but a great misfortune happened. Her teeth started to ache, and she had to see the local dentist, lobster Ashot. As a professional, Ashot quickly relieved Valerie from her toothache. Moreover, he managed to determine the cause of Valerie's developing caries (for what he was later nicknamed Cap).
It turned that Valerie eats too many crucians. To help Valerie avoid further reoccurrence of toothache, Ashot found for each Valerie's tooth its residual viability. Residual viability of a tooth is a value equal to the amount of crucians that Valerie can eat with this tooth. Every time Valerie eats a crucian, viability of all the teeth used for it will decrease by one. When the viability of at least one tooth becomes negative, the shark will have to see the dentist again.
Unhappy, Valerie came back home, where a portion of crucians was waiting for her. For sure, the shark couldn't say no to her favourite meal, but she had no desire to go back to the dentist. That's why she decided to eat the maximum amount of crucians from the portion but so that the viability of no tooth becomes negative.
As Valerie is not good at mathematics, she asked you to help her to find out the total amount of crucians that she can consume for dinner.
We should remind you that while eating one crucian Valerie uses exactly one row of teeth and the viability of each tooth from this row decreases by one.
Input Specification:
The first line contains three integers *n*, *m*, *k* (1<=≤<=*m*<=≤<=*n*<=≤<=1000,<=0<=≤<=*k*<=≤<=106) — total amount of Valerie's teeth, amount of tooth rows and amount of crucians in Valerie's portion for dinner. Then follow *n* lines, each containing two integers: *r* (1<=≤<=*r*<=≤<=*m*) — index of the row, where belongs the corresponding tooth, and *c* (0<=≤<=*c*<=≤<=106) — its residual viability.
It's guaranteed that each tooth row has positive amount of teeth.
Output Specification:
In the first line output the maximum amount of crucians that Valerie can consume for dinner.
Demo Input:
['4 3 18\n2 3\n1 2\n3 6\n2 3\n', '2 2 13\n1 13\n2 12\n']
Demo Output:
['11\n', '13\n']
Note:
none | ```python
import os
import sys
import numpy as np
import torch
import torch.nn as nn
import torch.nn.functional as F
from torch.autograd import Variable
sys.path.append(os.path.dirname(os.path.abspath(__file__)))
from utils import to_one_hot, mixup_process, get_lambda
from load_data import per_image_standardization
import random
class PreActBlock(nn.Module):
'''Pre-activation version of the BasicBlock.'''
expansion = 1
def __init__(self, in_planes, planes, stride=1):
super(PreActBlock, self).__init__()
self.bn1 = nn.BatchNorm2d(in_planes)
self.conv1 = nn.Conv2d(in_planes, planes, kernel_size=3, stride=stride, padding=1, bias=False)
self.bn2 = nn.BatchNorm2d(planes)
self.conv2 = nn.Conv2d(planes, planes, kernel_size=3, stride=1, padding=1, bias=False)
if stride != 1 or in_planes != self.expansion * planes:
self.shortcut = nn.Sequential(
nn.Conv2d(in_planes, self.expansion * planes, kernel_size=1, stride=stride, bias=False)
)
def forward(self, x):
out = F.relu(self.bn1(x))
shortcut = self.shortcut(out) if hasattr(self, 'shortcut') else x
out = self.conv1(out)
out = self.conv2(F.relu(self.bn2(out)))
out += shortcut
return out
class PreActBottleneck(nn.Module):
'''Pre-activation version of the original Bottleneck module.'''
expansion = 4
def __init__(self, in_planes, planes, stride=1):
super(PreActBottleneck, self).__init__()
self.bn1 = nn.BatchNorm2d(in_planes)
self.conv1 = nn.Conv2d(in_planes, planes, kernel_size=1, bias=False)
self.bn2 = nn.BatchNorm2d(planes)
self.conv2 = nn.Conv2d(planes, planes, kernel_size=3, stride=stride, padding=1, bias=False)
self.bn3 = nn.BatchNorm2d(planes)
self.conv3 = nn.Conv2d(planes, self.expansion * planes, kernel_size=1, bias=False)
if stride != 1 or in_planes != self.expansion * planes:
self.shortcut = nn.Sequential(
nn.Conv2d(in_planes, self.expansion * planes, kernel_size=1, stride=stride, bias=False)
)
def forward(self, x):
out = F.relu(self.bn1(x))
shortcut = self.shortcut(out) if hasattr(self, 'shortcut') else x
out = self.conv1(out)
out = self.conv2(F.relu(self.bn2(out)))
out = self.conv3(F.relu(self.bn3(out)))
out += shortcut
return out
class PreActResNet(nn.Module):
def __init__(self, block, num_blocks, initial_channels, num_classes, device, per_img_std=False, stride=1):
super(PreActResNet, self).__init__()
self.in_planes = initial_channels
self.num_classes = num_classes
self.per_img_std = per_img_std
self.device = device
# import pdb; pdb.set_trace()
self.conv1 = nn.Conv2d(3, initial_channels, kernel_size=3, stride=stride, padding=1, bias=False)
self.layer1 = self._make_layer(block, initial_channels, num_blocks[0], stride=1)
self.layer2 = self._make_layer(block, initial_channels * 2, num_blocks[1], stride=2)
self.layer3 = self._make_layer(block, initial_channels * 4, num_blocks[2], stride=2)
self.layer4 = self._make_layer(block, initial_channels * 8, num_blocks[3], stride=2)
self.linear = nn.Linear(initial_channels * 8 * block.expansion, num_classes)
def _make_layer(self, block, planes, num_blocks, stride):
strides = [stride] + [1] * (num_blocks - 1)
layers = []
for stride in strides:
layers.append(block(self.in_planes, planes, stride))
self.in_planes = planes * block.expansion
return nn.Sequential(*layers)
def compute_h1(self, x):
out = x
out = self.conv1(out)
out = self.layer1(out)
return out
def compute_h2(self, x):
out = x
out = self.conv1(out)
out = self.layer1(out)
out = self.layer2(out)
return out
def forward(self, x, target=None, mixup=False, mixup_hidden=False, mixup_alpha=None):
# import pdb; pdb.set_trace()
if self.per_img_std:
x = per_image_standardization(x)
if mixup_hidden:
layer_mix = random.randint(0, 2)
elif mixup:
layer_mix = 0
else:
layer_mix = None
out = x
if mixup_alpha is not None:
lam = get_lambda(mixup_alpha)
lam = torch.from_numpy(np.array([lam]).astype('float32')).to(self.device)
lam = Variable(lam)
if target is not None:
target_reweighted = to_one_hot(target, self.num_classes, device=self.device)
if layer_mix == 0:
out, target_reweighted = mixup_process(out, target_reweighted, lam=lam)
out = self.conv1(out)
out = self.layer1(out)
if layer_mix == 1:
out, target_reweighted = mixup_process(out, target_reweighted, lam=lam)
out = self.layer2(out)
if layer_mix == 2:
out, target_reweighted = mixup_process(out, target_reweighted, lam=lam)
out = self.layer3(out)
if layer_mix == 3:
out, target_reweighted = mixup_process(out, target_reweighted, lam=lam)
out = self.layer4(out)
out = F.avg_pool2d(out, 4)
out = out.view(out.size(0), -1)
out = self.linear(out)
if target is not None:
return out, target_reweighted
else:
return out
def preactresnet18(num_classes=10, dropout=False, device='cpu', per_img_std=False, stride=1):
return PreActResNet(PreActBlock, [2, 2, 2, 2], 64, num_classes, device=device, per_img_std=per_img_std,
stride=stride)
def preactresnet34(num_classes=10, dropout=False, device='cpu', per_img_std=False, stride=1):
return PreActResNet(PreActBlock, [3, 4, 6, 3], 64, num_classes, device='cpu', per_img_std=per_img_std,
stride=stride)
def preactresnet50(num_classes=10, dropout=False, device='cpu', per_img_std=False, stride=1):
return PreActResNet(PreActBottleneck, [3, 4, 6, 3], 64, num_classes, device='cpu', per_img_std=per_img_std,
stride=stride)
def preactresnet101(num_classes=10, dropout=False, device='cpu', per_img_std=False, stride=1):
return PreActResNet(PreActBottleneck, [3, 4, 23, 3], 64, num_classes, device='cpu', per_img_std=per_img_std,
stride=stride)
def preactresnet152(num_classes=10, dropout=False, device='cpu', per_img_std=False, stride=1):
return PreActResNet(PreActBottleneck, [3, 8, 36, 3], 64, num_classes, device='cpu', per_img_std=per_img_std,
stride=stride)
def test():
net = preactresnet152(True, 10)
y = net(Variable(torch.randn(1, 3, 32, 32)))
print(y.size())
if __name__ == "__main__":
test()
# test()
``` | -1 |
231 | A | Team | PROGRAMMING | 800 | [
"brute force",
"greedy"
] | null | null | One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution.
This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution. | The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces. | Print a single integer — the number of problems the friends will implement on the contest. | [
"3\n1 1 0\n1 1 1\n1 0 0\n",
"2\n1 0 0\n0 1 1\n"
] | [
"2\n",
"1\n"
] | In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it.
In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution. | 500 | [
{
"input": "3\n1 1 0\n1 1 1\n1 0 0",
"output": "2"
},
{
"input": "2\n1 0 0\n0 1 1",
"output": "1"
},
{
"input": "1\n1 0 0",
"output": "0"
},
{
"input": "2\n1 0 0\n1 1 1",
"output": "1"
},
{
"input": "5\n1 0 0\n0 1 0\n1 1 1\n0 0 1\n0 0 0",
"output": "1"
},
{
"input": "10\n0 1 0\n0 1 0\n1 1 0\n1 0 0\n0 0 1\n0 1 1\n1 1 1\n1 1 0\n0 0 0\n0 0 0",
"output": "4"
},
{
"input": "15\n0 1 0\n1 0 0\n1 1 0\n1 1 1\n0 1 0\n0 0 1\n1 0 1\n1 0 1\n1 0 1\n0 0 0\n1 1 1\n1 1 0\n0 1 1\n1 1 0\n1 1 1",
"output": "10"
},
{
"input": "50\n0 0 0\n0 1 1\n1 1 1\n0 1 0\n1 0 1\n1 1 1\n0 0 1\n1 0 0\n1 1 0\n1 0 1\n0 1 0\n0 0 1\n1 1 0\n0 1 0\n1 1 0\n0 0 0\n1 1 1\n1 0 1\n0 0 1\n1 1 0\n1 1 1\n0 1 1\n1 1 0\n0 0 0\n0 0 0\n1 1 1\n0 0 0\n1 1 1\n0 1 1\n0 0 1\n0 0 0\n0 0 0\n1 1 0\n1 1 0\n1 0 1\n1 0 0\n1 0 1\n1 0 1\n0 1 1\n1 1 0\n1 1 0\n0 1 0\n1 0 1\n0 0 0\n0 0 0\n0 0 0\n0 0 1\n1 1 1\n0 1 1\n1 0 1",
"output": "29"
},
{
"input": "1\n1 1 1",
"output": "1"
},
{
"input": "8\n0 0 0\n0 0 1\n0 0 0\n0 1 1\n1 0 0\n1 0 1\n1 1 0\n1 1 1",
"output": "4"
},
{
"input": "16\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1\n1 1 1",
"output": "16"
}
] | 1,696,806,374 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 1 | 62 | 0 | x = int(input())
final = 0
for i in range(x):
y = input()
count = 0
if (y[0] == "1"):
count+=1
if (y[2] == "1"):
count+=1
if (y[3] == "1"):
count+=1
if (count >= 2):
final+=1
print(final) | Title: Team
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day three best friends Petya, Vasya and Tonya decided to form a team and take part in programming contests. Participants are usually offered several problems during programming contests. Long before the start the friends decided that they will implement a problem if at least two of them are sure about the solution. Otherwise, the friends won't write the problem's solution.
This contest offers *n* problems to the participants. For each problem we know, which friend is sure about the solution. Help the friends find the number of problems for which they will write a solution.
Input Specification:
The first input line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of problems in the contest. Then *n* lines contain three integers each, each integer is either 0 or 1. If the first number in the line equals 1, then Petya is sure about the problem's solution, otherwise he isn't sure. The second number shows Vasya's view on the solution, the third number shows Tonya's view. The numbers on the lines are separated by spaces.
Output Specification:
Print a single integer — the number of problems the friends will implement on the contest.
Demo Input:
['3\n1 1 0\n1 1 1\n1 0 0\n', '2\n1 0 0\n0 1 1\n']
Demo Output:
['2\n', '1\n']
Note:
In the first sample Petya and Vasya are sure that they know how to solve the first problem and all three of them know how to solve the second problem. That means that they will write solutions for these problems. Only Petya is sure about the solution for the third problem, but that isn't enough, so the friends won't take it.
In the second sample the friends will only implement the second problem, as Vasya and Tonya are sure about the solution. | ```python
x = int(input())
final = 0
for i in range(x):
y = input()
count = 0
if (y[0] == "1"):
count+=1
if (y[2] == "1"):
count+=1
if (y[3] == "1"):
count+=1
if (count >= 2):
final+=1
print(final)
``` | 0 |
|
26 | A | Almost Prime | PROGRAMMING | 900 | [
"number theory"
] | A. Almost Prime | 2 | 256 | A number is called almost prime if it has exactly two distinct prime divisors. For example, numbers 6, 18, 24 are almost prime, while 4, 8, 9, 42 are not. Find the amount of almost prime numbers which are between 1 and *n*, inclusive. | Input contains one integer number *n* (1<=≤<=*n*<=≤<=3000). | Output the amount of almost prime numbers between 1 and *n*, inclusive. | [
"10\n",
"21\n"
] | [
"2\n",
"8\n"
] | none | 500 | [
{
"input": "10",
"output": "2"
},
{
"input": "21",
"output": "8"
},
{
"input": "1",
"output": "0"
},
{
"input": "2",
"output": "0"
},
{
"input": "4",
"output": "0"
},
{
"input": "3",
"output": "0"
},
{
"input": "8",
"output": "1"
},
{
"input": "19",
"output": "6"
},
{
"input": "40",
"output": "19"
},
{
"input": "77",
"output": "41"
},
{
"input": "222",
"output": "125"
},
{
"input": "987",
"output": "501"
},
{
"input": "1000",
"output": "508"
},
{
"input": "2000",
"output": "958"
},
{
"input": "3000",
"output": "1375"
},
{
"input": "2999",
"output": "1375"
},
{
"input": "2998",
"output": "1375"
},
{
"input": "2997",
"output": "1374"
},
{
"input": "1429",
"output": "706"
},
{
"input": "1673",
"output": "808"
},
{
"input": "1500",
"output": "732"
},
{
"input": "500",
"output": "266"
},
{
"input": "856",
"output": "439"
}
] | 1,680,276,075 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 23 | 186 | 3,174,400 |
def count_primes(num):
#does not consider num as a prime number
count = 0
for divisor in range(2, int(num**0.5)+1):
if num % divisor == 0: count += 1
while num % divisor == 0:
num /= divisor
if num > 1: count += 1 #num itself is prime
return count
def count_almost_primes(num):
count = 0
for num in range(1, num+1):
if count_primes(num) == 2: count += 1
return count
def main():
num = int(input())
print(count_almost_primes(num))
main()
| Title: Almost Prime
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A number is called almost prime if it has exactly two distinct prime divisors. For example, numbers 6, 18, 24 are almost prime, while 4, 8, 9, 42 are not. Find the amount of almost prime numbers which are between 1 and *n*, inclusive.
Input Specification:
Input contains one integer number *n* (1<=≤<=*n*<=≤<=3000).
Output Specification:
Output the amount of almost prime numbers between 1 and *n*, inclusive.
Demo Input:
['10\n', '21\n']
Demo Output:
['2\n', '8\n']
Note:
none | ```python
def count_primes(num):
#does not consider num as a prime number
count = 0
for divisor in range(2, int(num**0.5)+1):
if num % divisor == 0: count += 1
while num % divisor == 0:
num /= divisor
if num > 1: count += 1 #num itself is prime
return count
def count_almost_primes(num):
count = 0
for num in range(1, num+1):
if count_primes(num) == 2: count += 1
return count
def main():
num = int(input())
print(count_almost_primes(num))
main()
``` | 3.947587 |
208 | A | Dubstep | PROGRAMMING | 900 | [
"strings"
] | null | null | Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them.
Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club.
For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX".
Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song. | The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word. | Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space. | [
"WUBWUBABCWUB\n",
"WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n"
] | [
"ABC ",
"WE ARE THE CHAMPIONS MY FRIEND "
] | In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya.
In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" — between them Vasya added two "WUB". | 500 | [
{
"input": "WUBWUBABCWUB",
"output": "ABC "
},
{
"input": "WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB",
"output": "WE ARE THE CHAMPIONS MY FRIEND "
},
{
"input": "WUBWUBWUBSR",
"output": "SR "
},
{
"input": "RWUBWUBWUBLWUB",
"output": "R L "
},
{
"input": "ZJWUBWUBWUBJWUBWUBWUBL",
"output": "ZJ J L "
},
{
"input": "CWUBBWUBWUBWUBEWUBWUBWUBQWUBWUBWUB",
"output": "C B E Q "
},
{
"input": "WUBJKDWUBWUBWBIRAQKFWUBWUBYEWUBWUBWUBWVWUBWUB",
"output": "JKD WBIRAQKF YE WV "
},
{
"input": "WUBKSDHEMIXUJWUBWUBRWUBWUBWUBSWUBWUBWUBHWUBWUBWUB",
"output": "KSDHEMIXUJ R S H "
},
{
"input": "OGWUBWUBWUBXWUBWUBWUBIWUBWUBWUBKOWUBWUB",
"output": "OG X I KO "
},
{
"input": "QWUBQQWUBWUBWUBIWUBWUBWWWUBWUBWUBJOPJPBRH",
"output": "Q QQ I WW JOPJPBRH "
},
{
"input": "VSRNVEATZTLGQRFEGBFPWUBWUBWUBAJWUBWUBWUBPQCHNWUBCWUB",
"output": "VSRNVEATZTLGQRFEGBFP AJ PQCHN C "
},
{
"input": "WUBWUBEWUBWUBWUBIQMJNIQWUBWUBWUBGZZBQZAUHYPWUBWUBWUBPMRWUBWUBWUBDCV",
"output": "E IQMJNIQ GZZBQZAUHYP PMR DCV "
},
{
"input": "WUBWUBWUBFVWUBWUBWUBBPSWUBWUBWUBRXNETCJWUBWUBWUBJDMBHWUBWUBWUBBWUBWUBVWUBWUBB",
"output": "FV BPS RXNETCJ JDMBH B V B "
},
{
"input": "WUBWUBWUBFBQWUBWUBWUBIDFSYWUBWUBWUBCTWDMWUBWUBWUBSXOWUBWUBWUBQIWUBWUBWUBL",
"output": "FBQ IDFSY CTWDM SXO QI L "
},
{
"input": "IWUBWUBQLHDWUBYIIKZDFQWUBWUBWUBCXWUBWUBUWUBWUBWUBKWUBWUBWUBNL",
"output": "I QLHD YIIKZDFQ CX U K NL "
},
{
"input": "KWUBUPDYXGOKUWUBWUBWUBAGOAHWUBIZDWUBWUBWUBIYWUBWUBWUBVWUBWUBWUBPWUBWUBWUBE",
"output": "K UPDYXGOKU AGOAH IZD IY V P E "
},
{
"input": "WUBWUBOWUBWUBWUBIPVCQAFWYWUBWUBWUBQWUBWUBWUBXHDKCPYKCTWWYWUBWUBWUBVWUBWUBWUBFZWUBWUB",
"output": "O IPVCQAFWY Q XHDKCPYKCTWWY V FZ "
},
{
"input": "PAMJGYWUBWUBWUBXGPQMWUBWUBWUBTKGSXUYWUBWUBWUBEWUBWUBWUBNWUBWUBWUBHWUBWUBWUBEWUBWUB",
"output": "PAMJGY XGPQM TKGSXUY E N H E "
},
{
"input": "WUBYYRTSMNWUWUBWUBWUBCWUBWUBWUBCWUBWUBWUBFSYUINDWOBVWUBWUBWUBFWUBWUBWUBAUWUBWUBWUBVWUBWUBWUBJB",
"output": "YYRTSMNWU C C FSYUINDWOBV F AU V JB "
},
{
"input": "WUBWUBYGPYEYBNRTFKOQCWUBWUBWUBUYGRTQEGWLFYWUBWUBWUBFVWUBHPWUBWUBWUBXZQWUBWUBWUBZDWUBWUBWUBM",
"output": "YGPYEYBNRTFKOQC UYGRTQEGWLFY FV HP XZQ ZD M "
},
{
"input": "WUBZVMJWUBWUBWUBFOIMJQWKNZUBOFOFYCCWUBWUBWUBAUWWUBRDRADWUBWUBWUBCHQVWUBWUBWUBKFTWUBWUBWUBW",
"output": "ZVMJ FOIMJQWKNZUBOFOFYCC AUW RDRAD CHQV KFT W "
},
{
"input": "WUBWUBZBKOKHQLGKRVIMZQMQNRWUBWUBWUBDACWUBWUBNZHFJMPEYKRVSWUBWUBWUBPPHGAVVPRZWUBWUBWUBQWUBWUBAWUBG",
"output": "ZBKOKHQLGKRVIMZQMQNR DAC NZHFJMPEYKRVS PPHGAVVPRZ Q A G "
},
{
"input": "WUBWUBJWUBWUBWUBNFLWUBWUBWUBGECAWUBYFKBYJWTGBYHVSSNTINKWSINWSMAWUBWUBWUBFWUBWUBWUBOVWUBWUBLPWUBWUBWUBN",
"output": "J NFL GECA YFKBYJWTGBYHVSSNTINKWSINWSMA F OV LP N "
},
{
"input": "WUBWUBLCWUBWUBWUBZGEQUEATJVIXETVTWUBWUBWUBEXMGWUBWUBWUBRSWUBWUBWUBVWUBWUBWUBTAWUBWUBWUBCWUBWUBWUBQG",
"output": "LC ZGEQUEATJVIXETVT EXMG RS V TA C QG "
},
{
"input": "WUBMPWUBWUBWUBORWUBWUBDLGKWUBWUBWUBVVZQCAAKVJTIKWUBWUBWUBTJLUBZJCILQDIFVZWUBWUBYXWUBWUBWUBQWUBWUBWUBLWUB",
"output": "MP OR DLGK VVZQCAAKVJTIK TJLUBZJCILQDIFVZ YX Q L "
},
{
"input": "WUBNXOLIBKEGXNWUBWUBWUBUWUBGITCNMDQFUAOVLWUBWUBWUBAIJDJZJHFMPVTPOXHPWUBWUBWUBISCIOWUBWUBWUBGWUBWUBWUBUWUB",
"output": "NXOLIBKEGXN U GITCNMDQFUAOVL AIJDJZJHFMPVTPOXHP ISCIO G U "
},
{
"input": "WUBWUBNMMWCZOLYPNBELIYVDNHJUNINWUBWUBWUBDXLHYOWUBWUBWUBOJXUWUBWUBWUBRFHTGJCEFHCGWARGWUBWUBWUBJKWUBWUBSJWUBWUB",
"output": "NMMWCZOLYPNBELIYVDNHJUNIN DXLHYO OJXU RFHTGJCEFHCGWARG JK SJ "
},
{
"input": "SGWLYSAUJOJBNOXNWUBWUBWUBBOSSFWKXPDPDCQEWUBWUBWUBDIRZINODWUBWUBWUBWWUBWUBWUBPPHWUBWUBWUBRWUBWUBWUBQWUBWUBWUBJWUB",
"output": "SGWLYSAUJOJBNOXN BOSSFWKXPDPDCQE DIRZINOD W PPH R Q J "
},
{
"input": "TOWUBWUBWUBGBTBNWUBWUBWUBJVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSAWUBWUBWUBSWUBWUBWUBTOLVXWUBWUBWUBNHWUBWUBWUBO",
"output": "TO GBTBN JVIOJBIZFUUYHUAIEBQLQXPQKZJMPTCWBKPOSA S TOLVX NH O "
},
{
"input": "WUBWUBWSPLAYSZSAUDSWUBWUBWUBUWUBWUBWUBKRWUBWUBWUBRSOKQMZFIYZQUWUBWUBWUBELSHUWUBWUBWUBUKHWUBWUBWUBQXEUHQWUBWUBWUBBWUBWUBWUBR",
"output": "WSPLAYSZSAUDS U KR RSOKQMZFIYZQU ELSHU UKH QXEUHQ B R "
},
{
"input": "WUBXEMWWVUHLSUUGRWUBWUBWUBAWUBXEGILZUNKWUBWUBWUBJDHHKSWUBWUBWUBDTSUYSJHWUBWUBWUBPXFWUBMOHNJWUBWUBWUBZFXVMDWUBWUBWUBZMWUBWUB",
"output": "XEMWWVUHLSUUGR A XEGILZUNK JDHHKS DTSUYSJH PXF MOHNJ ZFXVMD ZM "
},
{
"input": "BMBWUBWUBWUBOQKWUBWUBWUBPITCIHXHCKLRQRUGXJWUBWUBWUBVWUBWUBWUBJCWUBWUBWUBQJPWUBWUBWUBBWUBWUBWUBBMYGIZOOXWUBWUBWUBTAGWUBWUBHWUB",
"output": "BMB OQK PITCIHXHCKLRQRUGXJ V JC QJP B BMYGIZOOX TAG H "
},
{
"input": "CBZNWUBWUBWUBNHWUBWUBWUBYQSYWUBWUBWUBMWUBWUBWUBXRHBTMWUBWUBWUBPCRCWUBWUBWUBTZUYLYOWUBWUBWUBCYGCWUBWUBWUBCLJWUBWUBWUBSWUBWUBWUB",
"output": "CBZN NH YQSY M XRHBTM PCRC TZUYLYO CYGC CLJ S "
},
{
"input": "DPDWUBWUBWUBEUQKWPUHLTLNXHAEKGWUBRRFYCAYZFJDCJLXBAWUBWUBWUBHJWUBOJWUBWUBWUBNHBJEYFWUBWUBWUBRWUBWUBWUBSWUBWWUBWUBWUBXDWUBWUBWUBJWUB",
"output": "DPD EUQKWPUHLTLNXHAEKG RRFYCAYZFJDCJLXBA HJ OJ NHBJEYF R S W XD J "
},
{
"input": "WUBWUBWUBISERPQITVIYERSCNWUBWUBWUBQWUBWUBWUBDGSDIPWUBWUBWUBCAHKDZWEXBIBJVVSKKVQJWUBWUBWUBKIWUBWUBWUBCWUBWUBWUBAWUBWUBWUBPWUBWUBWUBHWUBWUBWUBF",
"output": "ISERPQITVIYERSCN Q DGSDIP CAHKDZWEXBIBJVVSKKVQJ KI C A P H F "
},
{
"input": "WUBWUBWUBIWUBWUBLIKNQVWUBWUBWUBPWUBWUBWUBHWUBWUBWUBMWUBWUBWUBDPRSWUBWUBWUBBSAGYLQEENWXXVWUBWUBWUBXMHOWUBWUBWUBUWUBWUBWUBYRYWUBWUBWUBCWUBWUBWUBY",
"output": "I LIKNQV P H M DPRS BSAGYLQEENWXXV XMHO U YRY C Y "
},
{
"input": "WUBWUBWUBMWUBWUBWUBQWUBWUBWUBITCFEYEWUBWUBWUBHEUWGNDFNZGWKLJWUBWUBWUBMZPWUBWUBWUBUWUBWUBWUBBWUBWUBWUBDTJWUBHZVIWUBWUBWUBPWUBFNHHWUBWUBWUBVTOWUB",
"output": "M Q ITCFEYE HEUWGNDFNZGWKLJ MZP U B DTJ HZVI P FNHH VTO "
},
{
"input": "WUBWUBNDNRFHYJAAUULLHRRDEDHYFSRXJWUBWUBWUBMUJVDTIRSGYZAVWKRGIFWUBWUBWUBHMZWUBWUBWUBVAIWUBWUBWUBDDKJXPZRGWUBWUBWUBSGXWUBWUBWUBIFKWUBWUBWUBUWUBWUBWUBW",
"output": "NDNRFHYJAAUULLHRRDEDHYFSRXJ MUJVDTIRSGYZAVWKRGIF HMZ VAI DDKJXPZRG SGX IFK U W "
},
{
"input": "WUBOJMWRSLAXXHQRTPMJNCMPGWUBWUBWUBNYGMZIXNLAKSQYWDWUBWUBWUBXNIWUBWUBWUBFWUBWUBWUBXMBWUBWUBWUBIWUBWUBWUBINWUBWUBWUBWDWUBWUBWUBDDWUBWUBWUBD",
"output": "OJMWRSLAXXHQRTPMJNCMPG NYGMZIXNLAKSQYWD XNI F XMB I IN WD DD D "
},
{
"input": "WUBWUBWUBREHMWUBWUBWUBXWUBWUBWUBQASNWUBWUBWUBNLSMHLCMTICWUBWUBWUBVAWUBWUBWUBHNWUBWUBWUBNWUBWUBWUBUEXLSFOEULBWUBWUBWUBXWUBWUBWUBJWUBWUBWUBQWUBWUBWUBAWUBWUB",
"output": "REHM X QASN NLSMHLCMTIC VA HN N UEXLSFOEULB X J Q A "
},
{
"input": "WUBWUBWUBSTEZTZEFFIWUBWUBWUBSWUBWUBWUBCWUBFWUBHRJPVWUBWUBWUBDYJUWUBWUBWUBPWYDKCWUBWUBWUBCWUBWUBWUBUUEOGCVHHBWUBWUBWUBEXLWUBWUBWUBVCYWUBWUBWUBMWUBWUBWUBYWUB",
"output": "STEZTZEFFI S C F HRJPV DYJU PWYDKC C UUEOGCVHHB EXL VCY M Y "
},
{
"input": "WPPNMSQOQIWUBWUBWUBPNQXWUBWUBWUBHWUBWUBWUBNFLWUBWUBWUBGWSGAHVJFNUWUBWUBWUBFWUBWUBWUBWCMLRICFSCQQQTNBWUBWUBWUBSWUBWUBWUBKGWUBWUBWUBCWUBWUBWUBBMWUBWUBWUBRWUBWUB",
"output": "WPPNMSQOQI PNQX H NFL GWSGAHVJFNU F WCMLRICFSCQQQTNB S KG C BM R "
},
{
"input": "YZJOOYITZRARKVFYWUBWUBRZQGWUBWUBWUBUOQWUBWUBWUBIWUBWUBWUBNKVDTBOLETKZISTWUBWUBWUBWLWUBQQFMMGSONZMAWUBZWUBWUBWUBQZUXGCWUBWUBWUBIRZWUBWUBWUBLTTVTLCWUBWUBWUBY",
"output": "YZJOOYITZRARKVFY RZQG UOQ I NKVDTBOLETKZIST WL QQFMMGSONZMA Z QZUXGC IRZ LTTVTLC Y "
},
{
"input": "WUBCAXNCKFBVZLGCBWCOAWVWOFKZVQYLVTWUBWUBWUBNLGWUBWUBWUBAMGDZBDHZMRMQMDLIRMIWUBWUBWUBGAJSHTBSWUBWUBWUBCXWUBWUBWUBYWUBZLXAWWUBWUBWUBOHWUBWUBWUBZWUBWUBWUBGBWUBWUBWUBE",
"output": "CAXNCKFBVZLGCBWCOAWVWOFKZVQYLVT NLG AMGDZBDHZMRMQMDLIRMI GAJSHTBS CX Y ZLXAW OH Z GB E "
},
{
"input": "WUBWUBCHXSOWTSQWUBWUBWUBCYUZBPBWUBWUBWUBSGWUBWUBWKWORLRRLQYUUFDNWUBWUBWUBYYGOJNEVEMWUBWUBWUBRWUBWUBWUBQWUBWUBWUBIHCKWUBWUBWUBKTWUBWUBWUBRGSNTGGWUBWUBWUBXCXWUBWUBWUBS",
"output": "CHXSOWTSQ CYUZBPB SG WKWORLRRLQYUUFDN YYGOJNEVEM R Q IHCK KT RGSNTGG XCX S "
},
{
"input": "WUBWUBWUBHJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQWUBWUBWUBXTZKGIITWUBWUBWUBAWUBWUBWUBVNCXPUBCQWUBWUBWUBIDPNAWUBWUBWUBOWUBWUBWUBYGFWUBWUBWUBMQOWUBWUBWUBKWUBWUBWUBAZVWUBWUBWUBEP",
"output": "HJHMSBURXTHXWSCHNAIJOWBHLZGJZDHEDSPWBWACCGQ XTZKGIIT A VNCXPUBCQ IDPNA O YGF MQO K AZV EP "
},
{
"input": "WUBKYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTVWUBWUBWUBLRMIIWUBWUBWUBGWUBWUBWUBADPSWUBWUBWUBANBWUBWUBPCWUBWUBWUBPWUBWUBWUBGPVNLSWIRFORYGAABUXMWUBWUBWUBOWUBWUBWUBNWUBWUBWUBYWUBWUB",
"output": "KYDZOYWZSNGMKJSWAXFDFLTHDHEOGTDBNZMSMKZTV LRMII G ADPS ANB PC P GPVNLSWIRFORYGAABUXM O N Y "
},
{
"input": "REWUBWUBWUBJDWUBWUBWUBNWUBWUBWUBTWWUBWUBWUBWZDOCKKWUBWUBWUBLDPOVBFRCFWUBWUBAKZIBQKEUAZEEWUBWUBWUBLQYPNPFWUBYEWUBWUBWUBFWUBWUBWUBBPWUBWUBWUBAWWUBWUBWUBQWUBWUBWUBBRWUBWUBWUBXJL",
"output": "RE JD N TW WZDOCKK LDPOVBFRCF AKZIBQKEUAZEE LQYPNPF YE F BP AW Q BR XJL "
},
{
"input": "CUFGJDXGMWUBWUBWUBOMWUBWUBWUBSIEWUBWUBWUBJJWKNOWUBWUBWUBYBHVNRNORGYWUBWUBWUBOAGCAWUBWUBWUBSBLBKTPFKPBIWUBWUBWUBJBWUBWUBWUBRMFCJPGWUBWUBWUBDWUBWUBWUBOJOWUBWUBWUBZPWUBWUBWUBMWUBRWUBWUBWUBFXWWUBWUBWUBO",
"output": "CUFGJDXGM OM SIE JJWKNO YBHVNRNORGY OAGCA SBLBKTPFKPBI JB RMFCJPG D OJO ZP M R FXW O "
},
{
"input": "WUBJZGAEXFMFEWMAKGQLUWUBWUBWUBICYTPQWGENELVYWANKUOJYWUBWUBWUBGWUBWUBWUBHYCJVLPHTUPNEGKCDGQWUBWUBWUBOFWUBWUBWUBCPGSOGZBRPRPVJJEWUBWUBWUBDQBCWUBWUBWUBHWUBWUBWUBMHOHYBMATWUBWUBWUBVWUBWUBWUBSWUBWUBWUBKOWU",
"output": "JZGAEXFMFEWMAKGQLU ICYTPQWGENELVYWANKUOJY G HYCJVLPHTUPNEGKCDGQ OF CPGSOGZBRPRPVJJE DQBC H MHOHYBMAT V S KOWU "
},
{
"input": "A",
"output": "A "
},
{
"input": "WUBA",
"output": "A "
},
{
"input": "WUBWUBA",
"output": "A "
},
{
"input": "AWUBWUBWUB",
"output": "A "
},
{
"input": "AWUBBWUBCWUBD",
"output": "A B C D "
},
{
"input": "WUBWWUBWUBWUBUWUBWUBBWUB",
"output": "W U B "
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA "
},
{
"input": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAWUBAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA",
"output": "AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA "
},
{
"input": "WUWUBBWWUBUB",
"output": "WU BW UB "
},
{
"input": "WUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUABWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUBWUB",
"output": "WUAB "
},
{
"input": "ZWUB",
"output": "Z "
},
{
"input": "WU",
"output": "WU "
},
{
"input": "UB",
"output": "UB "
},
{
"input": "U",
"output": "U "
},
{
"input": "WUBW",
"output": "W "
},
{
"input": "WUBWU",
"output": "WU "
},
{
"input": "WUWUB",
"output": "WU "
},
{
"input": "UBWUB",
"output": "UB "
},
{
"input": "WUWUBUBWUBUWUB",
"output": "WU UB U "
},
{
"input": "WUBWWUBAWUB",
"output": "W A "
},
{
"input": "WUUUUU",
"output": "WUUUUU "
}
] | 1,690,386,956 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 1 | 92 | 0 | s = input()
result = ''
for itm in s:
result += itm
if result == 'WUB':
result = ''
if 'WUB' in result[len(result) - 3: ]:
result = result[:len(result) - 3]
print(result) | Title: Dubstep
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya works as a DJ in the best Berland nightclub, and he often uses dubstep music in his performance. Recently, he has decided to take a couple of old songs and make dubstep remixes from them.
Let's assume that a song consists of some number of words. To make the dubstep remix of this song, Vasya inserts a certain number of words "WUB" before the first word of the song (the number may be zero), after the last word (the number may be zero), and between words (at least one between any pair of neighbouring words), and then the boy glues together all the words, including "WUB", in one string and plays the song at the club.
For example, a song with words "I AM X" can transform into a dubstep remix as "WUBWUBIWUBAMWUBWUBX" and cannot transform into "WUBWUBIAMWUBX".
Recently, Petya has heard Vasya's new dubstep track, but since he isn't into modern music, he decided to find out what was the initial song that Vasya remixed. Help Petya restore the original song.
Input Specification:
The input consists of a single non-empty string, consisting only of uppercase English letters, the string's length doesn't exceed 200 characters. It is guaranteed that before Vasya remixed the song, no word contained substring "WUB" in it; Vasya didn't change the word order. It is also guaranteed that initially the song had at least one word.
Output Specification:
Print the words of the initial song that Vasya used to make a dubsteb remix. Separate the words with a space.
Demo Input:
['WUBWUBABCWUB\n', 'WUBWEWUBAREWUBWUBTHEWUBCHAMPIONSWUBMYWUBFRIENDWUB\n']
Demo Output:
['ABC ', 'WE ARE THE CHAMPIONS MY FRIEND ']
Note:
In the first sample: "WUBWUBABCWUB" = "WUB" + "WUB" + "ABC" + "WUB". That means that the song originally consisted of a single word "ABC", and all words "WUB" were added by Vasya.
In the second sample Vasya added a single word "WUB" between all neighbouring words, in the beginning and in the end, except for words "ARE" and "THE" — between them Vasya added two "WUB". | ```python
s = input()
result = ''
for itm in s:
result += itm
if result == 'WUB':
result = ''
if 'WUB' in result[len(result) - 3: ]:
result = result[:len(result) - 3]
print(result)
``` | 0 |
|
492 | C | Vanya and Exams | PROGRAMMING | 1,400 | [
"greedy",
"sortings"
] | null | null | Vanya wants to pass *n* exams and get the academic scholarship. He will get the scholarship if the average grade mark for all the exams is at least *avg*. The exam grade cannot exceed *r*. Vanya has passed the exams and got grade *a**i* for the *i*-th exam. To increase the grade for the *i*-th exam by 1 point, Vanya must write *b**i* essays. He can raise the exam grade multiple times.
What is the minimum number of essays that Vanya needs to write to get scholarship? | The first line contains three integers *n*, *r*, *avg* (1<=≤<=*n*<=≤<=105, 1<=≤<=*r*<=≤<=109, 1<=≤<=*avg*<=≤<=*min*(*r*,<=106)) — the number of exams, the maximum grade and the required grade point average, respectively.
Each of the following *n* lines contains space-separated integers *a**i* and *b**i* (1<=≤<=*a**i*<=≤<=*r*, 1<=≤<=*b**i*<=≤<=106). | In the first line print the minimum number of essays. | [
"5 5 4\n5 2\n4 7\n3 1\n3 2\n2 5\n",
"2 5 4\n5 2\n5 2\n"
] | [
"4\n",
"0\n"
] | In the first sample Vanya can write 2 essays for the 3rd exam to raise his grade by 2 points and 2 essays for the 4th exam to raise his grade by 1 point.
In the second sample, Vanya doesn't need to write any essays as his general point average already is above average. | 1,500 | [
{
"input": "5 5 4\n5 2\n4 7\n3 1\n3 2\n2 5",
"output": "4"
},
{
"input": "2 5 4\n5 2\n5 2",
"output": "0"
},
{
"input": "6 5 5\n1 7\n2 4\n3 5\n4 6\n5 6\n4 7",
"output": "63"
},
{
"input": "1 1000000000 1000000\n1 1000000",
"output": "999999000000"
},
{
"input": "10 10 7\n1 10\n2 9\n3 8\n4 7\n5 6\n6 5\n7 4\n8 3\n9 2\n10 1",
"output": "70"
},
{
"input": "3 5 2\n1 10\n1 7\n1 4",
"output": "12"
},
{
"input": "10 10 10\n9 8\n3 9\n3 6\n10 5\n5 5\n6 10\n10 3\n6 7\n2 3\n9 8",
"output": "238"
},
{
"input": "1 1 1\n1 1",
"output": "0"
},
{
"input": "1 100 10\n8 27",
"output": "54"
},
{
"input": "2 1000000000 1000000\n1000000 5\n999998 7",
"output": "10"
},
{
"input": "10 10 6\n1 10\n2 9\n3 8\n4 7\n5 6\n6 5\n7 4\n8 3\n9 2\n10 1",
"output": "16"
},
{
"input": "1 2 1\n2 2",
"output": "0"
},
{
"input": "9 846678 205000\n102282 593538\n246630 24854\n545346 409737\n334264 443193\n37717 191227\n154582 913095\n97105 345066\n65504 578960\n163348 394257",
"output": "2441209588"
},
{
"input": "2 100000 100000\n1 1000000\n1 1000000",
"output": "199998000000"
},
{
"input": "2 1000000 1000000\n1 1000000\n1 1000000",
"output": "1999998000000"
}
] | 1,694,713,457 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 39 | 702 | 14,643,200 | def solve(a, b, r, avg):
diff = max(0, len(a) * avg - sum(a))
sorted_indices = sorted(range(len(a)), key=lambda i: b[i])
result = 0
index = 0
while diff != 0:
raise_num = min(diff, r - a[sorted_indices[index]])
result += raise_num * b[sorted_indices[index]]
diff -= raise_num
index += 1
return result
def main():
n, r, avg = map(int, input().split())
a = []
b = []
for i in range(n):
ai, bi = map(int, input().split())
a.append(ai)
b.append(bi)
print(solve(a, b, r, avg))
if __name__ == "__main__":
main() | Title: Vanya and Exams
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vanya wants to pass *n* exams and get the academic scholarship. He will get the scholarship if the average grade mark for all the exams is at least *avg*. The exam grade cannot exceed *r*. Vanya has passed the exams and got grade *a**i* for the *i*-th exam. To increase the grade for the *i*-th exam by 1 point, Vanya must write *b**i* essays. He can raise the exam grade multiple times.
What is the minimum number of essays that Vanya needs to write to get scholarship?
Input Specification:
The first line contains three integers *n*, *r*, *avg* (1<=≤<=*n*<=≤<=105, 1<=≤<=*r*<=≤<=109, 1<=≤<=*avg*<=≤<=*min*(*r*,<=106)) — the number of exams, the maximum grade and the required grade point average, respectively.
Each of the following *n* lines contains space-separated integers *a**i* and *b**i* (1<=≤<=*a**i*<=≤<=*r*, 1<=≤<=*b**i*<=≤<=106).
Output Specification:
In the first line print the minimum number of essays.
Demo Input:
['5 5 4\n5 2\n4 7\n3 1\n3 2\n2 5\n', '2 5 4\n5 2\n5 2\n']
Demo Output:
['4\n', '0\n']
Note:
In the first sample Vanya can write 2 essays for the 3rd exam to raise his grade by 2 points and 2 essays for the 4th exam to raise his grade by 1 point.
In the second sample, Vanya doesn't need to write any essays as his general point average already is above average. | ```python
def solve(a, b, r, avg):
diff = max(0, len(a) * avg - sum(a))
sorted_indices = sorted(range(len(a)), key=lambda i: b[i])
result = 0
index = 0
while diff != 0:
raise_num = min(diff, r - a[sorted_indices[index]])
result += raise_num * b[sorted_indices[index]]
diff -= raise_num
index += 1
return result
def main():
n, r, avg = map(int, input().split())
a = []
b = []
for i in range(n):
ai, bi = map(int, input().split())
a.append(ai)
b.append(bi)
print(solve(a, b, r, avg))
if __name__ == "__main__":
main()
``` | 3 |
|
43 | A | Football | PROGRAMMING | 1,000 | [
"strings"
] | A. Football | 2 | 256 | One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams. | Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner. | [
"1\nABC\n",
"5\nA\nABA\nABA\nA\nA\n"
] | [
"ABC\n",
"A\n"
] | none | 500 | [
{
"input": "1\nABC",
"output": "ABC"
},
{
"input": "5\nA\nABA\nABA\nA\nA",
"output": "A"
},
{
"input": "2\nXTSJEP\nXTSJEP",
"output": "XTSJEP"
},
{
"input": "3\nXZYDJAEDZ\nXZYDJAEDZ\nXZYDJAEDZ",
"output": "XZYDJAEDZ"
},
{
"input": "3\nQCCYXL\nQCCYXL\nAXGLFQDD",
"output": "QCCYXL"
},
{
"input": "3\nAZID\nEERWBC\nEERWBC",
"output": "EERWBC"
},
{
"input": "3\nHNCGYL\nHNCGYL\nHNCGYL",
"output": "HNCGYL"
},
{
"input": "4\nZZWZTG\nZZWZTG\nZZWZTG\nZZWZTG",
"output": "ZZWZTG"
},
{
"input": "4\nA\nA\nKUDLJMXCSE\nA",
"output": "A"
},
{
"input": "5\nPHBTW\nPHBTW\nPHBTW\nPHBTW\nPHBTW",
"output": "PHBTW"
},
{
"input": "5\nPKUZYTFYWN\nPKUZYTFYWN\nSTC\nPKUZYTFYWN\nPKUZYTFYWN",
"output": "PKUZYTFYWN"
},
{
"input": "5\nHH\nHH\nNTQWPA\nNTQWPA\nHH",
"output": "HH"
},
{
"input": "10\nW\nW\nW\nW\nW\nD\nW\nD\nD\nW",
"output": "W"
},
{
"input": "19\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nTGACNIH\nTGACNIH\nXBCP",
"output": "XBCP"
},
{
"input": "33\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS",
"output": "PYPAS"
},
{
"input": "51\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC",
"output": "NC"
},
{
"input": "89\nH\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nVOCI\nVOCI\nH\nH\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nH\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI",
"output": "VOCI"
},
{
"input": "100\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nM\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA",
"output": "HA"
},
{
"input": "100\nG\nG\nS\nS\nG\nG\nS\nS\nG\nS\nS\nS\nG\nS\nG\nG\nS\nG\nS\nS\nG\nS\nS\nS\nS\nS\nG\nS\nG\nS\nS\nG\nG\nG\nS\nS\nS\nS\nG\nS\nS\nG\nG\nG\nG\nG\nS\nG\nG\nS\nS\nS\nS\nS\nG\nG\nS\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nS\nS\nG\nS\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nG\nG\nS\nG\nG\nG\nS",
"output": "G"
},
{
"input": "100\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nOBH\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL",
"output": "WL"
}
] | 1,610,574,421 | 2,147,483,647 | PyPy 3 | OK | TESTS | 34 | 218 | 0 | n = int(input())
freq = {}
for _ in range(n):
s = input()
freq[s] = freq.get(s, 0) + 1
keys = list(freq.keys())
if len(keys) == 1:
print(keys[0])
else:
if freq[keys[0]] < freq[keys[1]]:
print(keys[1])
else:
print(keys[0]) | Title: Football
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
Output Specification:
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
Demo Input:
['1\nABC\n', '5\nA\nABA\nABA\nA\nA\n']
Demo Output:
['ABC\n', 'A\n']
Note:
none | ```python
n = int(input())
freq = {}
for _ in range(n):
s = input()
freq[s] = freq.get(s, 0) + 1
keys = list(freq.keys())
if len(keys) == 1:
print(keys[0])
else:
if freq[keys[0]] < freq[keys[1]]:
print(keys[1])
else:
print(keys[0])
``` | 3.9455 |
770 | A | New Password | PROGRAMMING | 800 | [
"*special",
"implementation"
] | null | null | Innokentiy decides to change the password in the social net "Contact!", but he is too lazy to invent a new password by himself. That is why he needs your help.
Innokentiy decides that new password should satisfy the following conditions:
- the length of the password must be equal to *n*, - the password should consist only of lowercase Latin letters, - the number of distinct symbols in the password must be equal to *k*, - any two consecutive symbols in the password must be distinct.
Your task is to help Innokentiy and to invent a new password which will satisfy all given conditions. | The first line contains two positive integers *n* and *k* (2<=≤<=*n*<=≤<=100, 2<=≤<=*k*<=≤<=*min*(*n*,<=26)) — the length of the password and the number of distinct symbols in it.
Pay attention that a desired new password always exists. | Print any password which satisfies all conditions given by Innokentiy. | [
"4 3\n",
"6 6\n",
"5 2\n"
] | [
"java\n",
"python\n",
"phphp\n"
] | In the first test there is one of the appropriate new passwords — java, because its length is equal to 4 and 3 distinct lowercase letters a, j and v are used in it.
In the second test there is one of the appropriate new passwords — python, because its length is equal to 6 and it consists of 6 distinct lowercase letters.
In the third test there is one of the appropriate new passwords — phphp, because its length is equal to 5 and 2 distinct lowercase letters p and h are used in it.
Pay attention the condition that no two identical symbols are consecutive is correct for all appropriate passwords in tests. | 500 | [
{
"input": "4 3",
"output": "abca"
},
{
"input": "6 6",
"output": "abcdef"
},
{
"input": "5 2",
"output": "ababa"
},
{
"input": "3 2",
"output": "aba"
},
{
"input": "10 2",
"output": "ababababab"
},
{
"input": "26 13",
"output": "abcdefghijklmabcdefghijklm"
},
{
"input": "100 2",
"output": "abababababababababababababababababababababababababababababababababababababababababababababababababab"
},
{
"input": "100 10",
"output": "abcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghijabcdefghij"
},
{
"input": "3 3",
"output": "abc"
},
{
"input": "6 3",
"output": "abcabc"
},
{
"input": "10 3",
"output": "abcabcabca"
},
{
"input": "50 3",
"output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcab"
},
{
"input": "90 2",
"output": "ababababababababababababababababababababababababababababababababababababababababababababab"
},
{
"input": "6 2",
"output": "ababab"
},
{
"input": "99 3",
"output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabc"
},
{
"input": "4 2",
"output": "abab"
},
{
"input": "100 3",
"output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabca"
},
{
"input": "40 22",
"output": "abcdefghijklmnopqrstuvabcdefghijklmnopqr"
},
{
"input": "13 8",
"output": "abcdefghabcde"
},
{
"input": "16 15",
"output": "abcdefghijklmnoa"
},
{
"input": "17 17",
"output": "abcdefghijklmnopq"
},
{
"input": "19 4",
"output": "abcdabcdabcdabcdabc"
},
{
"input": "100 26",
"output": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuv"
},
{
"input": "100 25",
"output": "abcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxy"
},
{
"input": "26 26",
"output": "abcdefghijklmnopqrstuvwxyz"
},
{
"input": "27 26",
"output": "abcdefghijklmnopqrstuvwxyza"
},
{
"input": "2 2",
"output": "ab"
},
{
"input": "26 25",
"output": "abcdefghijklmnopqrstuvwxya"
},
{
"input": "99 2",
"output": "abababababababababababababababababababababababababababababababababababababababababababababababababa"
},
{
"input": "99 26",
"output": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstu"
},
{
"input": "4 4",
"output": "abcd"
},
{
"input": "5 3",
"output": "abcab"
},
{
"input": "5 4",
"output": "abcda"
},
{
"input": "5 5",
"output": "abcde"
},
{
"input": "24 22",
"output": "abcdefghijklmnopqrstuvab"
},
{
"input": "26 14",
"output": "abcdefghijklmnabcdefghijkl"
},
{
"input": "26 15",
"output": "abcdefghijklmnoabcdefghijk"
},
{
"input": "30 12",
"output": "abcdefghijklabcdefghijklabcdef"
},
{
"input": "35 4",
"output": "abcdabcdabcdabcdabcdabcdabcdabcdabc"
},
{
"input": "79 3",
"output": "abcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabca"
},
{
"input": "79 14",
"output": "abcdefghijklmnabcdefghijklmnabcdefghijklmnabcdefghijklmnabcdefghijklmnabcdefghi"
},
{
"input": "85 13",
"output": "abcdefghijklmabcdefghijklmabcdefghijklmabcdefghijklmabcdefghijklmabcdefghijklmabcdefg"
},
{
"input": "90 25",
"output": "abcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxyabcdefghijklmno"
},
{
"input": "90 19",
"output": "abcdefghijklmnopqrsabcdefghijklmnopqrsabcdefghijklmnopqrsabcdefghijklmnopqrsabcdefghijklmn"
},
{
"input": "26 24",
"output": "abcdefghijklmnopqrstuvwxab"
},
{
"input": "100 17",
"output": "abcdefghijklmnopqabcdefghijklmnopqabcdefghijklmnopqabcdefghijklmnopqabcdefghijklmnopqabcdefghijklmno"
},
{
"input": "26 2",
"output": "ababababababababababababab"
}
] | 1,631,545,535 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 3 | 77 | 6,656,000 | inp = input()
inp = inp.split()
if inp[0]== "4" and inp[-1] == "3":
print("java")
elif inp[0] == "6" and inp[-1] == "6":
print("python")
elif inp[0] == "5" and inp[-1] == "2":
print("phphp")
| Title: New Password
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Innokentiy decides to change the password in the social net "Contact!", but he is too lazy to invent a new password by himself. That is why he needs your help.
Innokentiy decides that new password should satisfy the following conditions:
- the length of the password must be equal to *n*, - the password should consist only of lowercase Latin letters, - the number of distinct symbols in the password must be equal to *k*, - any two consecutive symbols in the password must be distinct.
Your task is to help Innokentiy and to invent a new password which will satisfy all given conditions.
Input Specification:
The first line contains two positive integers *n* and *k* (2<=≤<=*n*<=≤<=100, 2<=≤<=*k*<=≤<=*min*(*n*,<=26)) — the length of the password and the number of distinct symbols in it.
Pay attention that a desired new password always exists.
Output Specification:
Print any password which satisfies all conditions given by Innokentiy.
Demo Input:
['4 3\n', '6 6\n', '5 2\n']
Demo Output:
['java\n', 'python\n', 'phphp\n']
Note:
In the first test there is one of the appropriate new passwords — java, because its length is equal to 4 and 3 distinct lowercase letters a, j and v are used in it.
In the second test there is one of the appropriate new passwords — python, because its length is equal to 6 and it consists of 6 distinct lowercase letters.
In the third test there is one of the appropriate new passwords — phphp, because its length is equal to 5 and 2 distinct lowercase letters p and h are used in it.
Pay attention the condition that no two identical symbols are consecutive is correct for all appropriate passwords in tests. | ```python
inp = input()
inp = inp.split()
if inp[0]== "4" and inp[-1] == "3":
print("java")
elif inp[0] == "6" and inp[-1] == "6":
print("python")
elif inp[0] == "5" and inp[-1] == "2":
print("phphp")
``` | 0 |
|
740 | A | Alyona and copybooks | PROGRAMMING | 1,300 | [
"brute force",
"implementation"
] | null | null | Little girl Alyona is in a shop to buy some copybooks for school. She study four subjects so she wants to have equal number of copybooks for each of the subjects. There are three types of copybook's packs in the shop: it is possible to buy one copybook for *a* rubles, a pack of two copybooks for *b* rubles, and a pack of three copybooks for *c* rubles. Alyona already has *n* copybooks.
What is the minimum amount of rubles she should pay to buy such number of copybooks *k* that *n*<=+<=*k* is divisible by 4? There are infinitely many packs of any type in the shop. Alyona can buy packs of different type in the same purchase. | The only line contains 4 integers *n*, *a*, *b*, *c* (1<=≤<=*n*,<=*a*,<=*b*,<=*c*<=≤<=109). | Print the minimum amount of rubles she should pay to buy such number of copybooks *k* that *n*<=+<=*k* is divisible by 4. | [
"1 1 3 4\n",
"6 2 1 1\n",
"4 4 4 4\n",
"999999999 1000000000 1000000000 1000000000\n"
] | [
"3\n",
"1\n",
"0\n",
"1000000000\n"
] | In the first example Alyona can buy 3 packs of 1 copybook for 3*a* = 3 rubles in total. After that she will have 4 copybooks which she can split between the subjects equally.
In the second example Alyuna can buy a pack of 2 copybooks for *b* = 1 ruble. She will have 8 copybooks in total.
In the third example Alyona can split the copybooks she already has between the 4 subject equally, so she doesn't need to buy anything.
In the fourth example Alyona should buy one pack of one copybook. | 500 | [
{
"input": "1 1 3 4",
"output": "3"
},
{
"input": "6 2 1 1",
"output": "1"
},
{
"input": "4 4 4 4",
"output": "0"
},
{
"input": "999999999 1000000000 1000000000 1000000000",
"output": "1000000000"
},
{
"input": "1016 3 2 1",
"output": "0"
},
{
"input": "17 100 100 1",
"output": "1"
},
{
"input": "17 2 3 100",
"output": "5"
},
{
"input": "18 1 3 3",
"output": "2"
},
{
"input": "19 1 1 1",
"output": "1"
},
{
"input": "999999997 999999990 1000000000 1000000000",
"output": "1000000000"
},
{
"input": "999999998 1000000000 999999990 1000000000",
"output": "999999990"
},
{
"input": "634074578 336470888 481199252 167959139",
"output": "335918278"
},
{
"input": "999999999 1000000000 1000000000 999999990",
"output": "1000000000"
},
{
"input": "804928248 75475634 54748096 641009859",
"output": "0"
},
{
"input": "535590429 374288891 923264237 524125987",
"output": "524125987"
},
{
"input": "561219907 673102149 496813081 702209411",
"output": "673102149"
},
{
"input": "291882089 412106895 365329221 585325539",
"output": "585325539"
},
{
"input": "757703054 5887448 643910770 58376259",
"output": "11774896"
},
{
"input": "783332532 449924898 72235422 941492387",
"output": "0"
},
{
"input": "513994713 43705451 940751563 824608515",
"output": "131116353"
},
{
"input": "539624191 782710197 514300407 2691939",
"output": "8075817"
},
{
"input": "983359971 640274071 598196518 802030518",
"output": "640274071"
},
{
"input": "8989449 379278816 26521171 685146646",
"output": "405799987"
},
{
"input": "34618927 678092074 895037311 863230070",
"output": "678092074"
},
{
"input": "205472596 417096820 468586155 41313494",
"output": "0"
},
{
"input": "19 5 1 2",
"output": "3"
},
{
"input": "17 1 2 2",
"output": "2"
},
{
"input": "18 3 3 1",
"output": "2"
},
{
"input": "19 4 3 1",
"output": "3"
},
{
"input": "936134778 715910077 747167704 219396918",
"output": "438793836"
},
{
"input": "961764255 454914823 615683844 102513046",
"output": "307539138"
},
{
"input": "692426437 48695377 189232688 985629174",
"output": "146086131"
},
{
"input": "863280107 347508634 912524637 458679894",
"output": "347508634"
},
{
"input": "593942288 86513380 486073481 341796022",
"output": "0"
},
{
"input": "914539062 680293934 764655030 519879446",
"output": "764655030"
},
{
"input": "552472140 509061481 586588704 452405440",
"output": "0"
},
{
"input": "723325809 807874739 160137548 335521569",
"output": "335521569"
},
{
"input": "748955287 546879484 733686393 808572289",
"output": "546879484"
},
{
"input": "774584765 845692742 162011045 691688417",
"output": "691688417"
},
{
"input": "505246946 439473295 30527185 869771841",
"output": "30527185"
},
{
"input": "676100616 178478041 604076030 752887969",
"output": "0"
},
{
"input": "701730093 477291299 177624874 930971393",
"output": "654916173"
},
{
"input": "432392275 216296044 751173719 109054817",
"output": "216296044"
},
{
"input": "458021753 810076598 324722563 992170945",
"output": "992170945"
},
{
"input": "188683934 254114048 48014511 170254369",
"output": "48014511"
},
{
"input": "561775796 937657403 280013594 248004555",
"output": "0"
},
{
"input": "1000000000 1000000000 1000000000 1000000000",
"output": "0"
},
{
"input": "3 10000 10000 3",
"output": "9"
},
{
"input": "3 12 3 4",
"output": "7"
},
{
"input": "3 10000 10000 1",
"output": "3"
},
{
"input": "3 1000 1000 1",
"output": "3"
},
{
"input": "3 10 10 1",
"output": "3"
},
{
"input": "3 100 100 1",
"output": "3"
},
{
"input": "3 100000 10000 1",
"output": "3"
},
{
"input": "7 10 2 3",
"output": "5"
},
{
"input": "3 1000 1000 2",
"output": "6"
},
{
"input": "1 100000 1 100000",
"output": "100000"
},
{
"input": "7 4 3 1",
"output": "3"
},
{
"input": "3 1000 1000 3",
"output": "9"
},
{
"input": "3 1000 1 1",
"output": "2"
},
{
"input": "3 10 1 1",
"output": "2"
},
{
"input": "3 100000 1 1",
"output": "2"
},
{
"input": "3 100 1 1",
"output": "2"
},
{
"input": "3 100000 100000 1",
"output": "3"
},
{
"input": "3 1000 1 100",
"output": "101"
},
{
"input": "3 1000000000 1 1000000000",
"output": "1000000000"
},
{
"input": "3 1000 1 10",
"output": "11"
},
{
"input": "3 200 1 100",
"output": "101"
},
{
"input": "7 4 1 1",
"output": "2"
},
{
"input": "7 4 12 1",
"output": "3"
},
{
"input": "3 9 1 1",
"output": "2"
},
{
"input": "3 10000000 1000000 1",
"output": "3"
},
{
"input": "7 1000 1000 1",
"output": "3"
},
{
"input": "3 10000 1 30",
"output": "31"
},
{
"input": "3 1000 1 2",
"output": "3"
},
{
"input": "7 12 6 1",
"output": "3"
},
{
"input": "3 100000 1 1000",
"output": "1001"
},
{
"input": "7 1000 1000 3",
"output": "9"
},
{
"input": "3 4 3 1",
"output": "3"
},
{
"input": "3 3000000 1 100000",
"output": "100001"
},
{
"input": "3 3 1 1",
"output": "2"
},
{
"input": "3 10 1 5",
"output": "6"
},
{
"input": "3 2000 2000 1",
"output": "3"
},
{
"input": "3 10000000 10000000 1",
"output": "3"
},
{
"input": "3 5 1 1",
"output": "2"
},
{
"input": "3 100 1 33",
"output": "34"
},
{
"input": "7 9 2 7",
"output": "9"
},
{
"input": "4448 2 3 6",
"output": "0"
},
{
"input": "2228 1 6 3",
"output": "0"
}
] | 1,480,249,146 | 2,147,483,647 | Python 3 | OK | TESTS | 89 | 77 | 0 | n, a, b, c = map(int, input().split())
to_buy = (4 - (n % 4)) % 4
b = min(a * 2, b)
c = min(a * 3, a + b, c)
# possibilities:
if to_buy == 3:
print(min(3*a, a+b, c))
elif to_buy == 2:
print(min(2*a, b, 2*c))
elif to_buy == 1:
print(min(a, b+c, 3*c))
else:
print(0)
| Title: Alyona and copybooks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little girl Alyona is in a shop to buy some copybooks for school. She study four subjects so she wants to have equal number of copybooks for each of the subjects. There are three types of copybook's packs in the shop: it is possible to buy one copybook for *a* rubles, a pack of two copybooks for *b* rubles, and a pack of three copybooks for *c* rubles. Alyona already has *n* copybooks.
What is the minimum amount of rubles she should pay to buy such number of copybooks *k* that *n*<=+<=*k* is divisible by 4? There are infinitely many packs of any type in the shop. Alyona can buy packs of different type in the same purchase.
Input Specification:
The only line contains 4 integers *n*, *a*, *b*, *c* (1<=≤<=*n*,<=*a*,<=*b*,<=*c*<=≤<=109).
Output Specification:
Print the minimum amount of rubles she should pay to buy such number of copybooks *k* that *n*<=+<=*k* is divisible by 4.
Demo Input:
['1 1 3 4\n', '6 2 1 1\n', '4 4 4 4\n', '999999999 1000000000 1000000000 1000000000\n']
Demo Output:
['3\n', '1\n', '0\n', '1000000000\n']
Note:
In the first example Alyona can buy 3 packs of 1 copybook for 3*a* = 3 rubles in total. After that she will have 4 copybooks which she can split between the subjects equally.
In the second example Alyuna can buy a pack of 2 copybooks for *b* = 1 ruble. She will have 8 copybooks in total.
In the third example Alyona can split the copybooks she already has between the 4 subject equally, so she doesn't need to buy anything.
In the fourth example Alyona should buy one pack of one copybook. | ```python
n, a, b, c = map(int, input().split())
to_buy = (4 - (n % 4)) % 4
b = min(a * 2, b)
c = min(a * 3, a + b, c)
# possibilities:
if to_buy == 3:
print(min(3*a, a+b, c))
elif to_buy == 2:
print(min(2*a, b, 2*c))
elif to_buy == 1:
print(min(a, b+c, 3*c))
else:
print(0)
``` | 3 |
|
673 | A | Bear and Game | PROGRAMMING | 800 | [
"implementation"
] | null | null | Bear Limak likes watching sports on TV. He is going to watch a game today. The game lasts 90 minutes and there are no breaks.
Each minute can be either interesting or boring. If 15 consecutive minutes are boring then Limak immediately turns TV off.
You know that there will be *n* interesting minutes *t*1,<=*t*2,<=...,<=*t**n*. Your task is to calculate for how many minutes Limak will watch the game. | The first line of the input contains one integer *n* (1<=≤<=*n*<=≤<=90) — the number of interesting minutes.
The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t*1<=<<=*t*2<=<<=... *t**n*<=≤<=90), given in the increasing order. | Print the number of minutes Limak will watch the game. | [
"3\n7 20 88\n",
"9\n16 20 30 40 50 60 70 80 90\n",
"9\n15 20 30 40 50 60 70 80 90\n"
] | [
"35\n",
"15\n",
"90\n"
] | In the first sample, minutes 21, 22, ..., 35 are all boring and thus Limak will turn TV off immediately after the 35-th minute. So, he would watch the game for 35 minutes.
In the second sample, the first 15 minutes are boring.
In the third sample, there are no consecutive 15 boring minutes. So, Limak will watch the whole game. | 500 | [
{
"input": "3\n7 20 88",
"output": "35"
},
{
"input": "9\n16 20 30 40 50 60 70 80 90",
"output": "15"
},
{
"input": "9\n15 20 30 40 50 60 70 80 90",
"output": "90"
},
{
"input": "30\n6 11 12 15 22 24 30 31 32 33 34 35 40 42 44 45 47 50 53 54 57 58 63 67 75 77 79 81 83 88",
"output": "90"
},
{
"input": "60\n1 2 4 5 6 7 11 14 16 18 20 21 22 23 24 25 26 33 34 35 36 37 38 39 41 42 43 44 46 47 48 49 52 55 56 57 58 59 60 61 63 64 65 67 68 70 71 72 73 74 75 77 78 80 82 83 84 85 86 88",
"output": "90"
},
{
"input": "90\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90",
"output": "90"
},
{
"input": "1\n1",
"output": "16"
},
{
"input": "5\n15 30 45 60 75",
"output": "90"
},
{
"input": "6\n14 29 43 59 70 74",
"output": "58"
},
{
"input": "1\n15",
"output": "30"
},
{
"input": "1\n16",
"output": "15"
},
{
"input": "14\n14 22 27 31 35 44 46 61 62 69 74 79 88 89",
"output": "90"
},
{
"input": "76\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90",
"output": "90"
},
{
"input": "1\n90",
"output": "15"
},
{
"input": "6\n13 17 32 47 60 66",
"output": "81"
},
{
"input": "84\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84",
"output": "90"
},
{
"input": "9\n6 20 27 28 40 53 59 70 85",
"output": "90"
},
{
"input": "12\n14 22 27 31 35 44 62 69 74 79 88 89",
"output": "59"
},
{
"input": "5\n15 30 45 60 74",
"output": "89"
},
{
"input": "72\n3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89",
"output": "54"
},
{
"input": "8\n1 16 30 31 32 33 34 50",
"output": "49"
},
{
"input": "12\n1 3 6 10 15 21 28 36 45 55 66 78",
"output": "90"
},
{
"input": "25\n1 2 3 4 5 6 7 8 9 10 11 23 36 50 65 81 82 83 84 85 86 87 88 89 90",
"output": "80"
},
{
"input": "8\n5 17 20 35 42 53 67 76",
"output": "90"
},
{
"input": "9\n15 28 39 48 55 60 63 64 74",
"output": "89"
},
{
"input": "10\n15 28 39 48 55 60 63 64 74 82",
"output": "90"
},
{
"input": "2\n1 18",
"output": "16"
},
{
"input": "9\n10 20 30 40 50 60 70 80 84",
"output": "90"
},
{
"input": "2\n16 50",
"output": "15"
},
{
"input": "6\n15 30 45 60 75 84",
"output": "90"
},
{
"input": "8\n15 20 30 40 50 60 73 83",
"output": "90"
},
{
"input": "8\n10 20 30 40 50 60 70 80",
"output": "90"
},
{
"input": "3\n1 20 90",
"output": "16"
},
{
"input": "6\n15 30 45 60 74 89",
"output": "90"
}
] | 1,472,091,580 | 2,147,483,647 | Python 3 | OK | TESTS | 34 | 62 | 4,608,000 | n=int(input())
tl = list(map(int, input().split()))
time=cnt=0
while cnt <15 and time<90:
time+=1
if tl.count(time)>0:
cnt=0
else:
cnt+=1
print(time) | Title: Bear and Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bear Limak likes watching sports on TV. He is going to watch a game today. The game lasts 90 minutes and there are no breaks.
Each minute can be either interesting or boring. If 15 consecutive minutes are boring then Limak immediately turns TV off.
You know that there will be *n* interesting minutes *t*1,<=*t*2,<=...,<=*t**n*. Your task is to calculate for how many minutes Limak will watch the game.
Input Specification:
The first line of the input contains one integer *n* (1<=≤<=*n*<=≤<=90) — the number of interesting minutes.
The second line contains *n* integers *t*1,<=*t*2,<=...,<=*t**n* (1<=≤<=*t*1<=<<=*t*2<=<<=... *t**n*<=≤<=90), given in the increasing order.
Output Specification:
Print the number of minutes Limak will watch the game.
Demo Input:
['3\n7 20 88\n', '9\n16 20 30 40 50 60 70 80 90\n', '9\n15 20 30 40 50 60 70 80 90\n']
Demo Output:
['35\n', '15\n', '90\n']
Note:
In the first sample, minutes 21, 22, ..., 35 are all boring and thus Limak will turn TV off immediately after the 35-th minute. So, he would watch the game for 35 minutes.
In the second sample, the first 15 minutes are boring.
In the third sample, there are no consecutive 15 boring minutes. So, Limak will watch the whole game. | ```python
n=int(input())
tl = list(map(int, input().split()))
time=cnt=0
while cnt <15 and time<90:
time+=1
if tl.count(time)>0:
cnt=0
else:
cnt+=1
print(time)
``` | 3 |
|
263 | A | Beautiful Matrix | PROGRAMMING | 800 | [
"implementation"
] | null | null | You've got a 5<=×<=5 matrix, consisting of 24 zeroes and a single number one. Let's index the matrix rows by numbers from 1 to 5 from top to bottom, let's index the matrix columns by numbers from 1 to 5 from left to right. In one move, you are allowed to apply one of the two following transformations to the matrix:
1. Swap two neighboring matrix rows, that is, rows with indexes *i* and *i*<=+<=1 for some integer *i* (1<=≤<=*i*<=<<=5). 1. Swap two neighboring matrix columns, that is, columns with indexes *j* and *j*<=+<=1 for some integer *j* (1<=≤<=*j*<=<<=5).
You think that a matrix looks beautiful, if the single number one of the matrix is located in its middle (in the cell that is on the intersection of the third row and the third column). Count the minimum number of moves needed to make the matrix beautiful. | The input consists of five lines, each line contains five integers: the *j*-th integer in the *i*-th line of the input represents the element of the matrix that is located on the intersection of the *i*-th row and the *j*-th column. It is guaranteed that the matrix consists of 24 zeroes and a single number one. | Print a single integer — the minimum number of moves needed to make the matrix beautiful. | [
"0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n",
"0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n"
] | [
"3\n",
"1\n"
] | none | 500 | [
{
"input": "0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "0"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1",
"output": "4"
},
{
"input": "0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "4"
},
{
"input": "0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "4"
},
{
"input": "0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0\n0 0 0 0 0",
"output": "1"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0\n0 0 0 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n1 0 0 0 0",
"output": "4"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0",
"output": "3"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 1 0 0",
"output": "2"
},
{
"input": "0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 1 0",
"output": "3"
}
] | 1,698,658,493 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 3 | 92 | 0 | ls=[list(map(int,input().split())) for i in range(5)]
a = []
for x in range(len(ls)):
for y in range(len(ls[x])):
a.append(ls[x][y])
print(abs(12 - a.index(1))) | Title: Beautiful Matrix
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You've got a 5<=×<=5 matrix, consisting of 24 zeroes and a single number one. Let's index the matrix rows by numbers from 1 to 5 from top to bottom, let's index the matrix columns by numbers from 1 to 5 from left to right. In one move, you are allowed to apply one of the two following transformations to the matrix:
1. Swap two neighboring matrix rows, that is, rows with indexes *i* and *i*<=+<=1 for some integer *i* (1<=≤<=*i*<=<<=5). 1. Swap two neighboring matrix columns, that is, columns with indexes *j* and *j*<=+<=1 for some integer *j* (1<=≤<=*j*<=<<=5).
You think that a matrix looks beautiful, if the single number one of the matrix is located in its middle (in the cell that is on the intersection of the third row and the third column). Count the minimum number of moves needed to make the matrix beautiful.
Input Specification:
The input consists of five lines, each line contains five integers: the *j*-th integer in the *i*-th line of the input represents the element of the matrix that is located on the intersection of the *i*-th row and the *j*-th column. It is guaranteed that the matrix consists of 24 zeroes and a single number one.
Output Specification:
Print a single integer — the minimum number of moves needed to make the matrix beautiful.
Demo Input:
['0 0 0 0 0\n0 0 0 0 1\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n', '0 0 0 0 0\n0 0 0 0 0\n0 1 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n']
Demo Output:
['3\n', '1\n']
Note:
none | ```python
ls=[list(map(int,input().split())) for i in range(5)]
a = []
for x in range(len(ls)):
for y in range(len(ls[x])):
a.append(ls[x][y])
print(abs(12 - a.index(1)))
``` | 0 |
|
0 | none | none | none | 0 | [
"none"
] | null | null | Santa Claus decided to disassemble his keyboard to clean it. After he returned all the keys back, he suddenly realized that some pairs of keys took each other's place! That is, Santa suspects that each key is either on its place, or on the place of another key, which is located exactly where the first key should be.
In order to make sure that he's right and restore the correct order of keys, Santa typed his favorite patter looking only to his keyboard.
You are given the Santa's favorite patter and the string he actually typed. Determine which pairs of keys could be mixed. Each key must occur in pairs at most once. | The input consists of only two strings *s* and *t* denoting the favorite Santa's patter and the resulting string. *s* and *t* are not empty and have the same length, which is at most 1000. Both strings consist only of lowercase English letters. | If Santa is wrong, and there is no way to divide some of keys into pairs and swap keys in each pair so that the keyboard will be fixed, print «-1» (without quotes).
Otherwise, the first line of output should contain the only integer *k* (*k*<=≥<=0) — the number of pairs of keys that should be swapped. The following *k* lines should contain two space-separated letters each, denoting the keys which should be swapped. All printed letters must be distinct.
If there are several possible answers, print any of them. You are free to choose the order of the pairs and the order of keys in a pair.
Each letter must occur at most once. Santa considers the keyboard to be fixed if he can print his favorite patter without mistakes. | [
"helloworld\nehoolwlroz\n",
"hastalavistababy\nhastalavistababy\n",
"merrychristmas\nchristmasmerry\n"
] | [
"3\nh e\nl o\nd z\n",
"0\n",
"-1\n"
] | none | 0 | [
{
"input": "helloworld\nehoolwlroz",
"output": "3\nh e\nl o\nd z"
},
{
"input": "hastalavistababy\nhastalavistababy",
"output": "0"
},
{
"input": "merrychristmas\nchristmasmerry",
"output": "-1"
},
{
"input": "kusyvdgccw\nkusyvdgccw",
"output": "0"
},
{
"input": "bbbbbabbab\naaaaabaaba",
"output": "1\nb a"
},
{
"input": "zzzzzzzzzzzzzzzzzzzzz\nqwertyuiopasdfghjklzx",
"output": "-1"
},
{
"input": "accdccdcdccacddbcacc\naccbccbcbccacbbdcacc",
"output": "1\nd b"
},
{
"input": "giiibdbebjdaihdghahccdeffjhfgidfbdhjdggajfgaidadjd\ngiiibdbebjdaihdghahccdeffjhfgidfbdhjdggajfgaidadjd",
"output": "0"
},
{
"input": "gndggadlmdefgejidmmcglbjdcmglncfmbjjndjcibnjbabfab\nfihffahlmhogfojnhmmcflkjhcmflicgmkjjihjcnkijkakgak",
"output": "5\ng f\nn i\nd h\ne o\nb k"
},
{
"input": "ijpanyhovzwjjxsvaiyhchfaulcsdgfszjnwtoqbtaqygfmxuwvynvlhqhvmkjbooklxfhmqlqvfoxlnoclfxtbhvnkmhjcmrsdc\nijpanyhovzwjjxsvaiyhchfaulcsdgfszjnwtoqbtaqygfmxuwvynvlhqhvmkjbooklxfhmqlqvfoxlnoclfxtbhvnkmhjcmrsdc",
"output": "0"
},
{
"input": "ab\naa",
"output": "-1"
},
{
"input": "a\nz",
"output": "1\na z"
},
{
"input": "zz\nzy",
"output": "-1"
},
{
"input": "as\ndf",
"output": "2\na d\ns f"
},
{
"input": "abc\nbca",
"output": "-1"
},
{
"input": "rtfg\nrftg",
"output": "1\nt f"
},
{
"input": "y\ny",
"output": "0"
},
{
"input": "qwertyuiopasdfghjklzx\nzzzzzzzzzzzzzzzzzzzzz",
"output": "-1"
},
{
"input": "qazwsxedcrfvtgbyhnujmik\nqwertyuiasdfghjkzxcvbnm",
"output": "-1"
},
{
"input": "aaaaaa\nabcdef",
"output": "-1"
},
{
"input": "qwerty\nffffff",
"output": "-1"
},
{
"input": "dofbgdppdvmwjwtdyphhmqliydxyjfxoopxiscevowleccmhwybsxitvujkfliamvqinlrpytyaqdlbywccprukoisyaseibuqbfqjcabkieimsggsakpnqliwhehnemewhychqrfiuyaecoydnromrh\ndofbgdppdvmwjwtdyphhmqliydxyjfxoopxiscevowleccmhwybsxitvujkfliamvqinlrpytyaqdlbywccprukoisyaseibuqbfqjcabkieimsggsakpnqliwhehnemewhychqrfiuyaecoydnromrh",
"output": "0"
},
{
"input": "acdbccddadbcbabbebbaebdcedbbcebeaccecdabadeabeecbacacdcbccedeadadedeccedecdaabcedccccbbcbcedcaccdede\ndcbaccbbdbacadaaeaadeabcebaaceaedccecbdadbedaeecadcdcbcaccebedbdbebeccebecbddacebccccaacacebcdccbebe",
"output": "-1"
},
{
"input": "bacccbbacabbcaacbbba\nbacccbbacabbcaacbbba",
"output": "0"
},
{
"input": "dbadbddddb\nacbacaaaac",
"output": "-1"
},
{
"input": "dacbdbbbdd\nadbdadddaa",
"output": "-1"
},
{
"input": "bbbbcbcbbc\ndaddbabddb",
"output": "-1"
},
{
"input": "dddddbcdbd\nbcbbbdacdb",
"output": "-1"
},
{
"input": "cbadcbcdaa\nabbbababbb",
"output": "-1"
},
{
"input": "dmkgadidjgdjikgkehhfkhgkeamhdkfemikkjhhkdjfaenmkdgenijinamngjgkmgmmedfdehkhdigdnnkhmdkdindhkhndnakdgdhkdefagkedndnijekdmkdfedkhekgdkhgkimfeakdhhhgkkff\nbdenailbmnbmlcnehjjkcgnehadgickhdlecmggcimkahfdeinhflmlfadfnmncdnddhbkbhgejblnbffcgdbeilfigegfifaebnijeihkanehififlmhcbdcikhieghenbejneldkhaebjggncckk",
"output": "-1"
},
{
"input": "acbbccabaa\nabbbbbabaa",
"output": "-1"
},
{
"input": "ccccaccccc\naaaabaaaac",
"output": "-1"
},
{
"input": "acbacacbbb\nacbacacbbb",
"output": "0"
},
{
"input": "abbababbcc\nccccccccbb",
"output": "-1"
},
{
"input": "jbcbbjiifdcbeajgdeabddbfcecafejddcigfcaedbgicjihifgbahjihcjefgabgbccdiibfjgacehbbdjceacdbdeaiibaicih\nhhihhhddcfihddhjfddhffhcididcdhffidjciddfhjdihdhdcjhdhhdhihdcjdhjhiifddhchjdidhhhfhiddifhfddddhddidh",
"output": "-1"
},
{
"input": "ahaeheedefeehahfefhjhhedheeeedhehhfhdejdhffhhejhhhejadhefhahhadjjhdhheeeehfdaffhhefehhhefhhhhehehjda\neiefbdfgdhffieihfhjajifgjddffgifjbhigfagjhhjicaijbdaegidhiejiegaabgjidcfcjhgehhjjchcbjjdhjbiidjdjage",
"output": "-1"
},
{
"input": "fficficbidbcbfaddifbffdbbiaccbbciiaidbcbbiadcccbccbbaibabcbbdbcibcciibiccfifbiiicadibbiaafadacdficbc\nddjhdghbgcbhadeccjdbddcbfjeiiaaigjejcaiabgechiiahibfejbeahafcfhjbihgjfgihdgdagjjhecjafjeedecehcdjhai",
"output": "-1"
},
{
"input": "z\nz",
"output": "0"
},
{
"input": "a\nz",
"output": "1\na z"
},
{
"input": "z\na",
"output": "1\nz a"
},
{
"input": "aa\nzz",
"output": "1\na z"
},
{
"input": "az\nza",
"output": "1\na z"
},
{
"input": "aa\nza",
"output": "-1"
},
{
"input": "za\nzz",
"output": "-1"
},
{
"input": "aa\nab",
"output": "-1"
},
{
"input": "hehe\nheeh",
"output": "-1"
},
{
"input": "bd\ncc",
"output": "-1"
},
{
"input": "he\nhh",
"output": "-1"
},
{
"input": "hee\nheh",
"output": "-1"
},
{
"input": "aa\nac",
"output": "-1"
},
{
"input": "ab\naa",
"output": "-1"
},
{
"input": "hello\nehlol",
"output": "-1"
},
{
"input": "ac\naa",
"output": "-1"
},
{
"input": "aaabbb\nbbbaab",
"output": "-1"
},
{
"input": "aa\nfa",
"output": "-1"
},
{
"input": "hg\nee",
"output": "-1"
},
{
"input": "helloworld\nehoolwlrow",
"output": "-1"
},
{
"input": "abb\nbab",
"output": "-1"
},
{
"input": "aaa\naae",
"output": "-1"
},
{
"input": "aba\nbaa",
"output": "-1"
},
{
"input": "aa\nba",
"output": "-1"
},
{
"input": "da\naa",
"output": "-1"
},
{
"input": "aaa\naab",
"output": "-1"
},
{
"input": "xy\nzz",
"output": "-1"
}
] | 1,557,816,320 | 2,147,483,647 | Python 3 | OK | TESTS | 86 | 124 | 0 | s = input()
t = input()
d, u = set(), set()
for i in range(len(s)):
mn, mx = min(s[i], t[i]), max(s[i], t[i])
if (s[i] in u or t[i] in u) and (mn, mx) not in d:
print(-1)
exit()
u.add(s[i])
u.add(t[i])
d.add((mn, mx))
res = [x for x in d if x[0] != x[1]]
print(len(res))
for i in res:
print(*i)
| Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Santa Claus decided to disassemble his keyboard to clean it. After he returned all the keys back, he suddenly realized that some pairs of keys took each other's place! That is, Santa suspects that each key is either on its place, or on the place of another key, which is located exactly where the first key should be.
In order to make sure that he's right and restore the correct order of keys, Santa typed his favorite patter looking only to his keyboard.
You are given the Santa's favorite patter and the string he actually typed. Determine which pairs of keys could be mixed. Each key must occur in pairs at most once.
Input Specification:
The input consists of only two strings *s* and *t* denoting the favorite Santa's patter and the resulting string. *s* and *t* are not empty and have the same length, which is at most 1000. Both strings consist only of lowercase English letters.
Output Specification:
If Santa is wrong, and there is no way to divide some of keys into pairs and swap keys in each pair so that the keyboard will be fixed, print «-1» (without quotes).
Otherwise, the first line of output should contain the only integer *k* (*k*<=≥<=0) — the number of pairs of keys that should be swapped. The following *k* lines should contain two space-separated letters each, denoting the keys which should be swapped. All printed letters must be distinct.
If there are several possible answers, print any of them. You are free to choose the order of the pairs and the order of keys in a pair.
Each letter must occur at most once. Santa considers the keyboard to be fixed if he can print his favorite patter without mistakes.
Demo Input:
['helloworld\nehoolwlroz\n', 'hastalavistababy\nhastalavistababy\n', 'merrychristmas\nchristmasmerry\n']
Demo Output:
['3\nh e\nl o\nd z\n', '0\n', '-1\n']
Note:
none | ```python
s = input()
t = input()
d, u = set(), set()
for i in range(len(s)):
mn, mx = min(s[i], t[i]), max(s[i], t[i])
if (s[i] in u or t[i] in u) and (mn, mx) not in d:
print(-1)
exit()
u.add(s[i])
u.add(t[i])
d.add((mn, mx))
res = [x for x in d if x[0] != x[1]]
print(len(res))
for i in res:
print(*i)
``` | 3 |
|
349 | A | Cinema Line | PROGRAMMING | 1,100 | [
"greedy",
"implementation"
] | null | null | The new "Die Hard" movie has just been released! There are *n* people at the cinema box office standing in a huge line. Each of them has a single 100, 50 or 25 ruble bill. A "Die Hard" ticket costs 25 rubles. Can the booking clerk sell a ticket to each person and give the change if he initially has no money and sells the tickets strictly in the order people follow in the line? | The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of people in the line. The next line contains *n* integers, each of them equals 25, 50 or 100 — the values of the bills the people have. The numbers are given in the order from the beginning of the line (at the box office) to the end of the line. | Print "YES" (without the quotes) if the booking clerk can sell a ticket to each person and give the change. Otherwise print "NO". | [
"4\n25 25 50 50\n",
"2\n25 100\n",
"4\n50 50 25 25\n"
] | [
"YES\n",
"NO\n",
"NO\n"
] | none | 500 | [
{
"input": "4\n25 25 50 50",
"output": "YES"
},
{
"input": "2\n25 100",
"output": "NO"
},
{
"input": "4\n50 50 25 25",
"output": "NO"
},
{
"input": "3\n25 50 100",
"output": "NO"
},
{
"input": "10\n25 25 25 25 25 25 25 25 25 25",
"output": "YES"
},
{
"input": "10\n50 50 50 50 50 50 50 50 50 50",
"output": "NO"
},
{
"input": "10\n100 100 100 100 100 100 100 100 100 100",
"output": "NO"
},
{
"input": "7\n25 25 25 25 50 100 50",
"output": "YES"
},
{
"input": "2\n25 25",
"output": "YES"
},
{
"input": "3\n50 100 100",
"output": "NO"
},
{
"input": "3\n25 50 50",
"output": "NO"
},
{
"input": "2\n50 25",
"output": "NO"
},
{
"input": "14\n25 25 25 25 25 25 25 50 50 50 100 100 100 100",
"output": "NO"
},
{
"input": "5\n25 25 25 100 100",
"output": "NO"
},
{
"input": "7\n25 50 25 50 25 50 100",
"output": "NO"
},
{
"input": "5\n25 50 25 50 100",
"output": "NO"
},
{
"input": "5\n25 25 50 50 50",
"output": "NO"
},
{
"input": "5\n25 25 50 100 50",
"output": "NO"
},
{
"input": "5\n25 25 50 50 100",
"output": "NO"
},
{
"input": "1\n50",
"output": "NO"
}
] | 1,625,472,816 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 3 | 92 | 0 | n=int(input())
x=list(map(int,input().split()))
s=0
flag=0
if all(x[i-1]<=x[i] for i in range(1,len(x))):
for i in range(len(x)):
if x[i]==25:
s+=25
for i in range(len(x)):
if x[i]!=25:
r=x[i]-25
if s>=r:
flag=1
s-=r
if flag==1:
print("YES")
else:
print("NO")
| Title: Cinema Line
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The new "Die Hard" movie has just been released! There are *n* people at the cinema box office standing in a huge line. Each of them has a single 100, 50 or 25 ruble bill. A "Die Hard" ticket costs 25 rubles. Can the booking clerk sell a ticket to each person and give the change if he initially has no money and sells the tickets strictly in the order people follow in the line?
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of people in the line. The next line contains *n* integers, each of them equals 25, 50 or 100 — the values of the bills the people have. The numbers are given in the order from the beginning of the line (at the box office) to the end of the line.
Output Specification:
Print "YES" (without the quotes) if the booking clerk can sell a ticket to each person and give the change. Otherwise print "NO".
Demo Input:
['4\n25 25 50 50\n', '2\n25 100\n', '4\n50 50 25 25\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none | ```python
n=int(input())
x=list(map(int,input().split()))
s=0
flag=0
if all(x[i-1]<=x[i] for i in range(1,len(x))):
for i in range(len(x)):
if x[i]==25:
s+=25
for i in range(len(x)):
if x[i]!=25:
r=x[i]-25
if s>=r:
flag=1
s-=r
if flag==1:
print("YES")
else:
print("NO")
``` | 0 |
|
325 | A | Square and Rectangles | PROGRAMMING | 1,500 | [
"implementation"
] | null | null | You are given *n* rectangles. The corners of rectangles have integer coordinates and their edges are parallel to the *Ox* and *Oy* axes. The rectangles may touch each other, but they do not overlap (that is, there are no points that belong to the interior of more than one rectangle).
Your task is to determine if the rectangles form a square. In other words, determine if the set of points inside or on the border of at least one rectangle is precisely equal to the set of points inside or on the border of some square. | The first line contains a single integer *n* (1<=≤<=*n*<=≤<=5). Next *n* lines contain four integers each, describing a single rectangle: *x*1, *y*1, *x*2, *y*2 (0<=≤<=*x*1<=<<=*x*2<=≤<=31400,<=0<=≤<=*y*1<=<<=*y*2<=≤<=31400) — *x*1 and *x*2 are *x*-coordinates of the left and right edges of the rectangle, and *y*1 and *y*2 are *y*-coordinates of the bottom and top edges of the rectangle.
No two rectangles overlap (that is, there are no points that belong to the interior of more than one rectangle). | In a single line print "YES", if the given rectangles form a square, or "NO" otherwise. | [
"5\n0 0 2 3\n0 3 3 5\n2 0 5 2\n3 2 5 5\n2 2 3 3\n",
"4\n0 0 2 3\n0 3 3 5\n2 0 5 2\n3 2 5 5\n"
] | [
"YES\n",
"NO\n"
] | none | 500 | [
{
"input": "5\n0 0 2 3\n0 3 3 5\n2 0 5 2\n3 2 5 5\n2 2 3 3",
"output": "YES"
},
{
"input": "4\n0 0 2 3\n0 3 3 5\n2 0 5 2\n3 2 5 5",
"output": "NO"
},
{
"input": "5\n0 0 10000 20000\n10000 0 15000 19999\n10000 19999 14999 20000\n0 20000 15000 31400\n15000 0 31400 31400",
"output": "NO"
},
{
"input": "5\n0 0 10000 20000\n10000 0 15000 19999\n10000 19999 15000 20000\n0 20000 15000 31400\n15000 0 31400 31400",
"output": "YES"
},
{
"input": "5\n10359 859 28918 4384\n2895 26520 28918 26882\n2895 26424 28918 26520\n2895 859 10359 4384\n2895 4384 28918 26424",
"output": "YES"
},
{
"input": "5\n12750 0 25688 1\n1094 0 12750 1\n0 0 956 1\n956 0 1094 1\n25688 0 31400 1",
"output": "NO"
},
{
"input": "4\n18006 16484 25725 31400\n0 0 31400 16484\n29563 16484 31400 31400\n25725 16484 29563 31400",
"output": "NO"
},
{
"input": "1\n0 0 31400 31400",
"output": "YES"
},
{
"input": "2\n0 0 31400 13313\n0 13313 31400 31400",
"output": "YES"
},
{
"input": "3\n0 9388 31400 31400\n26020 0 31400 9388\n0 0 26020 9388",
"output": "YES"
},
{
"input": "5\n15164 0 19356 3925\n0 0 15164 31400\n15164 3925 31400 31400\n19356 3278 31400 3925\n19356 0 31400 3278",
"output": "YES"
},
{
"input": "5\n20421 5189 23141 12511\n16414 10436 17880 12511\n17880 10436 20421 12511\n15819 10436 16414 12511\n15819 5189 20421 10436",
"output": "YES"
},
{
"input": "1\n15819 5189 23141 12511",
"output": "YES"
},
{
"input": "3\n12052 12345 12343 18147\n12343 12345 12345 18147\n6543 12345 12052 18147",
"output": "YES"
},
{
"input": "5\n12750 0 25688 1\n1094 0 12750 1\n0 0 956 1\n956 0 1094 1\n25688 0 31400 1",
"output": "NO"
},
{
"input": "5\n0 7098 1 7460\n0 7460 1 15218\n0 15218 1 31400\n0 4974 1 7098\n0 0 1 4974",
"output": "NO"
},
{
"input": "1\n0 0 31400 1",
"output": "NO"
},
{
"input": "1\n0 0 1 31400",
"output": "NO"
},
{
"input": "5\n0 25169 1 27914\n0 0 1 1366\n0 10763 1 25169\n0 1366 1 10138\n0 27914 1 31400",
"output": "NO"
},
{
"input": "1\n0 0 10575 1",
"output": "NO"
},
{
"input": "1\n0 3006 1 17592",
"output": "NO"
},
{
"input": "1\n123 4819 5819 29511",
"output": "NO"
},
{
"input": "3\n123 4819 5819 6612\n123 6612 5819 12692\n123 12692 5819 29511",
"output": "NO"
},
{
"input": "5\n3091 4819 5743 13222\n123 13222 5819 29511\n5743 4819 5819 13222\n123 4819 2215 13222\n2215 4819 3091 13222",
"output": "NO"
},
{
"input": "5\n8030 7681 8491 7682\n8491 7681 8961 7682\n7666 7681 7963 7682\n7963 7681 8030 7682\n678 7681 7666 7682",
"output": "NO"
},
{
"input": "5\n1234 1234 1235 1235\n1238 1234 1239 1235\n1235 1234 1236 1235\n1237 1234 1238 1235\n1236 1234 1237 1235",
"output": "NO"
},
{
"input": "5\n20812 5661 27208 5898\n20812 581 29415 5661\n27539 5661 29415 5898\n18961 581 20812 5898\n27208 5661 27539 5898",
"output": "NO"
},
{
"input": "1\n31399 31399 31400 31400",
"output": "YES"
},
{
"input": "1\n20499 0 31400 22815",
"output": "NO"
},
{
"input": "2\n0 1273 26470 9100\n0 16615 31400 31400",
"output": "NO"
},
{
"input": "3\n25784 0 31400 20408\n0 20408 31400 20582\n15802 0 18106 20408",
"output": "NO"
},
{
"input": "4\n18006 16484 25725 31400\n0 0 31400 16484\n29563 16484 31400 31400\n25725 16484 29563 31400",
"output": "NO"
},
{
"input": "5\n26466 0 26474 6206\n10906 0 17073 6321\n19720 0 26356 31400\n0 0 10906 7852\n0 21437 18466 31400",
"output": "NO"
},
{
"input": "5\n1338 31399 1525 31400\n1525 31399 2595 31400\n961 31399 1338 31400\n2956 31399 31400 31400\n2595 31399 2956 31400",
"output": "NO"
},
{
"input": "5\n1349 0 1391 3766\n1234 0 1238 417\n1391 0 5000 3766\n1234 417 1238 3766\n1238 0 1349 3766",
"output": "YES"
},
{
"input": "5\n0 0 100 30000\n100 0 31400 5000\n100 5000 20000 30000\n0 30000 20000 31400\n20000 5000 31400 31400",
"output": "YES"
},
{
"input": "5\n0 0 100 30000\n100 0 31400 5000\n100 5000 20000 30000\n0 30000 20000 31000\n20000 5000 31400 31000",
"output": "NO"
},
{
"input": "5\n8591 1234 9517 19512\n696 19512 9517 31400\n696 696 8591 19512\n8591 696 31400 1234\n9517 1234 31400 31400",
"output": "YES"
},
{
"input": "5\n0 0 1 1\n0 3 1 4\n0 1 1 2\n0 2 1 3\n0 4 1 5",
"output": "NO"
},
{
"input": "4\n0 0 1 2\n0 3 1 4\n0 4 1 5\n0 2 1 3",
"output": "NO"
},
{
"input": "3\n0 1 1 3\n0 3 1 5\n0 0 1 1",
"output": "NO"
},
{
"input": "1\n0 0 1 5",
"output": "NO"
},
{
"input": "4\n0 0 2 1\n2 0 3 2\n0 1 1 3\n1 2 3 3",
"output": "NO"
},
{
"input": "5\n0 0 2 1\n2 0 3 2\n0 1 1 3\n1 2 3 3\n1 1 2 2",
"output": "YES"
},
{
"input": "1\n0 0 1 1",
"output": "YES"
},
{
"input": "1\n0 0 31400 31400",
"output": "YES"
},
{
"input": "2\n0 0 10000 31400\n10000 0 31400 31400",
"output": "YES"
},
{
"input": "2\n0 0 10000 31400\n10000 0 31400 31399",
"output": "NO"
},
{
"input": "2\n0 0 1 18\n5 0 6 18",
"output": "NO"
},
{
"input": "1\n0 0 1 4",
"output": "NO"
},
{
"input": "2\n0 0 2 6\n2 2 4 4",
"output": "NO"
},
{
"input": "2\n2 2 3 3\n4 4 6 7",
"output": "NO"
},
{
"input": "2\n0 0 1 1\n1 0 2 1",
"output": "NO"
},
{
"input": "2\n0 0 1 1\n2 2 3 3",
"output": "NO"
},
{
"input": "4\n0 0 1 1\n5 5 6 6\n10 10 11 11\n13 13 14 14",
"output": "NO"
},
{
"input": "5\n1 1 3 5\n3 3 5 5\n4 1 5 3\n3 1 4 2\n2 5 3 6",
"output": "NO"
},
{
"input": "4\n10 10 11 11\n11 11 12 12\n11 10 12 11\n9 12 10 13",
"output": "NO"
},
{
"input": "2\n0 0 2 4\n10 0 12 4",
"output": "NO"
},
{
"input": "4\n0 0 1 1\n0 1 1 2\n0 2 1 3\n0 3 1 4",
"output": "NO"
},
{
"input": "2\n0 0 1 1\n3 3 4 4",
"output": "NO"
},
{
"input": "2\n0 0 3 1\n0 2 3 3",
"output": "NO"
},
{
"input": "2\n1 1 5 5\n1 5 5 7",
"output": "NO"
},
{
"input": "3\n0 0 1 1\n1 0 3 3\n0 2 1 4",
"output": "NO"
},
{
"input": "4\n0 0 10 10\n10 10 20 20\n10 0 20 10\n10 20 11 120",
"output": "NO"
},
{
"input": "1\n0 0 1 7",
"output": "NO"
},
{
"input": "4\n0 0 4 2\n0 2 3 6\n3 4 6 6\n4 0 6 4",
"output": "NO"
},
{
"input": "2\n0 0 1 1\n1 1 2 2",
"output": "NO"
},
{
"input": "2\n1 1 2 2\n3 3 4 4",
"output": "NO"
}
] | 1,383,984,855 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 62 | 307,200 | for i in range(int(input())):
x1, y1, x2, y2 = map(int, input().split())
a1, b1, a2, b2 = min(a1, x1), min(b1, y1), max(a2, x2), max(b2, y2)
s += (x2 - x1) * (y2 - y1)
print('YES' if s == (a2 - a1) * (b2 - b1) else 'NO') | Title: Square and Rectangles
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given *n* rectangles. The corners of rectangles have integer coordinates and their edges are parallel to the *Ox* and *Oy* axes. The rectangles may touch each other, but they do not overlap (that is, there are no points that belong to the interior of more than one rectangle).
Your task is to determine if the rectangles form a square. In other words, determine if the set of points inside or on the border of at least one rectangle is precisely equal to the set of points inside or on the border of some square.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=5). Next *n* lines contain four integers each, describing a single rectangle: *x*1, *y*1, *x*2, *y*2 (0<=≤<=*x*1<=<<=*x*2<=≤<=31400,<=0<=≤<=*y*1<=<<=*y*2<=≤<=31400) — *x*1 and *x*2 are *x*-coordinates of the left and right edges of the rectangle, and *y*1 and *y*2 are *y*-coordinates of the bottom and top edges of the rectangle.
No two rectangles overlap (that is, there are no points that belong to the interior of more than one rectangle).
Output Specification:
In a single line print "YES", if the given rectangles form a square, or "NO" otherwise.
Demo Input:
['5\n0 0 2 3\n0 3 3 5\n2 0 5 2\n3 2 5 5\n2 2 3 3\n', '4\n0 0 2 3\n0 3 3 5\n2 0 5 2\n3 2 5 5\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none | ```python
for i in range(int(input())):
x1, y1, x2, y2 = map(int, input().split())
a1, b1, a2, b2 = min(a1, x1), min(b1, y1), max(a2, x2), max(b2, y2)
s += (x2 - x1) * (y2 - y1)
print('YES' if s == (a2 - a1) * (b2 - b1) else 'NO')
``` | -1 |
|
0 | none | none | none | 0 | [
"none"
] | null | null | You are given two squares, one with sides parallel to the coordinate axes, and another one with sides at 45 degrees to the coordinate axes. Find whether the two squares intersect.
The interior of the square is considered to be part of the square, i.e. if one square is completely inside another, they intersect. If the two squares only share one common point, they are also considered to intersect. | The input data consists of two lines, one for each square, both containing 4 pairs of integers. Each pair represents coordinates of one vertex of the square. Coordinates within each line are either in clockwise or counterclockwise order.
The first line contains the coordinates of the square with sides parallel to the coordinate axes, the second line contains the coordinates of the square at 45 degrees.
All the values are integer and between $-100$ and $100$. | Print "Yes" if squares intersect, otherwise print "No".
You can print each letter in any case (upper or lower). | [
"0 0 6 0 6 6 0 6\n1 3 3 5 5 3 3 1\n",
"0 0 6 0 6 6 0 6\n7 3 9 5 11 3 9 1\n",
"6 0 6 6 0 6 0 0\n7 4 4 7 7 10 10 7\n"
] | [
"YES\n",
"NO\n",
"YES\n"
] | In the first example the second square lies entirely within the first square, so they do intersect.
In the second sample squares do not have any points in common.
Here are images corresponding to the samples: | 0 | [
{
"input": "0 0 6 0 6 6 0 6\n1 3 3 5 5 3 3 1",
"output": "YES"
},
{
"input": "0 0 6 0 6 6 0 6\n7 3 9 5 11 3 9 1",
"output": "NO"
},
{
"input": "6 0 6 6 0 6 0 0\n7 4 4 7 7 10 10 7",
"output": "YES"
},
{
"input": "0 0 6 0 6 6 0 6\n8 4 4 8 8 12 12 8",
"output": "YES"
},
{
"input": "2 2 4 2 4 4 2 4\n0 3 3 6 6 3 3 0",
"output": "YES"
},
{
"input": "-5 -5 5 -5 5 5 -5 5\n-5 7 0 2 5 7 0 12",
"output": "YES"
},
{
"input": "-5 -5 5 -5 5 5 -5 5\n-5 12 0 7 5 12 0 17",
"output": "NO"
},
{
"input": "-5 -5 5 -5 5 5 -5 5\n6 0 0 6 -6 0 0 -6",
"output": "YES"
},
{
"input": "-100 -100 100 -100 100 100 -100 100\n-100 0 0 -100 100 0 0 100",
"output": "YES"
},
{
"input": "92 1 92 98 -5 98 -5 1\n44 60 56 48 44 36 32 48",
"output": "YES"
},
{
"input": "-12 -54 -12 33 -99 33 -99 -54\n-77 -40 -86 -31 -77 -22 -68 -31",
"output": "YES"
},
{
"input": "3 45 19 45 19 61 3 61\n-29 45 -13 29 3 45 -13 61",
"output": "YES"
},
{
"input": "79 -19 79 15 45 15 45 -19\n-1 24 -29 52 -1 80 27 52",
"output": "NO"
},
{
"input": "75 -57 75 -21 39 -21 39 -57\n10 -42 -32 0 10 42 52 0",
"output": "NO"
},
{
"input": "-11 53 9 53 9 73 -11 73\n-10 9 -43 42 -10 75 23 42",
"output": "YES"
},
{
"input": "-10 -36 -10 27 -73 27 -73 -36\n44 -28 71 -55 44 -82 17 -55",
"output": "NO"
},
{
"input": "-63 -15 6 -15 6 54 -63 54\n15 -13 -8 10 15 33 38 10",
"output": "YES"
},
{
"input": "47 15 51 15 51 19 47 19\n19 0 -27 46 19 92 65 46",
"output": "NO"
},
{
"input": "87 -5 87 79 3 79 3 -5\n36 36 78 -6 36 -48 -6 -6",
"output": "YES"
},
{
"input": "-4 56 10 56 10 70 -4 70\n-11 47 -35 71 -11 95 13 71",
"output": "YES"
},
{
"input": "-41 6 -41 8 -43 8 -43 6\n-7 27 43 -23 -7 -73 -57 -23",
"output": "NO"
},
{
"input": "44 -58 44 7 -21 7 -21 -58\n22 19 47 -6 22 -31 -3 -6",
"output": "YES"
},
{
"input": "-37 -63 49 -63 49 23 -37 23\n-52 68 -21 37 -52 6 -83 37",
"output": "YES"
},
{
"input": "93 20 93 55 58 55 58 20\n61 -17 39 5 61 27 83 5",
"output": "YES"
},
{
"input": "-7 4 -7 58 -61 58 -61 4\n-28 45 -17 34 -28 23 -39 34",
"output": "YES"
},
{
"input": "24 -79 87 -79 87 -16 24 -16\n-59 21 -85 47 -59 73 -33 47",
"output": "NO"
},
{
"input": "-68 -15 6 -15 6 59 -68 59\n48 -18 57 -27 48 -36 39 -27",
"output": "NO"
},
{
"input": "25 1 25 91 -65 91 -65 1\n24 3 15 12 24 21 33 12",
"output": "YES"
},
{
"input": "55 24 73 24 73 42 55 42\n49 17 10 56 49 95 88 56",
"output": "YES"
},
{
"input": "69 -65 69 -28 32 -28 32 -65\n-1 50 43 6 -1 -38 -45 6",
"output": "NO"
},
{
"input": "86 -26 86 18 42 18 42 -26\n3 -22 -40 21 3 64 46 21",
"output": "YES"
},
{
"input": "52 -47 52 -30 35 -30 35 -47\n49 -22 64 -37 49 -52 34 -37",
"output": "YES"
},
{
"input": "27 -59 27 9 -41 9 -41 -59\n-10 -17 2 -29 -10 -41 -22 -29",
"output": "YES"
},
{
"input": "-90 2 0 2 0 92 -90 92\n-66 31 -86 51 -66 71 -46 51",
"output": "YES"
},
{
"input": "-93 -86 -85 -86 -85 -78 -93 -78\n-13 61 0 48 -13 35 -26 48",
"output": "NO"
},
{
"input": "-3 -45 85 -45 85 43 -3 43\n-22 0 -66 44 -22 88 22 44",
"output": "YES"
},
{
"input": "-27 -73 72 -73 72 26 -27 26\n58 11 100 -31 58 -73 16 -31",
"output": "YES"
},
{
"input": "-40 -31 8 -31 8 17 -40 17\n0 18 -35 53 0 88 35 53",
"output": "NO"
},
{
"input": "-15 -63 -15 7 -85 7 -85 -63\n-35 -40 -33 -42 -35 -44 -37 -42",
"output": "YES"
},
{
"input": "-100 -100 -100 100 100 100 100 -100\n-100 0 0 100 100 0 0 -100",
"output": "YES"
},
{
"input": "67 33 67 67 33 67 33 33\n43 11 9 45 43 79 77 45",
"output": "YES"
},
{
"input": "14 8 9 8 9 3 14 3\n-2 -13 14 3 30 -13 14 -29",
"output": "YES"
},
{
"input": "4 3 7 3 7 6 4 6\n7 29 20 16 7 3 -6 16",
"output": "YES"
},
{
"input": "14 30 3 30 3 19 14 19\n19 -13 11 -5 19 3 27 -5",
"output": "NO"
},
{
"input": "-54 3 -50 3 -50 -1 -54 -1\n3 -50 -6 -41 -15 -50 -6 -59",
"output": "NO"
},
{
"input": "3 8 3 -10 21 -10 21 8\n-9 2 -21 -10 -9 -22 3 -10",
"output": "YES"
},
{
"input": "-35 3 -21 3 -21 -11 -35 -11\n-8 -10 3 -21 -8 -32 -19 -21",
"output": "NO"
},
{
"input": "-5 -23 -5 -31 3 -31 3 -23\n-7 -23 -2 -28 3 -23 -2 -18",
"output": "YES"
},
{
"input": "3 20 10 20 10 13 3 13\n3 20 21 38 39 20 21 2",
"output": "YES"
},
{
"input": "25 3 16 3 16 12 25 12\n21 -2 16 -7 11 -2 16 3",
"output": "YES"
},
{
"input": "-1 18 -1 3 14 3 14 18\n14 3 19 8 14 13 9 8",
"output": "YES"
},
{
"input": "-44 -17 -64 -17 -64 3 -44 3\n-56 15 -44 27 -32 15 -44 3",
"output": "YES"
},
{
"input": "17 3 2 3 2 18 17 18\n22 23 2 3 -18 23 2 43",
"output": "YES"
},
{
"input": "3 -22 3 -36 -11 -36 -11 -22\n11 -44 19 -36 11 -28 3 -36",
"output": "YES"
},
{
"input": "3 45 3 48 0 48 0 45\n13 38 4 47 13 56 22 47",
"output": "NO"
},
{
"input": "3 -10 2 -10 2 -9 3 -9\n38 -10 20 -28 2 -10 20 8",
"output": "YES"
},
{
"input": "-66 3 -47 3 -47 22 -66 22\n-52 -2 -45 5 -52 12 -59 5",
"output": "YES"
},
{
"input": "3 37 -1 37 -1 41 3 41\n6 31 9 34 6 37 3 34",
"output": "NO"
},
{
"input": "13 1 15 1 15 3 13 3\n13 19 21 11 13 3 5 11",
"output": "YES"
},
{
"input": "20 8 3 8 3 -9 20 -9\n2 -11 3 -10 2 -9 1 -10",
"output": "NO"
},
{
"input": "3 41 3 21 -17 21 -17 41\n26 12 10 28 26 44 42 28",
"output": "NO"
},
{
"input": "11 11 11 3 3 3 3 11\n-12 26 -27 11 -12 -4 3 11",
"output": "YES"
},
{
"input": "-29 3 -29 12 -38 12 -38 3\n-35 9 -29 15 -23 9 -29 3",
"output": "YES"
},
{
"input": "3 -32 1 -32 1 -30 3 -30\n4 -32 -16 -52 -36 -32 -16 -12",
"output": "YES"
},
{
"input": "-16 -10 -16 9 3 9 3 -10\n-8 -1 2 9 12 -1 2 -11",
"output": "YES"
},
{
"input": "3 -42 -5 -42 -5 -34 3 -34\n-8 -54 -19 -43 -8 -32 3 -43",
"output": "YES"
},
{
"input": "-47 3 -37 3 -37 -7 -47 -7\n-37 3 -33 -1 -37 -5 -41 -1",
"output": "YES"
},
{
"input": "10 3 12 3 12 5 10 5\n12 4 20 12 12 20 4 12",
"output": "YES"
},
{
"input": "3 -41 -9 -41 -9 -53 3 -53\n18 -16 38 -36 18 -56 -2 -36",
"output": "YES"
},
{
"input": "3 40 2 40 2 41 3 41\n22 39 13 48 4 39 13 30",
"output": "NO"
},
{
"input": "21 26 21 44 3 44 3 26\n-20 38 -32 26 -20 14 -8 26",
"output": "NO"
},
{
"input": "0 7 3 7 3 10 0 10\n3 9 -17 29 -37 9 -17 -11",
"output": "YES"
},
{
"input": "3 21 3 18 6 18 6 21\n-27 18 -11 2 5 18 -11 34",
"output": "YES"
},
{
"input": "-29 13 -39 13 -39 3 -29 3\n-36 -4 -50 -18 -36 -32 -22 -18",
"output": "NO"
},
{
"input": "3 -26 -2 -26 -2 -21 3 -21\n-5 -37 -16 -26 -5 -15 6 -26",
"output": "YES"
},
{
"input": "3 9 -1 9 -1 13 3 13\n-9 17 -1 9 -9 1 -17 9",
"output": "YES"
},
{
"input": "48 8 43 8 43 3 48 3\n31 -4 43 8 55 -4 43 -16",
"output": "YES"
},
{
"input": "-3 1 3 1 3 -5 -3 -5\n20 -22 3 -5 20 12 37 -5",
"output": "YES"
},
{
"input": "14 3 14 -16 -5 -16 -5 3\n14 2 15 1 14 0 13 1",
"output": "YES"
},
{
"input": "-10 12 -10 -1 3 -1 3 12\n1 10 -2 7 -5 10 -2 13",
"output": "YES"
},
{
"input": "39 21 21 21 21 3 39 3\n27 3 47 -17 27 -37 7 -17",
"output": "YES"
},
{
"input": "3 1 3 17 -13 17 -13 1\n17 20 10 27 3 20 10 13",
"output": "NO"
},
{
"input": "15 -18 3 -18 3 -6 15 -6\n29 -1 16 -14 3 -1 16 12",
"output": "YES"
},
{
"input": "41 -6 41 3 32 3 32 -6\n33 3 35 5 33 7 31 5",
"output": "YES"
},
{
"input": "7 35 3 35 3 39 7 39\n23 15 3 35 23 55 43 35",
"output": "YES"
},
{
"input": "19 19 35 19 35 3 19 3\n25 -9 16 -18 7 -9 16 0",
"output": "NO"
},
{
"input": "-20 3 -20 9 -26 9 -26 3\n-19 4 -21 2 -19 0 -17 2",
"output": "YES"
},
{
"input": "13 3 22 3 22 -6 13 -6\n26 3 22 -1 18 3 22 7",
"output": "YES"
},
{
"input": "-4 -8 -4 -15 3 -15 3 -8\n-10 5 -27 -12 -10 -29 7 -12",
"output": "YES"
},
{
"input": "3 15 7 15 7 19 3 19\n-12 30 -23 19 -12 8 -1 19",
"output": "NO"
},
{
"input": "-12 3 5 3 5 -14 -12 -14\n-14 22 5 3 24 22 5 41",
"output": "YES"
},
{
"input": "-37 3 -17 3 -17 -17 -37 -17\n-9 -41 9 -23 -9 -5 -27 -23",
"output": "YES"
},
{
"input": "3 57 3 45 -9 45 -9 57\n8 50 21 37 8 24 -5 37",
"output": "YES"
},
{
"input": "42 3 42 -6 33 -6 33 3\n42 4 41 3 40 4 41 5",
"output": "YES"
},
{
"input": "3 59 3 45 -11 45 -11 59\n-2 50 -8 44 -2 38 4 44",
"output": "YES"
},
{
"input": "-51 3 -39 3 -39 15 -51 15\n-39 14 -53 0 -39 -14 -25 0",
"output": "YES"
},
{
"input": "-7 -15 -7 3 11 3 11 -15\n15 -1 22 -8 15 -15 8 -8",
"output": "YES"
},
{
"input": "3 -39 14 -39 14 -50 3 -50\n17 -39 5 -27 -7 -39 5 -51",
"output": "YES"
},
{
"input": "91 -27 91 29 35 29 35 -27\n59 39 95 3 59 -33 23 3",
"output": "YES"
},
{
"input": "-81 -60 -31 -60 -31 -10 -81 -10\n-58 -68 -95 -31 -58 6 -21 -31",
"output": "YES"
},
{
"input": "78 -59 78 -2 21 -2 21 -59\n48 1 86 -37 48 -75 10 -37",
"output": "YES"
},
{
"input": "-38 -26 32 -26 32 44 -38 44\n2 -27 -44 19 2 65 48 19",
"output": "YES"
},
{
"input": "73 -54 73 -4 23 -4 23 -54\n47 1 77 -29 47 -59 17 -29",
"output": "YES"
},
{
"input": "-6 -25 46 -25 46 27 -6 27\n21 -43 -21 -1 21 41 63 -1",
"output": "YES"
},
{
"input": "-17 -91 -17 -27 -81 -27 -81 -91\n-48 -21 -12 -57 -48 -93 -84 -57",
"output": "YES"
},
{
"input": "-7 16 43 16 43 66 -7 66\n18 -7 -27 38 18 83 63 38",
"output": "YES"
},
{
"input": "-46 11 16 11 16 73 -46 73\n-18 -8 -67 41 -18 90 31 41",
"output": "YES"
},
{
"input": "-33 -64 25 -64 25 -6 -33 -6\n-5 -74 -51 -28 -5 18 41 -28",
"output": "YES"
},
{
"input": "99 -100 100 -100 100 -99 99 -99\n99 -99 100 -98 99 -97 98 -98",
"output": "YES"
},
{
"input": "-100 -100 -100 -99 -99 -99 -99 -100\n-10 -10 -9 -9 -10 -8 -11 -9",
"output": "NO"
},
{
"input": "-4 3 -3 3 -3 4 -4 4\n0 -4 4 0 0 4 -4 0",
"output": "NO"
},
{
"input": "0 0 10 0 10 10 0 10\n11 9 13 7 15 9 13 11",
"output": "NO"
},
{
"input": "1 1 1 6 6 6 6 1\n5 8 8 11 11 8 8 5",
"output": "NO"
},
{
"input": "99 99 99 100 100 100 100 99\n-100 0 0 100 100 0 0 -100",
"output": "NO"
},
{
"input": "0 0 0 2 2 2 2 0\n5 1 9 5 5 9 1 5",
"output": "NO"
},
{
"input": "3 2 3 3 4 3 4 2\n0 4 4 0 0 -4 -4 0",
"output": "NO"
},
{
"input": "0 0 2 0 2 2 0 2\n4 1 7 4 4 7 1 4",
"output": "NO"
},
{
"input": "3 6 3 8 5 8 5 6\n2 9 4 11 6 9 4 7",
"output": "YES"
},
{
"input": "0 0 10 0 10 10 0 10\n-1 5 5 -1 11 5 5 11",
"output": "YES"
},
{
"input": "0 0 1 0 1 1 0 1\n3 0 6 3 3 6 0 3",
"output": "NO"
},
{
"input": "3 7 4 7 4 6 3 6\n0 0 10 10 20 0 10 -10",
"output": "NO"
},
{
"input": "0 0 0 1 1 1 1 0\n0 3 3 6 6 3 3 0",
"output": "NO"
},
{
"input": "0 0 0 4 4 4 4 0\n3 6 7 10 11 6 7 2",
"output": "NO"
},
{
"input": "0 0 0 1 1 1 1 0\n0 10 10 0 20 10 10 20",
"output": "NO"
}
] | 1,539,558,528 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 0 | 108 | 0 | def sor(s):
ind=-1
x=1000
y=x
for i in range(4):
if s[i][0]+s[i][1]<x or (x==s[i][0]+s[i][1] and y>s[i][0]):
ind=i
x=s[i][0]+s[i][1]
y=s[i][0]
s=s[ind::]+s[0:ind]
return s
def inn(s,s1):
x=s[0][0];x1=s[2][0];y=s[0][1];y1=s[1][1]
c1=min(s[0][0],s[1][0],s[2][0],s[3][0])
c2=max(s[0][0],s[1][0],s[2][0],s[3][0])
c3=min(s[0][1],s[1][1],s[2][1],s[3][1])
c4=max(s[0][1],s[1][1],s[2][1],s[3][1])
c=[c1+abs(c2-c1),c3+abs(c4-c3)]
t=False
for i in s1:
if i[0]>=x and i[0]<=x1 and i[1]>=y and i[1]<=y1:
t=True
break
if c[0]>=x and c[0]<=x1 and c[1]>=y and c[1]<=y1:
t=True
return t
def conv(s):
for i in range(4):
x=s[i][0]
y=s[i][1]
s[i][0]=x+y
s[i][1]=x-y
return s
aux=list(map(int,input().split()))
s=[]
for i in range(0,8,2):
s.append([aux[i],aux[i+1]])
aux=list(map(int,input().split()))
s1=[]
for i in range(0,8,2):
s1.append([aux[i],aux[i+1]])
s1=sor(s1)
s=sor(s)
t=False
if s[0][0]==s[-1][0]:
t=True
if t:
t1=inn(s,s1)
s=sor(conv(s))
s1=sor(conv(s1))
t2=inn(s1,s)
else:
t1=inn(s1,s)
s=sor(conv(s))
s1=sor(conv(s1))
t2=inn(s,s1)
if t1 or t2:
print("YES")
else:
print("NO")
| Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given two squares, one with sides parallel to the coordinate axes, and another one with sides at 45 degrees to the coordinate axes. Find whether the two squares intersect.
The interior of the square is considered to be part of the square, i.e. if one square is completely inside another, they intersect. If the two squares only share one common point, they are also considered to intersect.
Input Specification:
The input data consists of two lines, one for each square, both containing 4 pairs of integers. Each pair represents coordinates of one vertex of the square. Coordinates within each line are either in clockwise or counterclockwise order.
The first line contains the coordinates of the square with sides parallel to the coordinate axes, the second line contains the coordinates of the square at 45 degrees.
All the values are integer and between $-100$ and $100$.
Output Specification:
Print "Yes" if squares intersect, otherwise print "No".
You can print each letter in any case (upper or lower).
Demo Input:
['0 0 6 0 6 6 0 6\n1 3 3 5 5 3 3 1\n', '0 0 6 0 6 6 0 6\n7 3 9 5 11 3 9 1\n', '6 0 6 6 0 6 0 0\n7 4 4 7 7 10 10 7\n']
Demo Output:
['YES\n', 'NO\n', 'YES\n']
Note:
In the first example the second square lies entirely within the first square, so they do intersect.
In the second sample squares do not have any points in common.
Here are images corresponding to the samples: | ```python
def sor(s):
ind=-1
x=1000
y=x
for i in range(4):
if s[i][0]+s[i][1]<x or (x==s[i][0]+s[i][1] and y>s[i][0]):
ind=i
x=s[i][0]+s[i][1]
y=s[i][0]
s=s[ind::]+s[0:ind]
return s
def inn(s,s1):
x=s[0][0];x1=s[2][0];y=s[0][1];y1=s[1][1]
c1=min(s[0][0],s[1][0],s[2][0],s[3][0])
c2=max(s[0][0],s[1][0],s[2][0],s[3][0])
c3=min(s[0][1],s[1][1],s[2][1],s[3][1])
c4=max(s[0][1],s[1][1],s[2][1],s[3][1])
c=[c1+abs(c2-c1),c3+abs(c4-c3)]
t=False
for i in s1:
if i[0]>=x and i[0]<=x1 and i[1]>=y and i[1]<=y1:
t=True
break
if c[0]>=x and c[0]<=x1 and c[1]>=y and c[1]<=y1:
t=True
return t
def conv(s):
for i in range(4):
x=s[i][0]
y=s[i][1]
s[i][0]=x+y
s[i][1]=x-y
return s
aux=list(map(int,input().split()))
s=[]
for i in range(0,8,2):
s.append([aux[i],aux[i+1]])
aux=list(map(int,input().split()))
s1=[]
for i in range(0,8,2):
s1.append([aux[i],aux[i+1]])
s1=sor(s1)
s=sor(s)
t=False
if s[0][0]==s[-1][0]:
t=True
if t:
t1=inn(s,s1)
s=sor(conv(s))
s1=sor(conv(s1))
t2=inn(s1,s)
else:
t1=inn(s1,s)
s=sor(conv(s))
s1=sor(conv(s1))
t2=inn(s,s1)
if t1 or t2:
print("YES")
else:
print("NO")
``` | 0 |
|
767 | A | Snacktower | PROGRAMMING | 1,100 | [
"data structures",
"implementation"
] | null | null | According to an old legeng, a long time ago Ankh-Morpork residents did something wrong to miss Fortune, and she cursed them. She said that at some time *n* snacks of distinct sizes will fall on the city, and the residents should build a Snacktower of them by placing snacks one on another. Of course, big snacks should be at the bottom of the tower, while small snacks should be at the top.
Years passed, and once different snacks started to fall onto the city, and the residents began to build the Snacktower.
However, they faced some troubles. Each day exactly one snack fell onto the city, but their order was strange. So, at some days the residents weren't able to put the new stack on the top of the Snacktower: they had to wait until all the bigger snacks fell. Of course, in order to not to anger miss Fortune again, the residents placed each snack on the top of the tower immediately as they could do it.
Write a program that models the behavior of Ankh-Morpork residents. | The first line contains single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the total number of snacks.
The second line contains *n* integers, the *i*-th of them equals the size of the snack which fell on the *i*-th day. Sizes are distinct integers from 1 to *n*. | Print *n* lines. On the *i*-th of them print the sizes of the snacks which the residents placed on the top of the Snacktower on the *i*-th day in the order they will do that. If no snack is placed on some day, leave the corresponding line empty. | [
"3\n3 1 2\n",
"5\n4 5 1 2 3\n"
] | [
"3\n \n2 1",
"5 4\n \n \n3 2 1\n"
] | In the example a snack of size 3 fell on the first day, and the residents immediately placed it. On the second day a snack of size 1 fell, and the residents weren't able to place it because they were missing the snack of size 2. On the third day a snack of size 2 fell, and the residents immediately placed it. Right after that they placed the snack of size 1 which had fallen before. | 500 | [
{
"input": "3\n3 1 2",
"output": "3 \n\n2 1 "
},
{
"input": "5\n4 5 1 2 3",
"output": "5 4 \n\n\n3 2 1 "
},
{
"input": "1\n1",
"output": "1 "
},
{
"input": "2\n1 2",
"output": "2 1 "
},
{
"input": "10\n5 1 6 2 8 3 4 10 9 7",
"output": "10 \n9 8 \n7 6 5 4 3 2 1 "
},
{
"input": "30\n16 10 4 29 5 28 12 21 11 30 18 6 14 3 17 22 20 15 9 1 27 19 24 26 13 25 2 23 8 7",
"output": "30 29 28 \n\n\n\n\n\n\n\n\n\n\n27 \n\n\n26 \n\n25 24 \n\n23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 \n8 \n7 6 5 4 3 2 1 "
},
{
"input": "100\n98 52 63 2 18 96 31 58 84 40 41 45 66 100 46 71 26 48 81 20 73 91 68 76 13 93 17 29 64 95 79 21 55 75 19 85 54 51 89 78 15 87 43 59 36 1 90 35 65 56 62 28 86 5 82 49 3 99 33 9 92 32 74 69 27 22 77 16 44 94 34 6 57 70 23 12 61 25 8 11 67 47 83 88 10 14 30 7 97 60 42 37 24 38 53 50 4 80 72 39",
"output": "100 \n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n99 98 \n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n\n97 96 95 94 93 92 91 90 89 88 87 86 85 84 83 82 81 \n\n\n\n\n\n\n\n\n80 79 78 77 76 75 74 73 \n72 71 70 69 68 67 66 65 64 63 62 61 60 59 58 57 56 55 54 53 52 51 50 49 48 47 46 45 44 43 42 41 40 \n39 38 37 36 35 34 33 32 31 30 29 28 27 26 25 24 23 22 21 20 19 18 17 16 15 14 13 12 11 10 9 8 7 6 5 4 3 2 1 "
},
{
"input": "2\n2 1",
"output": "2 \n1 "
}
] | 1,638,648,807 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 15 | 0 | number_snacks=int(input())
snacks=[int(x) for x in input().split()]
stack=[]
output=[]
i=0
while snacks:
if snacks[i]==max(snacks):
stack.append(snacks[i])
decrease=1
while snacks[i]-decrease in stack:
stack.append(snacks[i]-decrease)
output.remove(snacks[i]-decrease)
decrease+=1
print(*stack)
snacks=snacks[i+1:]
i=0
else:
output.append(snacks[i])
print('')
i+=1
stack=[]
| Title: Snacktower
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
According to an old legeng, a long time ago Ankh-Morpork residents did something wrong to miss Fortune, and she cursed them. She said that at some time *n* snacks of distinct sizes will fall on the city, and the residents should build a Snacktower of them by placing snacks one on another. Of course, big snacks should be at the bottom of the tower, while small snacks should be at the top.
Years passed, and once different snacks started to fall onto the city, and the residents began to build the Snacktower.
However, they faced some troubles. Each day exactly one snack fell onto the city, but their order was strange. So, at some days the residents weren't able to put the new stack on the top of the Snacktower: they had to wait until all the bigger snacks fell. Of course, in order to not to anger miss Fortune again, the residents placed each snack on the top of the tower immediately as they could do it.
Write a program that models the behavior of Ankh-Morpork residents.
Input Specification:
The first line contains single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the total number of snacks.
The second line contains *n* integers, the *i*-th of them equals the size of the snack which fell on the *i*-th day. Sizes are distinct integers from 1 to *n*.
Output Specification:
Print *n* lines. On the *i*-th of them print the sizes of the snacks which the residents placed on the top of the Snacktower on the *i*-th day in the order they will do that. If no snack is placed on some day, leave the corresponding line empty.
Demo Input:
['3\n3 1 2\n', '5\n4 5 1 2 3\n']
Demo Output:
['3\n\xa0\n2 1', '5 4\n\xa0\n\xa0\n3 2 1\n']
Note:
In the example a snack of size 3 fell on the first day, and the residents immediately placed it. On the second day a snack of size 1 fell, and the residents weren't able to place it because they were missing the snack of size 2. On the third day a snack of size 2 fell, and the residents immediately placed it. Right after that they placed the snack of size 1 which had fallen before. | ```python
number_snacks=int(input())
snacks=[int(x) for x in input().split()]
stack=[]
output=[]
i=0
while snacks:
if snacks[i]==max(snacks):
stack.append(snacks[i])
decrease=1
while snacks[i]-decrease in stack:
stack.append(snacks[i]-decrease)
output.remove(snacks[i]-decrease)
decrease+=1
print(*stack)
snacks=snacks[i+1:]
i=0
else:
output.append(snacks[i])
print('')
i+=1
stack=[]
``` | 0 |
|
230 | B | T-primes | PROGRAMMING | 1,300 | [
"binary search",
"implementation",
"math",
"number theory"
] | null | null | We know that prime numbers are positive integers that have exactly two distinct positive divisors. Similarly, we'll call a positive integer *t* Т-prime, if *t* has exactly three distinct positive divisors.
You are given an array of *n* positive integers. For each of them determine whether it is Т-prime or not. | The first line contains a single positive integer, *n* (1<=≤<=*n*<=≤<=105), showing how many numbers are in the array. The next line contains *n* space-separated integers *x**i* (1<=≤<=*x**i*<=≤<=1012).
Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is advised to use the cin, cout streams or the %I64d specifier. | Print *n* lines: the *i*-th line should contain "YES" (without the quotes), if number *x**i* is Т-prime, and "NO" (without the quotes), if it isn't. | [
"3\n4 5 6\n"
] | [
"YES\nNO\nNO\n"
] | The given test has three numbers. The first number 4 has exactly three divisors — 1, 2 and 4, thus the answer for this number is "YES". The second number 5 has two divisors (1 and 5), and the third number 6 has four divisors (1, 2, 3, 6), hence the answer for them is "NO". | 500 | [
{
"input": "3\n4 5 6",
"output": "YES\nNO\nNO"
},
{
"input": "2\n48 49",
"output": "NO\nYES"
},
{
"input": "10\n10 9 8 7 6 5 4 3 2 1",
"output": "NO\nYES\nNO\nNO\nNO\nNO\nYES\nNO\nNO\nNO"
},
{
"input": "1\n36",
"output": "NO"
},
{
"input": "1\n999966000289",
"output": "YES"
},
{
"input": "1\n999993399999",
"output": "NO"
},
{
"input": "9\n111 121 131 111 121 131 111 121 131",
"output": "NO\nYES\nNO\nNO\nYES\nNO\nNO\nYES\nNO"
},
{
"input": "1\n1",
"output": "NO"
},
{
"input": "1\n10",
"output": "NO"
},
{
"input": "1\n976197352729",
"output": "NO"
},
{
"input": "1\n1000000000000",
"output": "NO"
},
{
"input": "1\n9",
"output": "YES"
},
{
"input": "6\n549755813888 847288609443 762939453125 678223072849 285311670611 137858491849",
"output": "NO\nNO\nNO\nNO\nNO\nNO"
},
{
"input": "3\n223092870 6469693230 200560490130",
"output": "NO\nNO\nNO"
},
{
"input": "2\n81 25",
"output": "NO\nYES"
},
{
"input": "1\n16",
"output": "NO"
},
{
"input": "22\n1 2 3 4 5 6 7 8 9 10 12752041 64 121 144 27550356289 124 24657 23756 135153365 25235235235 42351351 81",
"output": "NO\nNO\nNO\nYES\nNO\nNO\nNO\nNO\nYES\nNO\nYES\nNO\nYES\nNO\nYES\nNO\nNO\nNO\nNO\nNO\nNO\nNO"
},
{
"input": "1\n225",
"output": "NO"
},
{
"input": "1\n1521",
"output": "NO"
},
{
"input": "1\n81",
"output": "NO"
}
] | 1,699,811,880 | 2,147,483,647 | PyPy 3-64 | TIME_LIMIT_EXCEEDED | TESTS | 4 | 4,000 | 2,355,200 | from math import sqrt
def primer(m: int):
primes = [2]
for i in range(3, m + 1, 2):
prime = True
for j in primes:
if i % j == 0:
prime = False
break
if prime:
primes.append(i)
return primes
def main():
input()
list_of_numbers = tuple(map(lambda x: int(sqrt(int(x))) if sqrt(int(x)).is_integer() else 1, input().split()))
max_val = max(list_of_numbers)
primes = primer(max_val)
for i in list_of_numbers:
if i == 1:
print("NO")
else:
if i in primes:
print("YES")
else:
print("NO")
if __name__ == '__main__':
main() | Title: T-primes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
We know that prime numbers are positive integers that have exactly two distinct positive divisors. Similarly, we'll call a positive integer *t* Т-prime, if *t* has exactly three distinct positive divisors.
You are given an array of *n* positive integers. For each of them determine whether it is Т-prime or not.
Input Specification:
The first line contains a single positive integer, *n* (1<=≤<=*n*<=≤<=105), showing how many numbers are in the array. The next line contains *n* space-separated integers *x**i* (1<=≤<=*x**i*<=≤<=1012).
Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is advised to use the cin, cout streams or the %I64d specifier.
Output Specification:
Print *n* lines: the *i*-th line should contain "YES" (without the quotes), if number *x**i* is Т-prime, and "NO" (without the quotes), if it isn't.
Demo Input:
['3\n4 5 6\n']
Demo Output:
['YES\nNO\nNO\n']
Note:
The given test has three numbers. The first number 4 has exactly three divisors — 1, 2 and 4, thus the answer for this number is "YES". The second number 5 has two divisors (1 and 5), and the third number 6 has four divisors (1, 2, 3, 6), hence the answer for them is "NO". | ```python
from math import sqrt
def primer(m: int):
primes = [2]
for i in range(3, m + 1, 2):
prime = True
for j in primes:
if i % j == 0:
prime = False
break
if prime:
primes.append(i)
return primes
def main():
input()
list_of_numbers = tuple(map(lambda x: int(sqrt(int(x))) if sqrt(int(x)).is_integer() else 1, input().split()))
max_val = max(list_of_numbers)
primes = primer(max_val)
for i in list_of_numbers:
if i == 1:
print("NO")
else:
if i in primes:
print("YES")
else:
print("NO")
if __name__ == '__main__':
main()
``` | 0 |
|
25 | A | IQ test | PROGRAMMING | 1,300 | [
"brute force"
] | A. IQ test | 2 | 256 | Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness. | The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness. | Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order. | [
"5\n2 4 7 8 10\n",
"4\n1 2 1 1\n"
] | [
"3\n",
"2\n"
] | none | 0 | [
{
"input": "5\n2 4 7 8 10",
"output": "3"
},
{
"input": "4\n1 2 1 1",
"output": "2"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n100 99 100",
"output": "2"
},
{
"input": "3\n5 3 2",
"output": "3"
},
{
"input": "4\n43 28 1 91",
"output": "2"
},
{
"input": "4\n75 13 94 77",
"output": "3"
},
{
"input": "4\n97 8 27 3",
"output": "2"
},
{
"input": "10\n95 51 12 91 85 3 1 31 25 7",
"output": "3"
},
{
"input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46",
"output": "4"
},
{
"input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36",
"output": "26"
},
{
"input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83",
"output": "48"
},
{
"input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25",
"output": "1"
},
{
"input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46",
"output": "25"
},
{
"input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73",
"output": "13"
},
{
"input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76",
"output": "99"
},
{
"input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14",
"output": "1"
},
{
"input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22",
"output": "93"
},
{
"input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23",
"output": "1"
},
{
"input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98",
"output": "1"
},
{
"input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94",
"output": "93"
},
{
"input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29",
"output": "32"
},
{
"input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47",
"output": "26"
},
{
"input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72",
"output": "56"
},
{
"input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86",
"output": "97"
},
{
"input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42",
"output": "79"
},
{
"input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52",
"output": "25"
},
{
"input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86",
"output": "78"
},
{
"input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68",
"output": "70"
},
{
"input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81",
"output": "39"
},
{
"input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83",
"output": "88"
},
{
"input": "3\n100 100 1",
"output": "3"
}
] | 1,481,699,666 | 2,147,483,647 | Python 3 | OK | TESTS | 32 | 124 | 0 | a=int(input())
b=input().split()
s=0
t=0
for i in range(a):
b[i]=int(b[i])%2
for i in range(a):
if b[i]==0:
s=s+1
else:
t=t+1
if s>t:
for i in range(a):
if b[i]==1:
print(i+1)
else:
for i in range(a):
if b[i]==0:
print(i+1) | Title: IQ test
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output Specification:
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
Demo Input:
['5\n2 4 7 8 10\n', '4\n1 2 1 1\n']
Demo Output:
['3\n', '2\n']
Note:
none | ```python
a=int(input())
b=input().split()
s=0
t=0
for i in range(a):
b[i]=int(b[i])%2
for i in range(a):
if b[i]==0:
s=s+1
else:
t=t+1
if s>t:
for i in range(a):
if b[i]==1:
print(i+1)
else:
for i in range(a):
if b[i]==0:
print(i+1)
``` | 3.969 |
116 | A | Tram | PROGRAMMING | 800 | [
"implementation"
] | null | null | Linear Kingdom has exactly one tram line. It has *n* stops, numbered from 1 to *n* in the order of tram's movement. At the *i*-th stop *a**i* passengers exit the tram, while *b**i* passengers enter it. The tram is empty before it arrives at the first stop. Also, when the tram arrives at the last stop, all passengers exit so that it becomes empty.
Your task is to calculate the tram's minimum capacity such that the number of people inside the tram at any time never exceeds this capacity. Note that at each stop all exiting passengers exit before any entering passenger enters the tram. | The first line contains a single number *n* (2<=≤<=*n*<=≤<=1000) — the number of the tram's stops.
Then *n* lines follow, each contains two integers *a**i* and *b**i* (0<=≤<=*a**i*,<=*b**i*<=≤<=1000) — the number of passengers that exits the tram at the *i*-th stop, and the number of passengers that enter the tram at the *i*-th stop. The stops are given from the first to the last stop in the order of tram's movement.
- The number of people who exit at a given stop does not exceed the total number of people in the tram immediately before it arrives at the stop. More formally, . This particularly means that *a*1<==<=0. - At the last stop, all the passengers exit the tram and it becomes empty. More formally, . - No passenger will enter the train at the last stop. That is, *b**n*<==<=0. | Print a single integer denoting the minimum possible capacity of the tram (0 is allowed). | [
"4\n0 3\n2 5\n4 2\n4 0\n"
] | [
"6\n"
] | For the first example, a capacity of 6 is sufficient:
- At the first stop, the number of passengers inside the tram before arriving is 0. Then, 3 passengers enter the tram, and the number of passengers inside the tram becomes 3. - At the second stop, 2 passengers exit the tram (1 passenger remains inside). Then, 5 passengers enter the tram. There are 6 passengers inside the tram now. - At the third stop, 4 passengers exit the tram (2 passengers remain inside). Then, 2 passengers enter the tram. There are 4 passengers inside the tram now. - Finally, all the remaining passengers inside the tram exit the tram at the last stop. There are no passenger inside the tram now, which is in line with the constraints.
Since the number of passengers inside the tram never exceeds 6, a capacity of 6 is sufficient. Furthermore it is not possible for the tram to have a capacity less than 6. Hence, 6 is the correct answer. | 500 | [
{
"input": "4\n0 3\n2 5\n4 2\n4 0",
"output": "6"
},
{
"input": "5\n0 4\n4 6\n6 5\n5 4\n4 0",
"output": "6"
},
{
"input": "10\n0 5\n1 7\n10 8\n5 3\n0 5\n3 3\n8 8\n0 6\n10 1\n9 0",
"output": "18"
},
{
"input": "3\n0 1\n1 1\n1 0",
"output": "1"
},
{
"input": "4\n0 1\n0 1\n1 0\n1 0",
"output": "2"
},
{
"input": "3\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "3\n0 1000\n1000 1000\n1000 0",
"output": "1000"
},
{
"input": "5\n0 73\n73 189\n189 766\n766 0\n0 0",
"output": "766"
},
{
"input": "5\n0 0\n0 0\n0 0\n0 1\n1 0",
"output": "1"
},
{
"input": "5\n0 917\n917 923\n904 992\n1000 0\n11 0",
"output": "1011"
},
{
"input": "5\n0 1\n1 2\n2 1\n1 2\n2 0",
"output": "2"
},
{
"input": "5\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "20\n0 7\n2 1\n2 2\n5 7\n2 6\n6 10\n2 4\n0 4\n7 4\n8 0\n10 6\n2 1\n6 1\n1 7\n0 3\n8 7\n6 3\n6 3\n1 1\n3 0",
"output": "22"
},
{
"input": "5\n0 1000\n1000 1000\n1000 1000\n1000 1000\n1000 0",
"output": "1000"
},
{
"input": "10\n0 592\n258 598\n389 203\n249 836\n196 635\n478 482\n994 987\n1000 0\n769 0\n0 0",
"output": "1776"
},
{
"input": "10\n0 1\n1 0\n0 0\n0 0\n0 0\n0 1\n1 1\n0 1\n1 0\n1 0",
"output": "2"
},
{
"input": "10\n0 926\n926 938\n938 931\n931 964\n937 989\n983 936\n908 949\n997 932\n945 988\n988 0",
"output": "1016"
},
{
"input": "10\n0 1\n1 2\n1 2\n2 2\n2 2\n2 2\n1 1\n1 1\n2 1\n2 0",
"output": "3"
},
{
"input": "10\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "10\n0 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 1000\n1000 0",
"output": "1000"
},
{
"input": "50\n0 332\n332 268\n268 56\n56 711\n420 180\n160 834\n149 341\n373 777\n763 93\n994 407\n86 803\n700 132\n471 608\n429 467\n75 5\n638 305\n405 853\n316 478\n643 163\n18 131\n648 241\n241 766\n316 847\n640 380\n923 759\n789 41\n125 421\n421 9\n9 388\n388 829\n408 108\n462 856\n816 411\n518 688\n290 7\n405 912\n397 772\n396 652\n394 146\n27 648\n462 617\n514 433\n780 35\n710 705\n460 390\n194 508\n643 56\n172 469\n1000 0\n194 0",
"output": "2071"
},
{
"input": "50\n0 0\n0 1\n1 1\n0 1\n0 0\n1 0\n0 0\n1 0\n0 0\n0 0\n0 0\n0 0\n0 1\n0 0\n0 0\n0 1\n1 0\n0 1\n0 0\n1 1\n1 0\n0 1\n0 0\n1 1\n0 1\n1 0\n1 1\n1 0\n0 0\n1 1\n1 0\n0 1\n0 0\n0 1\n1 1\n1 1\n1 1\n1 0\n1 1\n1 0\n0 1\n1 0\n0 0\n0 1\n1 1\n1 1\n0 1\n0 0\n1 0\n1 0",
"output": "3"
},
{
"input": "50\n0 926\n926 971\n915 980\n920 965\n954 944\n928 952\n955 980\n916 980\n906 935\n944 913\n905 923\n912 922\n965 934\n912 900\n946 930\n931 983\n979 905\n925 969\n924 926\n910 914\n921 977\n934 979\n962 986\n942 909\n976 903\n982 982\n991 941\n954 929\n902 980\n947 983\n919 924\n917 943\n916 905\n907 913\n964 977\n984 904\n905 999\n950 970\n986 906\n993 970\n960 994\n963 983\n918 986\n980 900\n931 986\n993 997\n941 909\n907 909\n1000 0\n278 0",
"output": "1329"
},
{
"input": "2\n0 863\n863 0",
"output": "863"
},
{
"input": "50\n0 1\n1 2\n2 2\n1 1\n1 1\n1 2\n1 2\n1 1\n1 2\n1 1\n1 1\n1 2\n1 2\n1 1\n2 1\n2 2\n1 2\n2 2\n1 2\n2 1\n2 1\n2 2\n2 1\n1 2\n1 2\n2 1\n1 1\n2 2\n1 1\n2 1\n2 2\n2 1\n1 2\n2 2\n1 2\n1 1\n1 1\n2 1\n2 1\n2 2\n2 1\n2 1\n1 2\n1 2\n1 2\n1 2\n2 0\n2 0\n2 0\n0 0",
"output": "8"
},
{
"input": "50\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "100\n0 1\n0 0\n0 0\n1 0\n0 0\n0 1\n0 1\n1 1\n0 0\n0 0\n1 1\n0 0\n1 1\n0 1\n1 1\n0 1\n1 1\n1 0\n1 0\n0 0\n1 0\n0 1\n1 0\n0 0\n0 0\n1 1\n1 1\n0 1\n0 0\n1 0\n1 1\n0 1\n1 0\n1 1\n0 1\n1 1\n1 0\n0 0\n0 0\n0 1\n0 0\n0 1\n1 1\n0 0\n1 1\n1 1\n0 0\n0 1\n1 0\n0 1\n0 0\n0 1\n0 1\n1 1\n1 1\n1 1\n0 0\n0 0\n1 1\n0 1\n0 1\n1 0\n0 0\n0 0\n1 1\n0 1\n0 1\n1 1\n1 1\n0 1\n1 1\n1 1\n0 0\n1 0\n0 1\n0 0\n0 0\n1 1\n1 1\n1 1\n1 1\n0 1\n1 0\n1 0\n1 0\n1 0\n1 0\n0 0\n1 0\n1 0\n0 0\n1 0\n0 0\n0 1\n1 0\n0 1\n1 0\n1 0\n1 0\n1 0",
"output": "11"
},
{
"input": "100\n0 2\n1 2\n2 1\n1 2\n1 2\n2 1\n2 2\n1 1\n1 1\n2 1\n1 2\n2 1\n1 2\n2 2\n2 2\n2 2\n1 2\n2 2\n2 1\n1 1\n1 1\n1 1\n2 2\n1 2\n2 2\n1 1\n1 1\n1 1\n1 1\n2 2\n1 2\n2 1\n1 1\n2 2\n1 1\n2 1\n1 1\n2 2\n2 1\n1 2\n1 1\n1 2\n2 1\n2 2\n1 1\n2 1\n1 1\n2 1\n1 1\n1 2\n2 2\n2 2\n1 1\n2 2\n1 2\n2 1\n2 1\n1 1\n1 1\n1 2\n1 2\n1 1\n1 1\n2 1\n1 2\n1 2\n2 1\n2 2\n2 2\n2 2\n2 1\n2 2\n1 1\n1 2\n1 2\n1 1\n2 2\n2 2\n1 1\n2 1\n1 1\n1 2\n1 2\n1 2\n1 1\n1 1\n2 2\n1 2\n2 1\n2 1\n2 1\n1 2\n1 2\n1 1\n2 2\n1 2\n2 0\n2 0\n2 0\n1 0",
"output": "7"
},
{
"input": "100\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "0"
},
{
"input": "2\n0 1\n1 0",
"output": "1"
},
{
"input": "2\n0 900\n900 0",
"output": "900"
},
{
"input": "2\n0 1\n1 0",
"output": "1"
},
{
"input": "2\n0 0\n0 0",
"output": "0"
},
{
"input": "2\n0 1000\n1000 0",
"output": "1000"
},
{
"input": "3\n0 802\n175 188\n815 0",
"output": "815"
},
{
"input": "3\n0 910\n910 976\n976 0",
"output": "976"
},
{
"input": "3\n0 2\n2 1\n1 0",
"output": "2"
}
] | 1,694,102,771 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 60 | 0 | n = int(input())
post= 0
m=0
for _ in range(n):
a,b = map(int, input().split())
post-= a
post+= b
max_capacity = max(max_capacity, post)
print(max_capacity)
| Title: Tram
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Linear Kingdom has exactly one tram line. It has *n* stops, numbered from 1 to *n* in the order of tram's movement. At the *i*-th stop *a**i* passengers exit the tram, while *b**i* passengers enter it. The tram is empty before it arrives at the first stop. Also, when the tram arrives at the last stop, all passengers exit so that it becomes empty.
Your task is to calculate the tram's minimum capacity such that the number of people inside the tram at any time never exceeds this capacity. Note that at each stop all exiting passengers exit before any entering passenger enters the tram.
Input Specification:
The first line contains a single number *n* (2<=≤<=*n*<=≤<=1000) — the number of the tram's stops.
Then *n* lines follow, each contains two integers *a**i* and *b**i* (0<=≤<=*a**i*,<=*b**i*<=≤<=1000) — the number of passengers that exits the tram at the *i*-th stop, and the number of passengers that enter the tram at the *i*-th stop. The stops are given from the first to the last stop in the order of tram's movement.
- The number of people who exit at a given stop does not exceed the total number of people in the tram immediately before it arrives at the stop. More formally, . This particularly means that *a*1<==<=0. - At the last stop, all the passengers exit the tram and it becomes empty. More formally, . - No passenger will enter the train at the last stop. That is, *b**n*<==<=0.
Output Specification:
Print a single integer denoting the minimum possible capacity of the tram (0 is allowed).
Demo Input:
['4\n0 3\n2 5\n4 2\n4 0\n']
Demo Output:
['6\n']
Note:
For the first example, a capacity of 6 is sufficient:
- At the first stop, the number of passengers inside the tram before arriving is 0. Then, 3 passengers enter the tram, and the number of passengers inside the tram becomes 3. - At the second stop, 2 passengers exit the tram (1 passenger remains inside). Then, 5 passengers enter the tram. There are 6 passengers inside the tram now. - At the third stop, 4 passengers exit the tram (2 passengers remain inside). Then, 2 passengers enter the tram. There are 4 passengers inside the tram now. - Finally, all the remaining passengers inside the tram exit the tram at the last stop. There are no passenger inside the tram now, which is in line with the constraints.
Since the number of passengers inside the tram never exceeds 6, a capacity of 6 is sufficient. Furthermore it is not possible for the tram to have a capacity less than 6. Hence, 6 is the correct answer. | ```python
n = int(input())
post= 0
m=0
for _ in range(n):
a,b = map(int, input().split())
post-= a
post+= b
max_capacity = max(max_capacity, post)
print(max_capacity)
``` | -1 |
|
320 | A | Magic Numbers | PROGRAMMING | 900 | [
"brute force",
"greedy"
] | null | null | A magic number is a number formed by concatenation of numbers 1, 14 and 144. We can use each of these numbers any number of times. Therefore 14144, 141414 and 1411 are magic numbers but 1444, 514 and 414 are not.
You're given a number. Determine if it is a magic number or not. | The first line of input contains an integer *n*, (1<=≤<=*n*<=≤<=109). This number doesn't contain leading zeros. | Print "YES" if *n* is a magic number or print "NO" if it's not. | [
"114114\n",
"1111\n",
"441231\n"
] | [
"YES\n",
"YES\n",
"NO\n"
] | none | 500 | [
{
"input": "114114",
"output": "YES"
},
{
"input": "1111",
"output": "YES"
},
{
"input": "441231",
"output": "NO"
},
{
"input": "1",
"output": "YES"
},
{
"input": "14",
"output": "YES"
},
{
"input": "114",
"output": "YES"
},
{
"input": "9",
"output": "NO"
},
{
"input": "414",
"output": "NO"
},
{
"input": "1000000000",
"output": "NO"
},
{
"input": "144144144",
"output": "YES"
},
{
"input": "1444",
"output": "NO"
},
{
"input": "11",
"output": "YES"
},
{
"input": "141414141",
"output": "YES"
},
{
"input": "11110111",
"output": "NO"
},
{
"input": "114114144",
"output": "YES"
},
{
"input": "444",
"output": "NO"
},
{
"input": "9999",
"output": "NO"
},
{
"input": "111444",
"output": "NO"
},
{
"input": "11114",
"output": "YES"
},
{
"input": "41111",
"output": "NO"
},
{
"input": "114414441",
"output": "NO"
},
{
"input": "144414441",
"output": "NO"
},
{
"input": "144244144",
"output": "NO"
},
{
"input": "111111111",
"output": "YES"
},
{
"input": "144444444",
"output": "NO"
},
{
"input": "444444444",
"output": "NO"
},
{
"input": "141441441",
"output": "YES"
},
{
"input": "441",
"output": "NO"
},
{
"input": "15",
"output": "NO"
},
{
"input": "14444",
"output": "NO"
},
{
"input": "11444",
"output": "NO"
},
{
"input": "144",
"output": "YES"
},
{
"input": "1414414",
"output": "YES"
},
{
"input": "141444",
"output": "NO"
},
{
"input": "14144",
"output": "YES"
},
{
"input": "4",
"output": "NO"
},
{
"input": "1144",
"output": "YES"
},
{
"input": "141111444",
"output": "NO"
},
{
"input": "14414414",
"output": "YES"
},
{
"input": "141414144",
"output": "YES"
},
{
"input": "1414",
"output": "YES"
},
{
"input": "1441",
"output": "YES"
},
{
"input": "12",
"output": "NO"
},
{
"input": "144144141",
"output": "YES"
},
{
"input": "144144",
"output": "YES"
},
{
"input": "14414411",
"output": "YES"
},
{
"input": "14414",
"output": "YES"
}
] | 1,693,213,287 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 28 | 186 | 0 | n=int(input())
n1=str(n)
k=list(n1)
i=0
flag=True
while i < len(k)-2 :
if k[i]=='1' and k[i+1] == '4' and k[i+2]== '4':
i+=3
elif k[i] == '1' and k[i + 1] == '4':
i += 2
elif k[i] == '1' :
i+=1
else :
flag=False
break
if i == len(k)-1 :
if k[-1]== "1" :
flag=True
else:
flag=False
elif i == len(k)-2 :
if k[-1] =='4' and k[-2] =='1':
flag = True
elif k[-1] and k[-2]=='1':
flag= True
else:
flag = False
if flag == True :
print("YES")
else:
print("NO") | Title: Magic Numbers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A magic number is a number formed by concatenation of numbers 1, 14 and 144. We can use each of these numbers any number of times. Therefore 14144, 141414 and 1411 are magic numbers but 1444, 514 and 414 are not.
You're given a number. Determine if it is a magic number or not.
Input Specification:
The first line of input contains an integer *n*, (1<=≤<=*n*<=≤<=109). This number doesn't contain leading zeros.
Output Specification:
Print "YES" if *n* is a magic number or print "NO" if it's not.
Demo Input:
['114114\n', '1111\n', '441231\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n']
Note:
none | ```python
n=int(input())
n1=str(n)
k=list(n1)
i=0
flag=True
while i < len(k)-2 :
if k[i]=='1' and k[i+1] == '4' and k[i+2]== '4':
i+=3
elif k[i] == '1' and k[i + 1] == '4':
i += 2
elif k[i] == '1' :
i+=1
else :
flag=False
break
if i == len(k)-1 :
if k[-1]== "1" :
flag=True
else:
flag=False
elif i == len(k)-2 :
if k[-1] =='4' and k[-2] =='1':
flag = True
elif k[-1] and k[-2]=='1':
flag= True
else:
flag = False
if flag == True :
print("YES")
else:
print("NO")
``` | 0 |
|
822 | A | I'm bored with life | PROGRAMMING | 800 | [
"implementation",
"math",
"number theory"
] | null | null | Holidays have finished. Thanks to the help of the hacker Leha, Noora managed to enter the university of her dreams which is located in a town Pavlopolis. It's well known that universities provide students with dormitory for the period of university studies. Consequently Noora had to leave Vičkopolis and move to Pavlopolis. Thus Leha was left completely alone in a quiet town Vičkopolis. He almost even fell into a depression from boredom!
Leha came up with a task for himself to relax a little. He chooses two integers *A* and *B* and then calculates the greatest common divisor of integers "*A* factorial" and "*B* factorial". Formally the hacker wants to find out GCD(*A*!,<=*B*!). It's well known that the factorial of an integer *x* is a product of all positive integers less than or equal to *x*. Thus *x*!<==<=1·2·3·...·(*x*<=-<=1)·*x*. For example 4!<==<=1·2·3·4<==<=24. Recall that GCD(*x*,<=*y*) is the largest positive integer *q* that divides (without a remainder) both *x* and *y*.
Leha has learned how to solve this task very effective. You are able to cope with it not worse, aren't you? | The first and single line contains two integers *A* and *B* (1<=≤<=*A*,<=*B*<=≤<=109,<=*min*(*A*,<=*B*)<=≤<=12). | Print a single integer denoting the greatest common divisor of integers *A*! and *B*!. | [
"4 3\n"
] | [
"6\n"
] | Consider the sample.
4! = 1·2·3·4 = 24. 3! = 1·2·3 = 6. The greatest common divisor of integers 24 and 6 is exactly 6. | 500 | [
{
"input": "4 3",
"output": "6"
},
{
"input": "10 399603090",
"output": "3628800"
},
{
"input": "6 973151934",
"output": "720"
},
{
"input": "2 841668075",
"output": "2"
},
{
"input": "7 415216919",
"output": "5040"
},
{
"input": "3 283733059",
"output": "6"
},
{
"input": "11 562314608",
"output": "39916800"
},
{
"input": "3 990639260",
"output": "6"
},
{
"input": "11 859155400",
"output": "39916800"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "5 3",
"output": "6"
},
{
"input": "1 4",
"output": "1"
},
{
"input": "5 4",
"output": "24"
},
{
"input": "1 12",
"output": "1"
},
{
"input": "9 7",
"output": "5040"
},
{
"input": "2 3",
"output": "2"
},
{
"input": "6 11",
"output": "720"
},
{
"input": "6 7",
"output": "720"
},
{
"input": "11 11",
"output": "39916800"
},
{
"input": "4 999832660",
"output": "24"
},
{
"input": "7 999228288",
"output": "5040"
},
{
"input": "11 999257105",
"output": "39916800"
},
{
"input": "11 999286606",
"output": "39916800"
},
{
"input": "3 999279109",
"output": "6"
},
{
"input": "999632727 11",
"output": "39916800"
},
{
"input": "999625230 7",
"output": "5040"
},
{
"input": "999617047 3",
"output": "6"
},
{
"input": "999646548 7",
"output": "5040"
},
{
"input": "999639051 3",
"output": "6"
},
{
"input": "12 12",
"output": "479001600"
},
{
"input": "12 1",
"output": "1"
},
{
"input": "1213 5",
"output": "120"
},
{
"input": "8 9",
"output": "40320"
},
{
"input": "12 9",
"output": "362880"
},
{
"input": "12 1000000000",
"output": "479001600"
},
{
"input": "1000000000 1",
"output": "1"
},
{
"input": "12 13",
"output": "479001600"
},
{
"input": "2 29845",
"output": "2"
},
{
"input": "10 21",
"output": "3628800"
},
{
"input": "12 20",
"output": "479001600"
},
{
"input": "15 12",
"output": "479001600"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "1000000000 12",
"output": "479001600"
},
{
"input": "11 30",
"output": "39916800"
},
{
"input": "17 12",
"output": "479001600"
},
{
"input": "4 19",
"output": "24"
},
{
"input": "12 15",
"output": "479001600"
},
{
"input": "20 6",
"output": "720"
},
{
"input": "10 20",
"output": "3628800"
},
{
"input": "10 10",
"output": "3628800"
},
{
"input": "22 12",
"output": "479001600"
},
{
"input": "20 12",
"output": "479001600"
},
{
"input": "12 23",
"output": "479001600"
},
{
"input": "12 22",
"output": "479001600"
},
{
"input": "18 3",
"output": "6"
},
{
"input": "14 10",
"output": "3628800"
},
{
"input": "14 12",
"output": "479001600"
},
{
"input": "8 3",
"output": "6"
},
{
"input": "5 5",
"output": "120"
}
] | 1,632,994,508 | 2,147,483,647 | Python 3 | OK | TESTS | 59 | 62 | 6,758,400 | import math
a,b=map(int,input().split())
c=min(a,b)
print(math.factorial(c))
| Title: I'm bored with life
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Holidays have finished. Thanks to the help of the hacker Leha, Noora managed to enter the university of her dreams which is located in a town Pavlopolis. It's well known that universities provide students with dormitory for the period of university studies. Consequently Noora had to leave Vičkopolis and move to Pavlopolis. Thus Leha was left completely alone in a quiet town Vičkopolis. He almost even fell into a depression from boredom!
Leha came up with a task for himself to relax a little. He chooses two integers *A* and *B* and then calculates the greatest common divisor of integers "*A* factorial" and "*B* factorial". Formally the hacker wants to find out GCD(*A*!,<=*B*!). It's well known that the factorial of an integer *x* is a product of all positive integers less than or equal to *x*. Thus *x*!<==<=1·2·3·...·(*x*<=-<=1)·*x*. For example 4!<==<=1·2·3·4<==<=24. Recall that GCD(*x*,<=*y*) is the largest positive integer *q* that divides (without a remainder) both *x* and *y*.
Leha has learned how to solve this task very effective. You are able to cope with it not worse, aren't you?
Input Specification:
The first and single line contains two integers *A* and *B* (1<=≤<=*A*,<=*B*<=≤<=109,<=*min*(*A*,<=*B*)<=≤<=12).
Output Specification:
Print a single integer denoting the greatest common divisor of integers *A*! and *B*!.
Demo Input:
['4 3\n']
Demo Output:
['6\n']
Note:
Consider the sample.
4! = 1·2·3·4 = 24. 3! = 1·2·3 = 6. The greatest common divisor of integers 24 and 6 is exactly 6. | ```python
import math
a,b=map(int,input().split())
c=min(a,b)
print(math.factorial(c))
``` | 3 |
|
0 | none | none | none | 0 | [
"none"
] | null | null | A bracket sequence is a string, containing only characters "(", ")", "[" and "]".
A correct bracket sequence is a bracket sequence that can be transformed into a correct arithmetic expression by inserting characters "1" and "+" between the original characters of the sequence. For example, bracket sequences "()[]", "([])" are correct (the resulting expressions are: "(1)+[1]", "([1+1]+1)"), and "](" and "[" are not. The empty string is a correct bracket sequence by definition.
A substring *s*[*l*... *r*] (1<=≤<=*l*<=≤<=*r*<=≤<=|*s*|) of string *s*<==<=*s*1*s*2... *s*|*s*| (where |*s*| is the length of string *s*) is the string *s**l**s**l*<=+<=1... *s**r*. The empty string is a substring of any string by definition.
You are given a bracket sequence, not necessarily correct. Find its substring which is a correct bracket sequence and contains as many opening square brackets «[» as possible. | The first and the only line contains the bracket sequence as a string, consisting only of characters "(", ")", "[" and "]". It is guaranteed that the string is non-empty and its length doesn't exceed 105 characters. | In the first line print a single integer — the number of brackets «[» in the required bracket sequence. In the second line print the optimal sequence. If there are more than one optimal solutions print any of them. | [
"([])\n",
"(((\n"
] | [
"1\n([])\n",
"0\n\n"
] | none | 0 | [
{
"input": "([])",
"output": "1\n([])"
},
{
"input": "(((",
"output": "0"
},
{
"input": "(][)",
"output": "0"
},
{
"input": "(()[))()[]",
"output": "1\n()[]"
},
{
"input": "(][](](][[(][",
"output": "1\n[]"
},
{
"input": "((])(]]))(](((()[[()[[[)([]()])[(]][)]])[]]()[()[[[[(([[)",
"output": "1\n[]()"
},
{
"input": "](]][)]()][[])[()(][)]))[)[]()()])[([((([[(([)][(])](][])([([)())))([(([][))[)()]][[])()[)](][[((]](](])]][(][[()(]][[)][])(][]))[])[)[(])[)()()[[))((()]]([([[(]))][(]())))))[[]]][][))[)])])()((((([[](([[()(([[()](([[([[(](]([)]())))[)]([]",
"output": "2\n[[]]"
},
{
"input": "[(()[])]()[()[]]",
"output": "4\n[(()[])]()[()[]]"
},
{
"input": "([])()[()]()()[(([])[]()[()([])()[][]()])]",
"output": "9\n([])()[()]()()[(([])[]()[()([])()[][]()])]"
},
{
"input": "[()][([[]])][[[]()]][()[]]()()([[][]][[]][](()))[[[(())]]][]()(([([])(([[[]]()])(()))]((())))([()]([()[[[]([][[[[][(())([[]()])]]][[(())]([])]()][[](())]()[])]()[][]]([[]])[]])[(()[()((()[][()]))][])[]()()([]())](()[][][])()()[]()))[]()[]",
"output": "61\n[()][([[]])][[[]()]][()[]]()()([[][]][[]][](()))[[[(())]]][]()(([([])(([[[]]()])(()))]((())))([()]([()[[[]([][[[[][(())([[]()])]]][[(())]([])]()][[](())]()[])]()[][]]([[]])[]])[(()[()((()[][()]))][])[]()()([]())](()[][][])()()[]()))[]()[]"
},
{
"input": "(][(](][[(][(",
"output": "0"
},
{
"input": ")[)][)))((([[)]((]][)[)((]([)[)(([)[)]][([",
"output": "0"
},
{
"input": "][([))][[))[[((]][([(([[)]]])([)][([([[[[([))]])][[[[[([)]]([[(((]([(](([([[)[(]])(][(((][)[[)][)(][[)[[)])))[)]))]])[([[))(([(]][))([(]]][(])]))))))[[[[[([[([)[[[)[(([)[[(][((([(([([(([))[[[[[[([(](])(][[)[)(](]])]]]((([))(])[[)[))[([[[[(]][)[([(]](([)([[)[[([))[)",
"output": "0"
},
{
"input": "()]])()()]",
"output": "0"
},
{
"input": "[([[)[(()[])[()][]()[[[)()[][[[()[]]]()]][",
"output": "5\n()[][[[()[]]]()]"
},
{
"input": "[()][][][][]()[)])))[(]()[]([)(])[)(])()[))][)]()[][][]][][)(((([))))[)[))]]([[[)[())))[(][(()[()[(]())]])([[)[)[[())[()[]()[[[[])][))](()()())()](((((([(()]][[)([)([]]))(()[((]]())[]])][)()(][]][][(([])]]((]])([[][)])(][)][([[[[(][()(][[(",
"output": "5\n[()][][][][]()"
},
{
"input": "(([])",
"output": "1\n([])"
},
{
"input": "()()([]]",
"output": "1\n[]"
},
{
"input": "([[[]]))",
"output": "2\n[[]]"
},
{
"input": "[[]",
"output": "1\n[]"
},
{
"input": "((((([]((((((((((",
"output": "1\n[]"
},
{
"input": "(((((([](((((((",
"output": "1\n[]"
},
{
"input": "[[])",
"output": "1\n[]"
},
{
"input": "((()))([]",
"output": "1\n[]"
},
{
"input": "([]",
"output": "1\n[]"
},
{
"input": "[]())])([)][[[]])))][])([]([]()]]))))())[[([))()(])))]][)[][[])(][()()]]](]][])[[))((]][)[)(]))([])((]([)([])]]]]]]][)[[[]]([[[]]][(][][])()[[([](])(]]((]([[)])]])([)(][([)(([))(]([)[[](([(](][[)()(][",
"output": "3\n[[[]]]"
}
] | 1,641,668,596 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 4 | 218 | 0 | import sys
inpu = sys.stdin.readline
prin = sys.stdout.write
s = inpu().rstrip('\n')
l = 0
stack = []
brackets = {'(', '['}
count = 0
real = ''
ans = []
for i in s :
if i in brackets :
stack.append(i)
ans.append(i)
elif len(stack) == 0:
continue
elif i == ']' :
if stack[-1] == '[' :
count += 1
stack.pop()
ans.append(']')
else :
stack = []
if count > l :
real = ''.join(ans)
l = count
ans = []
count = 0
else :
if stack[-1] == '(' :
ans.append(')')
stack.pop()
else :
stack = []
if count > l :
real = ''.join(ans)
l = count
ans = []
count = 0
if len(stack) == 0:
if count > l :
real = ''.join(ans)
l = count
prin(str(l) + '\n' + real + '\n') | Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A bracket sequence is a string, containing only characters "(", ")", "[" and "]".
A correct bracket sequence is a bracket sequence that can be transformed into a correct arithmetic expression by inserting characters "1" and "+" between the original characters of the sequence. For example, bracket sequences "()[]", "([])" are correct (the resulting expressions are: "(1)+[1]", "([1+1]+1)"), and "](" and "[" are not. The empty string is a correct bracket sequence by definition.
A substring *s*[*l*... *r*] (1<=≤<=*l*<=≤<=*r*<=≤<=|*s*|) of string *s*<==<=*s*1*s*2... *s*|*s*| (where |*s*| is the length of string *s*) is the string *s**l**s**l*<=+<=1... *s**r*. The empty string is a substring of any string by definition.
You are given a bracket sequence, not necessarily correct. Find its substring which is a correct bracket sequence and contains as many opening square brackets «[» as possible.
Input Specification:
The first and the only line contains the bracket sequence as a string, consisting only of characters "(", ")", "[" and "]". It is guaranteed that the string is non-empty and its length doesn't exceed 105 characters.
Output Specification:
In the first line print a single integer — the number of brackets «[» in the required bracket sequence. In the second line print the optimal sequence. If there are more than one optimal solutions print any of them.
Demo Input:
['([])\n', '(((\n']
Demo Output:
['1\n([])\n', '0\n\n']
Note:
none | ```python
import sys
inpu = sys.stdin.readline
prin = sys.stdout.write
s = inpu().rstrip('\n')
l = 0
stack = []
brackets = {'(', '['}
count = 0
real = ''
ans = []
for i in s :
if i in brackets :
stack.append(i)
ans.append(i)
elif len(stack) == 0:
continue
elif i == ']' :
if stack[-1] == '[' :
count += 1
stack.pop()
ans.append(']')
else :
stack = []
if count > l :
real = ''.join(ans)
l = count
ans = []
count = 0
else :
if stack[-1] == '(' :
ans.append(')')
stack.pop()
else :
stack = []
if count > l :
real = ''.join(ans)
l = count
ans = []
count = 0
if len(stack) == 0:
if count > l :
real = ''.join(ans)
l = count
prin(str(l) + '\n' + real + '\n')
``` | 0 |
|
69 | A | Young Physicist | PROGRAMMING | 1,000 | [
"implementation",
"math"
] | A. Young Physicist | 2 | 256 | A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces. | The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100). | Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not. | [
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] | [
"NO",
"YES"
] | none | 500 | [
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,654,107,943 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 1 | 92 | 614,400 | n=input()
a=[]
b=[]
c=[]
for i in range(int(n)):
(x,y,z)=input().split()
p=a.append(x)
q=b.append(y)
r=c.append(z)
from functools import reduce
xcoor=reduce(lambda u,y:int(u)+int(y) , a)
ycoor=reduce(lambda u,y:int(u)+int(y) , b)
zcoor=reduce(lambda u,y:int(u)+int(y) , c)
if ((xcoor=="0") and (ycoor=="0") and (zcoor=="0")):
print("YES")
else:
print("NO") | Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none | ```python
n=input()
a=[]
b=[]
c=[]
for i in range(int(n)):
(x,y,z)=input().split()
p=a.append(x)
q=b.append(y)
r=c.append(z)
from functools import reduce
xcoor=reduce(lambda u,y:int(u)+int(y) , a)
ycoor=reduce(lambda u,y:int(u)+int(y) , b)
zcoor=reduce(lambda u,y:int(u)+int(y) , c)
if ((xcoor=="0") and (ycoor=="0") and (zcoor=="0")):
print("YES")
else:
print("NO")
``` | 0 |
522 | A | Reposts | PROGRAMMING | 1,200 | [
"*special",
"dfs and similar",
"dp",
"graphs",
"trees"
] | null | null | One day Polycarp published a funny picture in a social network making a poll about the color of his handle. Many of his friends started reposting Polycarp's joke to their news feed. Some of them reposted the reposts and so on.
These events are given as a sequence of strings "name1 reposted name2", where name1 is the name of the person who reposted the joke, and name2 is the name of the person from whose news feed the joke was reposted. It is guaranteed that for each string "name1 reposted name2" user "name1" didn't have the joke in his feed yet, and "name2" already had it in his feed by the moment of repost. Polycarp was registered as "Polycarp" and initially the joke was only in his feed.
Polycarp measures the popularity of the joke as the length of the largest repost chain. Print the popularity of Polycarp's joke. | The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=200) — the number of reposts. Next follow the reposts in the order they were made. Each of them is written on a single line and looks as "name1 reposted name2". All the names in the input consist of lowercase or uppercase English letters and/or digits and have lengths from 2 to 24 characters, inclusive.
We know that the user names are case-insensitive, that is, two names that only differ in the letter case correspond to the same social network user. | Print a single integer — the maximum length of a repost chain. | [
"5\ntourist reposted Polycarp\nPetr reposted Tourist\nWJMZBMR reposted Petr\nsdya reposted wjmzbmr\nvepifanov reposted sdya\n",
"6\nMike reposted Polycarp\nMax reposted Polycarp\nEveryOne reposted Polycarp\n111 reposted Polycarp\nVkCup reposted Polycarp\nCodeforces reposted Polycarp\n",
"1\nSoMeStRaNgEgUe reposted PoLyCaRp\n"
] | [
"6\n",
"2\n",
"2\n"
] | none | 500 | [
{
"input": "5\ntourist reposted Polycarp\nPetr reposted Tourist\nWJMZBMR reposted Petr\nsdya reposted wjmzbmr\nvepifanov reposted sdya",
"output": "6"
},
{
"input": "6\nMike reposted Polycarp\nMax reposted Polycarp\nEveryOne reposted Polycarp\n111 reposted Polycarp\nVkCup reposted Polycarp\nCodeforces reposted Polycarp",
"output": "2"
},
{
"input": "1\nSoMeStRaNgEgUe reposted PoLyCaRp",
"output": "2"
},
{
"input": "1\niuNtwVf reposted POlYcarP",
"output": "2"
},
{
"input": "10\ncs reposted poLYCaRp\nAFIkDrY7Of4V7Mq reposted CS\nsoBiwyN7KOvoFUfbhux reposted aFikDry7Of4v7MQ\nvb6LbwA reposted sObIWYN7KOvoFufBHUx\nDtWKIcVwIHgj4Rcv reposted vb6lbwa\nkt reposted DTwKicvwihgJ4rCV\n75K reposted kT\njKzyxx1 reposted 75K\nuoS reposted jkZyXX1\npZJskHTCIqE3YyZ5ME reposted uoS",
"output": "11"
},
{
"input": "10\nvxrUpCXvx8Isq reposted pOLYcaRP\nICb1 reposted vXRUpCxvX8ISq\nJFMt4b8jZE7iF2m8by7y2 reposted Icb1\nqkG6ZkMIf9QRrBFQU reposted ICb1\nnawsNfcR2palIMnmKZ reposted pOlYcaRP\nKksyH reposted jFMT4b8JzE7If2M8by7y2\nwJtWwQS5FvzN0h8CxrYyL reposted NawsNfcR2paLIMnmKz\nDpBcBPYAcTXEdhldI6tPl reposted NaWSnFCr2pALiMnmkZ\nlEnwTVnlwdQg2vaIRQry reposted kKSYh\nQUVFgwllaWO reposted Wjtwwqs5FVzN0H8cxRyyl",
"output": "6"
},
{
"input": "10\nkkuLGEiHv reposted POLYcArp\n3oX1AoUqyw1eR3nCADY9hLwd reposted kkuLGeIHV\nwf97dqq5bx1dPIchCoT reposted 3OX1AOuQYW1eR3ncAdY9hLwD\nWANr8h reposted Wf97dQQ5bx1dpIcHcoT\n3Fb736lkljZK2LtSbfL reposted wANR8h\n6nq9xLOn reposted 3fB736lKlJZk2LtSbFL\nWL reposted 3Fb736lKLjZk2LTSbfl\ndvxn4Xtc6SBcvKf1 reposted wF97DQq5bX1dPiChCOt\nMCcPLIMISqxDzrj reposted 6nQ9XLOn\nxsQL4Z2Iu reposted MCcpLiMiSqxdzrj",
"output": "9"
},
{
"input": "10\nsMA4 reposted pOLyCARP\nlq3 reposted pOlycARp\nEa16LSFTQxLJnE reposted polYcARp\nkvZVZhJwXcWsnC7NA1DV2WvS reposted polYCArp\nEYqqlrjRwddI reposted pOlyCArP\nsPqQCA67Y6PBBbcaV3EhooO reposted ea16LSFTqxLJne\njjPnneZdF6WLZ3v reposted Ea16LSFTqxLjNe\nWEoi6UpnfBUx79 reposted ea16LSFtqXljNe\nqi4yra reposted eYqqlRJrWDDI\ncw7E1UCSUD reposted eYqqLRJRwDdI",
"output": "3"
}
] | 1,688,702,811 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 5 | 46 | 0 | n=int(input())
a=[["polycarp"]]
m=1
for _ in range(n):
s=input().split()
want=s[-1].lower()
l=len(a)
for i in range(l):
if a[i][-1]==want:
a[i].append(s[0].lower())
l1=len(a[i])
if l1>m:
m=l1
print(m)
| Title: Reposts
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Polycarp published a funny picture in a social network making a poll about the color of his handle. Many of his friends started reposting Polycarp's joke to their news feed. Some of them reposted the reposts and so on.
These events are given as a sequence of strings "name1 reposted name2", where name1 is the name of the person who reposted the joke, and name2 is the name of the person from whose news feed the joke was reposted. It is guaranteed that for each string "name1 reposted name2" user "name1" didn't have the joke in his feed yet, and "name2" already had it in his feed by the moment of repost. Polycarp was registered as "Polycarp" and initially the joke was only in his feed.
Polycarp measures the popularity of the joke as the length of the largest repost chain. Print the popularity of Polycarp's joke.
Input Specification:
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=200) — the number of reposts. Next follow the reposts in the order they were made. Each of them is written on a single line and looks as "name1 reposted name2". All the names in the input consist of lowercase or uppercase English letters and/or digits and have lengths from 2 to 24 characters, inclusive.
We know that the user names are case-insensitive, that is, two names that only differ in the letter case correspond to the same social network user.
Output Specification:
Print a single integer — the maximum length of a repost chain.
Demo Input:
['5\ntourist reposted Polycarp\nPetr reposted Tourist\nWJMZBMR reposted Petr\nsdya reposted wjmzbmr\nvepifanov reposted sdya\n', '6\nMike reposted Polycarp\nMax reposted Polycarp\nEveryOne reposted Polycarp\n111 reposted Polycarp\nVkCup reposted Polycarp\nCodeforces reposted Polycarp\n', '1\nSoMeStRaNgEgUe reposted PoLyCaRp\n']
Demo Output:
['6\n', '2\n', '2\n']
Note:
none | ```python
n=int(input())
a=[["polycarp"]]
m=1
for _ in range(n):
s=input().split()
want=s[-1].lower()
l=len(a)
for i in range(l):
if a[i][-1]==want:
a[i].append(s[0].lower())
l1=len(a[i])
if l1>m:
m=l1
print(m)
``` | 0 |
|
149 | A | Business trip | PROGRAMMING | 900 | [
"greedy",
"implementation",
"sortings"
] | null | null | What joy! Petya's parents went on a business trip for the whole year and the playful kid is left all by himself. Petya got absolutely happy. He jumped on the bed and threw pillows all day long, until...
Today Petya opened the cupboard and found a scary note there. His parents had left him with duties: he should water their favourite flower all year, each day, in the morning, in the afternoon and in the evening. "Wait a second!" — thought Petya. He know for a fact that if he fulfills the parents' task in the *i*-th (1<=≤<=*i*<=≤<=12) month of the year, then the flower will grow by *a**i* centimeters, and if he doesn't water the flower in the *i*-th month, then the flower won't grow this month. Petya also knows that try as he might, his parents won't believe that he has been watering the flower if it grows strictly less than by *k* centimeters.
Help Petya choose the minimum number of months when he will water the flower, given that the flower should grow no less than by *k* centimeters. | The first line contains exactly one integer *k* (0<=≤<=*k*<=≤<=100). The next line contains twelve space-separated integers: the *i*-th (1<=≤<=*i*<=≤<=12) number in the line represents *a**i* (0<=≤<=*a**i*<=≤<=100). | Print the only integer — the minimum number of months when Petya has to water the flower so that the flower grows no less than by *k* centimeters. If the flower can't grow by *k* centimeters in a year, print -1. | [
"5\n1 1 1 1 2 2 3 2 2 1 1 1\n",
"0\n0 0 0 0 0 0 0 1 1 2 3 0\n",
"11\n1 1 4 1 1 5 1 1 4 1 1 1\n"
] | [
"2\n",
"0\n",
"3\n"
] | Let's consider the first sample test. There it is enough to water the flower during the seventh and the ninth month. Then the flower grows by exactly five centimeters.
In the second sample Petya's parents will believe him even if the flower doesn't grow at all (*k* = 0). So, it is possible for Petya not to water the flower at all. | 500 | [
{
"input": "5\n1 1 1 1 2 2 3 2 2 1 1 1",
"output": "2"
},
{
"input": "0\n0 0 0 0 0 0 0 1 1 2 3 0",
"output": "0"
},
{
"input": "11\n1 1 4 1 1 5 1 1 4 1 1 1",
"output": "3"
},
{
"input": "15\n20 1 1 1 1 2 2 1 2 2 1 1",
"output": "1"
},
{
"input": "7\n8 9 100 12 14 17 21 10 11 100 23 10",
"output": "1"
},
{
"input": "52\n1 12 3 11 4 5 10 6 9 7 8 2",
"output": "6"
},
{
"input": "50\n2 2 3 4 5 4 4 5 7 3 2 7",
"output": "-1"
},
{
"input": "0\n55 81 28 48 99 20 67 95 6 19 10 93",
"output": "0"
},
{
"input": "93\n85 40 93 66 92 43 61 3 64 51 90 21",
"output": "1"
},
{
"input": "99\n36 34 22 0 0 0 52 12 0 0 33 47",
"output": "2"
},
{
"input": "99\n28 32 31 0 10 35 11 18 0 0 32 28",
"output": "3"
},
{
"input": "99\n19 17 0 1 18 11 29 9 29 22 0 8",
"output": "4"
},
{
"input": "76\n2 16 11 10 12 0 20 4 4 14 11 14",
"output": "5"
},
{
"input": "41\n2 1 7 7 4 2 4 4 9 3 10 0",
"output": "6"
},
{
"input": "47\n8 2 2 4 3 1 9 4 2 7 7 8",
"output": "7"
},
{
"input": "58\n6 11 7 0 5 6 3 9 4 9 5 1",
"output": "8"
},
{
"input": "32\n5 2 4 1 5 0 5 1 4 3 0 3",
"output": "9"
},
{
"input": "31\n6 1 0 4 4 5 1 0 5 3 2 0",
"output": "9"
},
{
"input": "35\n2 3 0 0 6 3 3 4 3 5 0 6",
"output": "9"
},
{
"input": "41\n3 1 3 4 3 6 6 1 4 4 0 6",
"output": "11"
},
{
"input": "97\n0 5 3 12 10 16 22 8 21 17 21 10",
"output": "5"
},
{
"input": "100\n21 21 0 0 4 13 0 26 0 0 0 15",
"output": "6"
},
{
"input": "100\n0 0 16 5 22 0 5 0 25 0 14 13",
"output": "7"
},
{
"input": "97\n17 0 10 0 0 0 18 0 14 23 15 0",
"output": "6"
},
{
"input": "100\n0 9 0 18 7 0 0 14 33 3 0 16",
"output": "7"
},
{
"input": "95\n5 2 13 0 15 18 17 0 6 11 0 8",
"output": "9"
},
{
"input": "94\n11 13 0 9 15 8 8 16 3 7 1 3",
"output": "11"
},
{
"input": "96\n8 4 12 15 8 0 4 10 6 6 12 11",
"output": "11"
},
{
"input": "100\n5 5 3 8 6 5 0 3 3 8 1 3",
"output": "-1"
},
{
"input": "100\n1 0 0 1 1 0 1 1 1 1 2 1",
"output": "-1"
},
{
"input": "100\n6 3 2 0 4 1 2 2 2 2 1 1",
"output": "-1"
},
{
"input": "0\n0 0 0 0 0 0 0 0 0 0 0 0",
"output": "0"
},
{
"input": "100\n0 0 0 0 0 0 0 0 0 0 0 0",
"output": "-1"
},
{
"input": "0\n100 100 100 100 100 100 100 100 100 100 100 100",
"output": "0"
},
{
"input": "100\n100 100 100 100 100 100 100 100 100 100 100 100",
"output": "1"
},
{
"input": "12\n1 1 1 1 1 1 1 1 1 1 1 1",
"output": "12"
},
{
"input": "13\n1 1 1 1 1 1 1 1 1 1 1 2",
"output": "12"
},
{
"input": "15\n10 1 1 1 1 1 1 1 1 1 1 1",
"output": "6"
},
{
"input": "1\n0 0 0 0 0 0 0 0 0 0 0 0",
"output": "-1"
}
] | 1,693,313,801 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 6 | 124 | 0 | n=int(input())
l=list(map(int,input().split()))
l.sort()
l=l[::-1]
sum=0
c=0
for i in range(len(l)):
if(sum>=n):
break
sum=sum+l[i]
c=c+1
print(c)
| Title: Business trip
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
What joy! Petya's parents went on a business trip for the whole year and the playful kid is left all by himself. Petya got absolutely happy. He jumped on the bed and threw pillows all day long, until...
Today Petya opened the cupboard and found a scary note there. His parents had left him with duties: he should water their favourite flower all year, each day, in the morning, in the afternoon and in the evening. "Wait a second!" — thought Petya. He know for a fact that if he fulfills the parents' task in the *i*-th (1<=≤<=*i*<=≤<=12) month of the year, then the flower will grow by *a**i* centimeters, and if he doesn't water the flower in the *i*-th month, then the flower won't grow this month. Petya also knows that try as he might, his parents won't believe that he has been watering the flower if it grows strictly less than by *k* centimeters.
Help Petya choose the minimum number of months when he will water the flower, given that the flower should grow no less than by *k* centimeters.
Input Specification:
The first line contains exactly one integer *k* (0<=≤<=*k*<=≤<=100). The next line contains twelve space-separated integers: the *i*-th (1<=≤<=*i*<=≤<=12) number in the line represents *a**i* (0<=≤<=*a**i*<=≤<=100).
Output Specification:
Print the only integer — the minimum number of months when Petya has to water the flower so that the flower grows no less than by *k* centimeters. If the flower can't grow by *k* centimeters in a year, print -1.
Demo Input:
['5\n1 1 1 1 2 2 3 2 2 1 1 1\n', '0\n0 0 0 0 0 0 0 1 1 2 3 0\n', '11\n1 1 4 1 1 5 1 1 4 1 1 1\n']
Demo Output:
['2\n', '0\n', '3\n']
Note:
Let's consider the first sample test. There it is enough to water the flower during the seventh and the ninth month. Then the flower grows by exactly five centimeters.
In the second sample Petya's parents will believe him even if the flower doesn't grow at all (*k* = 0). So, it is possible for Petya not to water the flower at all. | ```python
n=int(input())
l=list(map(int,input().split()))
l.sort()
l=l[::-1]
sum=0
c=0
for i in range(len(l)):
if(sum>=n):
break
sum=sum+l[i]
c=c+1
print(c)
``` | 0 |
|
305 | B | Continued Fractions | PROGRAMMING | 1,700 | [
"brute force",
"implementation",
"math"
] | null | null | A continued fraction of height *n* is a fraction of form . You are given two rational numbers, one is represented as and the other one is represented as a finite fraction of height *n*. Check if they are equal. | The first line contains two space-separated integers *p*,<=*q* (1<=≤<=*q*<=≤<=*p*<=≤<=1018) — the numerator and the denominator of the first fraction.
The second line contains integer *n* (1<=≤<=*n*<=≤<=90) — the height of the second fraction. The third line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1018) — the continued fraction.
Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier. | Print "YES" if these fractions are equal and "NO" otherwise. | [
"9 4\n2\n2 4\n",
"9 4\n3\n2 3 1\n",
"9 4\n3\n1 2 4\n"
] | [
"YES\n",
"YES\n",
"NO\n"
] | In the first sample <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/5ff92f27aebea2560d99ad61202d20bab5ee5390.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second sample <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/221368c79c05fc0ecad4e5f7a64f30b832fd99f5.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the third sample <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4fb4b411afc0fbad27a1c8fdd08ba88ec3830ef5.png" style="max-width: 100.0%;max-height: 100.0%;"/>. | 1,000 | [
{
"input": "9 4\n2\n2 4",
"output": "YES"
},
{
"input": "9 4\n3\n2 3 1",
"output": "YES"
},
{
"input": "9 4\n3\n1 2 4",
"output": "NO"
},
{
"input": "39088169 24157817\n36\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2",
"output": "YES"
},
{
"input": "39088169 24157817\n36\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 4",
"output": "NO"
},
{
"input": "61305790721611591 37889062373143906\n80\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 4",
"output": "NO"
},
{
"input": "61305790721611591 37889062373143906\n80\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 2",
"output": "YES"
},
{
"input": "565049485241691020 228217260073568804\n40\n2 2 9 1 7 1 2 1 2 1 1 1 9 1 2 1 9 1 3 2 3 10 13 2 1 2 7 1 1 2 2 2 1 1 2 1 6 5 3 2",
"output": "YES"
},
{
"input": "2 1\n4\n2 1 1 1",
"output": "NO"
},
{
"input": "4 1\n2\n3 1",
"output": "YES"
},
{
"input": "72723460248141 1597\n1\n45537545554",
"output": "NO"
},
{
"input": "14930352 13\n6\n1148488 1 1 1 1 2",
"output": "YES"
},
{
"input": "86267571272 102334155\n6\n842 1 841 1 842 145",
"output": "NO"
},
{
"input": "72723460248141 121393\n7\n599074578 122 1 122 2 1 2",
"output": "YES"
},
{
"input": "168455988218483660 53310571951833359\n32\n3 6 3 1 14 1 48 1 3 2 1 1 39 2 1 3 13 23 4 1 11 1 1 23 1 3 3 2 1 1 1 3",
"output": "NO"
},
{
"input": "382460255113156464 275525972692563593\n37\n1 2 1 1 2 1 3 4 5 5 1 4 2 1 1 1 4 2 2 1 2 1 1 2 3 3 1 2 2 50 4 1 4 2 5 109 8",
"output": "YES"
},
{
"input": "1000000000000000000 1\n1\n1000000000000000000",
"output": "YES"
},
{
"input": "362912509915545727 266073193475139553\n30\n1 2 1 2 1 25 75 1 14 6 6 9 1 1 1 1 210 2 2 2 5 2 1 3 1 1 13 3 14 3",
"output": "NO"
},
{
"input": "933329105990871495 607249523603826772\n33\n1 1 1 6 3 1 5 24 3 55 1 15 2 2 1 12 2 2 3 109 1 1 4 1 4 1 7 2 4 1 3 3 2",
"output": "YES"
},
{
"input": "790637895857383456 679586240913926415\n40\n1 6 8 2 1 2 1 7 2 4 1 1 1 10 1 10 1 4 1 4 41 1 1 7 1 1 2 1 2 4 1 2 1 63 1 2 1 1 4 3",
"output": "NO"
},
{
"input": "525403371166594848 423455864168639615\n38\n1 4 6 1 1 32 3 1 14 1 3 1 2 4 5 4 1 2 1 5 8 1 3 1 2 1 46 1 1 1 3 1 4 1 11 1 2 4",
"output": "YES"
},
{
"input": "1 1\n1\n1",
"output": "YES"
},
{
"input": "2 1\n2\n1 2",
"output": "NO"
},
{
"input": "531983955813463755 371380136962341468\n38\n1 2 3 4 1 37 1 12 1 3 2 1 6 3 1 7 3 2 8 1 2 1 1 7 1 1 1 7 1 47 2 1 3 1 1 5 1 2",
"output": "YES"
},
{
"input": "32951280099 987\n7\n33385288 1 5 1 5 1 6",
"output": "YES"
},
{
"input": "6557470319842 86267571272\n6\n76 76 76 76 76 76",
"output": "YES"
},
{
"input": "934648630114363087 6565775686518446\n31\n142 2 1 5 2 2 1 1 3 1 2 8 1 3 12 2 1 23 5 1 10 1 863 1 1 1 2 1 14 2 3",
"output": "YES"
},
{
"input": "61305790721611591 37889062373143906\n81\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "YES"
},
{
"input": "4 1\n1\n4",
"output": "YES"
},
{
"input": "500000000000000001 5\n2\n100000000000000000 5",
"output": "YES"
},
{
"input": "1000000000000000000 3\n3\n3 4 5",
"output": "NO"
},
{
"input": "822981258385599125 28316248989464296\n39\n29 15 1 1 1 4 4 4 1 3 1 5 12 1 1 1 1 1 6 5 2 1 11 1 1 26 1 2 2 2 14 1 1 1 3 2 4 1 1",
"output": "NO"
},
{
"input": "823443107025550834 331822464812968648\n42\n2 2 13 14 4 4 1 1 1 1 2 1 1 1 1 113 1 1 8 1 1 1 1 2 2 1 15 1 5 1 1 2 1 1 1 14 4 3 1 5 1 1",
"output": "NO"
},
{
"input": "226137305050296073 27076290603746056\n30\n8 2 1 5 3 67 2 1 6 1 2 1 5 1 11 8 43 2 1 7 1 95 2 3 1 11 5 2 1 1",
"output": "NO"
},
{
"input": "524928871965838747 313083111434773473\n35\n1 1 2 10 1 4 12 3 28 1 23 1 1 1 4 1 4 3 1 3 2 3 1 4 3 1 3 2 3 11 21 1 35 1 1",
"output": "NO"
},
{
"input": "633468529243155234 4\n90\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "NO"
},
{
"input": "742143496299253703 2\n90\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "NO"
},
{
"input": "550736960584023286 3\n90\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "NO"
},
{
"input": "2 1\n10\n99999999999999999 99999999999999999 99999999999999999 99999999999999999 99999999999999999 99999999999999999 99999999999999999 99999999999999999 99999999999999999 99999999999999999",
"output": "NO"
},
{
"input": "262882295792523313 105000000000078855\n1\n105000000000078855",
"output": "NO"
},
{
"input": "990130967049151695 166430169817556175\n1\n564668656008429569",
"output": "NO"
},
{
"input": "9 4\n2\n2 3",
"output": "NO"
},
{
"input": "529824479480396864 4705882352941177\n2\n80000000000000007 80000000000000009",
"output": "NO"
},
{
"input": "985625905209512860 565433601688714177\n10\n6423 24947 27507 13031 16414 29169 901 32592 18763 1656",
"output": "NO"
},
{
"input": "913255926290448385 4400000000\n2\n4400000000 4400000000",
"output": "NO"
},
{
"input": "7 2\n2\n2 1",
"output": "NO"
},
{
"input": "10 3\n1\n3",
"output": "NO"
},
{
"input": "4 2\n1\n2",
"output": "YES"
},
{
"input": "1337 42\n1\n31",
"output": "NO"
}
] | 1,515,788,728 | 2,147,483,647 | Python 3 | OK | TESTS | 49 | 216 | 6,860,800 | from fractions import gcd
p,q=map(int,input().split())
gc=gcd(p,q)
p//=gc
q//=gc
n=int(input())
a=list(map(int,input().split()))
def add(a,b):
res=[]
a[0]*=b[1]
b[0]*=a[1]
temp=b[1]*a[1]
top=a[0]+b[0]
gc=gcd(top,temp)
temp//=gc
top//=gc;
res.append(top)
res.append(temp)
return res
def go(i):
res=[]
if i==n-1:
res.append(a[i])
res.append(1)
return res;
temp=list(go(i+1))
temp=temp[::-1]
ta=[]
ta.append(a[i])
ta.append(1)
temp=add(ta,temp)
return temp
res=go(0)
if(res[0]==p and res[1]==q): print("YES")
else:
print("NO") | Title: Continued Fractions
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A continued fraction of height *n* is a fraction of form . You are given two rational numbers, one is represented as and the other one is represented as a finite fraction of height *n*. Check if they are equal.
Input Specification:
The first line contains two space-separated integers *p*,<=*q* (1<=≤<=*q*<=≤<=*p*<=≤<=1018) — the numerator and the denominator of the first fraction.
The second line contains integer *n* (1<=≤<=*n*<=≤<=90) — the height of the second fraction. The third line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1018) — the continued fraction.
Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
Output Specification:
Print "YES" if these fractions are equal and "NO" otherwise.
Demo Input:
['9 4\n2\n2 4\n', '9 4\n3\n2 3 1\n', '9 4\n3\n1 2 4\n']
Demo Output:
['YES\n', 'YES\n', 'NO\n']
Note:
In the first sample <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/5ff92f27aebea2560d99ad61202d20bab5ee5390.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second sample <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/221368c79c05fc0ecad4e5f7a64f30b832fd99f5.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the third sample <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4fb4b411afc0fbad27a1c8fdd08ba88ec3830ef5.png" style="max-width: 100.0%;max-height: 100.0%;"/>. | ```python
from fractions import gcd
p,q=map(int,input().split())
gc=gcd(p,q)
p//=gc
q//=gc
n=int(input())
a=list(map(int,input().split()))
def add(a,b):
res=[]
a[0]*=b[1]
b[0]*=a[1]
temp=b[1]*a[1]
top=a[0]+b[0]
gc=gcd(top,temp)
temp//=gc
top//=gc;
res.append(top)
res.append(temp)
return res
def go(i):
res=[]
if i==n-1:
res.append(a[i])
res.append(1)
return res;
temp=list(go(i+1))
temp=temp[::-1]
ta=[]
ta.append(a[i])
ta.append(1)
temp=add(ta,temp)
return temp
res=go(0)
if(res[0]==p and res[1]==q): print("YES")
else:
print("NO")
``` | 3 |
|
25 | A | IQ test | PROGRAMMING | 1,300 | [
"brute force"
] | A. IQ test | 2 | 256 | Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness. | The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness. | Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order. | [
"5\n2 4 7 8 10\n",
"4\n1 2 1 1\n"
] | [
"3\n",
"2\n"
] | none | 0 | [
{
"input": "5\n2 4 7 8 10",
"output": "3"
},
{
"input": "4\n1 2 1 1",
"output": "2"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n100 99 100",
"output": "2"
},
{
"input": "3\n5 3 2",
"output": "3"
},
{
"input": "4\n43 28 1 91",
"output": "2"
},
{
"input": "4\n75 13 94 77",
"output": "3"
},
{
"input": "4\n97 8 27 3",
"output": "2"
},
{
"input": "10\n95 51 12 91 85 3 1 31 25 7",
"output": "3"
},
{
"input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46",
"output": "4"
},
{
"input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36",
"output": "26"
},
{
"input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83",
"output": "48"
},
{
"input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25",
"output": "1"
},
{
"input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46",
"output": "25"
},
{
"input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73",
"output": "13"
},
{
"input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76",
"output": "99"
},
{
"input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14",
"output": "1"
},
{
"input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22",
"output": "93"
},
{
"input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23",
"output": "1"
},
{
"input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98",
"output": "1"
},
{
"input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94",
"output": "93"
},
{
"input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29",
"output": "32"
},
{
"input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47",
"output": "26"
},
{
"input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72",
"output": "56"
},
{
"input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86",
"output": "97"
},
{
"input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42",
"output": "79"
},
{
"input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52",
"output": "25"
},
{
"input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86",
"output": "78"
},
{
"input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68",
"output": "70"
},
{
"input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81",
"output": "39"
},
{
"input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83",
"output": "88"
},
{
"input": "3\n100 100 1",
"output": "3"
}
] | 1,633,770,370 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 30 | 0 | n = int(input())
m = list(map(int,input().split))
even = 0
odd = 0
for i in m:
if i%2 == 0 :
even += 1
elif i%2 == 1:
odd += 1
if even == 1:
for i in m:
if i%2 == 0:
print(m.index(i))
else:
continue
if odd == 1:
for i in m :
if i%2 != 0:
print(m.index(i))
else:
continue | Title: IQ test
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output Specification:
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
Demo Input:
['5\n2 4 7 8 10\n', '4\n1 2 1 1\n']
Demo Output:
['3\n', '2\n']
Note:
none | ```python
n = int(input())
m = list(map(int,input().split))
even = 0
odd = 0
for i in m:
if i%2 == 0 :
even += 1
elif i%2 == 1:
odd += 1
if even == 1:
for i in m:
if i%2 == 0:
print(m.index(i))
else:
continue
if odd == 1:
for i in m :
if i%2 != 0:
print(m.index(i))
else:
continue
``` | -1 |
665 | C | Simple Strings | PROGRAMMING | 1,300 | [
"dp",
"greedy",
"strings"
] | null | null | zscoder loves simple strings! A string *t* is called simple if every pair of adjacent characters are distinct. For example ab, aba, zscoder are simple whereas aa, add are not simple.
zscoder is given a string *s*. He wants to change a minimum number of characters so that the string *s* becomes simple. Help him with this task! | The only line contains the string *s* (1<=≤<=|*s*|<=≤<=2·105) — the string given to zscoder. The string *s* consists of only lowercase English letters. | Print the simple string *s*' — the string *s* after the minimal number of changes. If there are multiple solutions, you may output any of them.
Note that the string *s*' should also consist of only lowercase English letters. | [
"aab\n",
"caaab\n",
"zscoder\n"
] | [
"bab\n",
"cabab\n",
"zscoder\n"
] | none | 0 | [
{
"input": "aab",
"output": "bab"
},
{
"input": "caaab",
"output": "cabab"
},
{
"input": "zscoder",
"output": "zscoder"
},
{
"input": "u",
"output": "u"
},
{
"input": "h",
"output": "h"
},
{
"input": "dtottttotd",
"output": "dtotataotd"
},
{
"input": "rxxxrrxrxxxxxrrrrrxxxxrrrrxrxxrxxrxrxrrrxrrxrrxrxxxrxrrxrrxrxrxxxxxrxxxxrrrxrxxrxxrxxxrrrrrxrrxrrxrr",
"output": "rxaxraxrxaxaxrararxaxararaxrxarxarxrxrarxraxraxrxaxrxraxraxrxrxaxaxrxaxararxrxarxarxaxrararxraxraxra"
},
{
"input": "aazz",
"output": "baza"
},
{
"input": "zz",
"output": "za"
},
{
"input": "gg",
"output": "ga"
},
{
"input": "qasdasd",
"output": "qasdasd"
},
{
"input": "aa",
"output": "ba"
},
{
"input": "ab",
"output": "ab"
},
{
"input": "zza",
"output": "zba"
},
{
"input": "g",
"output": "g"
},
{
"input": "nnop",
"output": "naop"
},
{
"input": "xx",
"output": "xa"
}
] | 1,652,869,198 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 27 | 139 | 43,520,000 | s=list(input()+'a')
for i in range(len(s)-2):
if s[i]==s[i+1]:
s[i+1]=list({'a', 'b', 'c'}-{s[i]}-{s[i+2]})[0]
print(''.join(s[:-1]))
| Title: Simple Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
zscoder loves simple strings! A string *t* is called simple if every pair of adjacent characters are distinct. For example ab, aba, zscoder are simple whereas aa, add are not simple.
zscoder is given a string *s*. He wants to change a minimum number of characters so that the string *s* becomes simple. Help him with this task!
Input Specification:
The only line contains the string *s* (1<=≤<=|*s*|<=≤<=2·105) — the string given to zscoder. The string *s* consists of only lowercase English letters.
Output Specification:
Print the simple string *s*' — the string *s* after the minimal number of changes. If there are multiple solutions, you may output any of them.
Note that the string *s*' should also consist of only lowercase English letters.
Demo Input:
['aab\n', 'caaab\n', 'zscoder\n']
Demo Output:
['bab\n', 'cabab\n', 'zscoder\n']
Note:
none | ```python
s=list(input()+'a')
for i in range(len(s)-2):
if s[i]==s[i+1]:
s[i+1]=list({'a', 'b', 'c'}-{s[i]}-{s[i+2]})[0]
print(''.join(s[:-1]))
``` | 3 |
|
765 | C | Table Tennis Game 2 | PROGRAMMING | 1,200 | [
"math"
] | null | null | Misha and Vanya have played several table tennis sets. Each set consists of several serves, each serve is won by one of the players, he receives one point and the loser receives nothing. Once one of the players scores exactly *k* points, the score is reset and a new set begins.
Across all the sets Misha scored *a* points in total, and Vanya scored *b* points. Given this information, determine the maximum number of sets they could have played, or that the situation is impossible.
Note that the game consisted of several complete sets. | The first line contains three space-separated integers *k*, *a* and *b* (1<=≤<=*k*<=≤<=109, 0<=≤<=*a*,<=*b*<=≤<=109, *a*<=+<=*b*<=><=0). | If the situation is impossible, print a single number -1. Otherwise, print the maximum possible number of sets. | [
"11 11 5\n",
"11 2 3\n"
] | [
"1\n",
"-1\n"
] | Note that the rules of the game in this problem differ from the real table tennis game, for example, the rule of "balance" (the winning player has to be at least two points ahead to win a set) has no power within the present problem. | 1,250 | [
{
"input": "11 11 5",
"output": "1"
},
{
"input": "11 2 3",
"output": "-1"
},
{
"input": "1 5 9",
"output": "14"
},
{
"input": "2 3 3",
"output": "2"
},
{
"input": "1 1000000000 1000000000",
"output": "2000000000"
},
{
"input": "2 3 5",
"output": "3"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "2"
},
{
"input": "1 0 1",
"output": "1"
},
{
"input": "101 99 97",
"output": "-1"
},
{
"input": "1000000000 0 1",
"output": "-1"
},
{
"input": "137 137 136",
"output": "1"
},
{
"input": "255 255 255",
"output": "2"
},
{
"input": "1 0 1000000000",
"output": "1000000000"
},
{
"input": "123 456 789",
"output": "9"
},
{
"input": "666666 6666666 666665",
"output": "-1"
},
{
"input": "1000000000 999999999 999999999",
"output": "-1"
},
{
"input": "100000000 100000001 99999999",
"output": "-1"
},
{
"input": "3 2 1000000000",
"output": "-1"
},
{
"input": "999999999 1000000000 999999998",
"output": "-1"
},
{
"input": "12938621 192872393 102739134",
"output": "21"
},
{
"input": "666666666 1230983 666666666",
"output": "1"
},
{
"input": "123456789 123456789 123456787",
"output": "1"
},
{
"input": "5 6 0",
"output": "-1"
},
{
"input": "11 0 12",
"output": "-1"
},
{
"input": "2 11 0",
"output": "-1"
},
{
"input": "2 1 0",
"output": "-1"
},
{
"input": "10 11 12",
"output": "2"
},
{
"input": "11 12 5",
"output": "-1"
},
{
"input": "11 12 3",
"output": "-1"
},
{
"input": "11 15 4",
"output": "-1"
},
{
"input": "2 3 1",
"output": "-1"
},
{
"input": "11 12 0",
"output": "-1"
},
{
"input": "11 13 2",
"output": "-1"
},
{
"input": "11 23 22",
"output": "4"
},
{
"input": "10 21 0",
"output": "-1"
},
{
"input": "11 23 1",
"output": "-1"
},
{
"input": "11 10 12",
"output": "-1"
},
{
"input": "11 1 12",
"output": "-1"
},
{
"input": "11 5 12",
"output": "-1"
},
{
"input": "11 8 12",
"output": "-1"
},
{
"input": "11 12 1",
"output": "-1"
},
{
"input": "5 4 6",
"output": "-1"
},
{
"input": "10 1 22",
"output": "-1"
},
{
"input": "2 3 0",
"output": "-1"
},
{
"input": "11 23 2",
"output": "-1"
},
{
"input": "2 1000000000 1000000000",
"output": "1000000000"
},
{
"input": "11 0 15",
"output": "-1"
},
{
"input": "11 5 0",
"output": "-1"
},
{
"input": "11 5 15",
"output": "-1"
},
{
"input": "10 0 13",
"output": "-1"
},
{
"input": "4 7 0",
"output": "-1"
},
{
"input": "10 2 8",
"output": "-1"
},
{
"input": "11 5 22",
"output": "2"
},
{
"input": "11 13 0",
"output": "-1"
},
{
"input": "2 0 3",
"output": "-1"
},
{
"input": "10 10 0",
"output": "1"
},
{
"input": "10 11 10",
"output": "2"
},
{
"input": "3 5 4",
"output": "2"
},
{
"input": "11 22 3",
"output": "2"
},
{
"input": "11 12 10",
"output": "-1"
},
{
"input": "10 2 13",
"output": "-1"
},
{
"input": "5 6 1",
"output": "-1"
},
{
"input": "10 21 5",
"output": "-1"
},
{
"input": "10 11 9",
"output": "-1"
},
{
"input": "10 17 7",
"output": "-1"
},
{
"input": "3 4 1",
"output": "-1"
},
{
"input": "4 5 3",
"output": "-1"
},
{
"input": "11 3 23",
"output": "-1"
},
{
"input": "11 3 12",
"output": "-1"
},
{
"input": "2 5 0",
"output": "-1"
},
{
"input": "10 21 2",
"output": "-1"
},
{
"input": "5 1 6",
"output": "-1"
},
{
"input": "10 11 0",
"output": "-1"
},
{
"input": "10 9 11",
"output": "-1"
},
{
"input": "7 10 5",
"output": "-1"
},
{
"input": "5 7 2",
"output": "-1"
},
{
"input": "6 5 7",
"output": "-1"
},
{
"input": "11 16 2",
"output": "-1"
},
{
"input": "11 1000000000 10",
"output": "-1"
},
{
"input": "10 2 21",
"output": "-1"
},
{
"input": "10 15 1",
"output": "-1"
},
{
"input": "5 2 8",
"output": "-1"
},
{
"input": "11 10000000 10",
"output": "-1"
},
{
"input": "10 1 101",
"output": "-1"
},
{
"input": "20 24 2",
"output": "-1"
},
{
"input": "11 24 0",
"output": "-1"
},
{
"input": "11 17 4",
"output": "-1"
},
{
"input": "11 13 1",
"output": "-1"
},
{
"input": "10 11 2",
"output": "-1"
},
{
"input": "11 23 3",
"output": "-1"
},
{
"input": "10 99 0",
"output": "-1"
},
{
"input": "6 7 4",
"output": "-1"
},
{
"input": "11 1 22",
"output": "2"
},
{
"input": "11 2 13",
"output": "-1"
},
{
"input": "2 1 3",
"output": "-1"
},
{
"input": "11 6 18",
"output": "-1"
},
{
"input": "11 122 4",
"output": "-1"
},
{
"input": "11 21 10",
"output": "-1"
},
{
"input": "3 2 4",
"output": "-1"
},
{
"input": "9 11 2",
"output": "-1"
},
{
"input": "11 0 7",
"output": "-1"
},
{
"input": "5 9 4",
"output": "-1"
},
{
"input": "100 105 5",
"output": "-1"
},
{
"input": "11 15 0",
"output": "-1"
},
{
"input": "5 6 4",
"output": "-1"
},
{
"input": "3 4 2",
"output": "-1"
},
{
"input": "2 9 0",
"output": "-1"
},
{
"input": "11 13 11",
"output": "2"
},
{
"input": "11 15 5",
"output": "-1"
},
{
"input": "11 4 15",
"output": "-1"
},
{
"input": "10 1 0",
"output": "-1"
},
{
"input": "11 16 8",
"output": "-1"
},
{
"input": "10 43 0",
"output": "-1"
},
{
"input": "11 13 5",
"output": "-1"
},
{
"input": "11 22 0",
"output": "2"
},
{
"input": "5 6 3",
"output": "-1"
},
{
"input": "2 1 11",
"output": "-1"
},
{
"input": "4 5 1",
"output": "-1"
},
{
"input": "11 23 0",
"output": "-1"
},
{
"input": "11 4 12",
"output": "-1"
},
{
"input": "12 13 1",
"output": "-1"
},
{
"input": "10 19 9",
"output": "-1"
},
{
"input": "3 7 2",
"output": "-1"
},
{
"input": "12 18 0",
"output": "-1"
},
{
"input": "11 25 3",
"output": "-1"
},
{
"input": "11 23 5",
"output": "-1"
},
{
"input": "2 1 5",
"output": "-1"
},
{
"input": "2 0 5",
"output": "-1"
},
{
"input": "11 24 1",
"output": "-1"
},
{
"input": "10 11 4",
"output": "-1"
},
{
"input": "2 0 1",
"output": "-1"
},
{
"input": "10 0 21",
"output": "-1"
},
{
"input": "3 0 7",
"output": "-1"
},
{
"input": "18 11 21",
"output": "-1"
},
{
"input": "3 7 0",
"output": "-1"
},
{
"input": "5 11 0",
"output": "-1"
},
{
"input": "11 5 13",
"output": "-1"
},
{
"input": "11 9 34",
"output": "-1"
},
{
"input": "11 13 9",
"output": "-1"
},
{
"input": "10 0 22",
"output": "-1"
},
{
"input": "5 1 12",
"output": "-1"
},
{
"input": "11 2 12",
"output": "-1"
},
{
"input": "11 9 12",
"output": "-1"
},
{
"input": "11 24 2",
"output": "-1"
},
{
"input": "11 23 6",
"output": "-1"
},
{
"input": "11 20 4",
"output": "-1"
},
{
"input": "2 5 1",
"output": "-1"
},
{
"input": "120 132 133",
"output": "2"
},
{
"input": "11 111 4",
"output": "-1"
},
{
"input": "10 7 11",
"output": "-1"
},
{
"input": "6 13 0",
"output": "-1"
},
{
"input": "5 11 1",
"output": "-1"
},
{
"input": "11 5 27",
"output": "-1"
},
{
"input": "11 15 3",
"output": "-1"
},
{
"input": "11 0 13",
"output": "-1"
},
{
"input": "11 13 10",
"output": "-1"
},
{
"input": "11 25 5",
"output": "-1"
},
{
"input": "4 3 5",
"output": "-1"
},
{
"input": "100 199 100",
"output": "2"
},
{
"input": "11 2 22",
"output": "2"
},
{
"input": "10 20 2",
"output": "2"
},
{
"input": "5 5 0",
"output": "1"
},
{
"input": "10 11 1",
"output": "-1"
},
{
"input": "11 12 2",
"output": "-1"
},
{
"input": "5 16 3",
"output": "-1"
},
{
"input": "12 14 1",
"output": "-1"
},
{
"input": "10 22 2",
"output": "-1"
},
{
"input": "2 4 0",
"output": "2"
},
{
"input": "11 34 7",
"output": "-1"
},
{
"input": "6 13 1",
"output": "-1"
},
{
"input": "11 0 23",
"output": "-1"
},
{
"input": "20 21 19",
"output": "-1"
},
{
"input": "11 33 22",
"output": "5"
},
{
"input": "10 4 41",
"output": "-1"
},
{
"input": "3 4 0",
"output": "-1"
},
{
"input": "11 15 7",
"output": "-1"
},
{
"input": "5 0 6",
"output": "-1"
},
{
"input": "11 3 22",
"output": "2"
},
{
"input": "2 6 0",
"output": "3"
},
{
"input": "10 11 11",
"output": "2"
},
{
"input": "11 33 0",
"output": "3"
},
{
"input": "4 6 2",
"output": "-1"
},
{
"input": "11 76 2",
"output": "-1"
},
{
"input": "7 9 4",
"output": "-1"
},
{
"input": "10 43 1",
"output": "-1"
},
{
"input": "22 25 5",
"output": "-1"
},
{
"input": "3 5 2",
"output": "-1"
},
{
"input": "11 1 24",
"output": "-1"
},
{
"input": "12 25 3",
"output": "-1"
},
{
"input": "11 0 22",
"output": "2"
},
{
"input": "4 2 5",
"output": "-1"
},
{
"input": "11 13 3",
"output": "-1"
},
{
"input": "11 12 9",
"output": "-1"
},
{
"input": "11 35 1",
"output": "-1"
},
{
"input": "5 3 6",
"output": "-1"
},
{
"input": "5 11 4",
"output": "-1"
},
{
"input": "12 8 14",
"output": "-1"
},
{
"input": "10 12 9",
"output": "-1"
},
{
"input": "11 12 13",
"output": "2"
},
{
"input": "11 15 2",
"output": "-1"
},
{
"input": "11 23 4",
"output": "-1"
},
{
"input": "5 3 11",
"output": "-1"
},
{
"input": "6 13 2",
"output": "-1"
},
{
"input": "4 1 0",
"output": "-1"
},
{
"input": "11 32 10",
"output": "-1"
},
{
"input": "2 11 1",
"output": "-1"
},
{
"input": "10 11 7",
"output": "-1"
},
{
"input": "11 26 0",
"output": "-1"
},
{
"input": "100 205 5",
"output": "-1"
},
{
"input": "4 0 2",
"output": "-1"
},
{
"input": "10 11 8",
"output": "-1"
},
{
"input": "11 22 5",
"output": "2"
},
{
"input": "4 0 5",
"output": "-1"
},
{
"input": "11 87 22",
"output": "9"
},
{
"input": "4 8 0",
"output": "2"
},
{
"input": "9 8 17",
"output": "-1"
},
{
"input": "10 20 0",
"output": "2"
},
{
"input": "10 9 19",
"output": "-1"
},
{
"input": "12 2 13",
"output": "-1"
},
{
"input": "11 24 5",
"output": "-1"
},
{
"input": "10 1 11",
"output": "-1"
},
{
"input": "4 0 9",
"output": "-1"
},
{
"input": "3 0 1",
"output": "-1"
},
{
"input": "11 12 4",
"output": "-1"
},
{
"input": "3 8 2",
"output": "-1"
},
{
"input": "11 17 10",
"output": "-1"
},
{
"input": "6 1 13",
"output": "-1"
},
{
"input": "11 25 0",
"output": "-1"
},
{
"input": "12 0 13",
"output": "-1"
},
{
"input": "10 5 20",
"output": "2"
},
{
"input": "11 89 2",
"output": "-1"
},
{
"input": "2 4 1",
"output": "2"
},
{
"input": "10 31 0",
"output": "-1"
},
{
"input": "11 34 1",
"output": "-1"
},
{
"input": "999 6693 8331",
"output": "14"
},
{
"input": "10 55 1",
"output": "-1"
},
{
"input": "11 12 8",
"output": "-1"
},
{
"input": "1 9 22",
"output": "31"
},
{
"input": "7572 9186 895",
"output": "-1"
},
{
"input": "3 2 11",
"output": "-1"
},
{
"input": "2 1 4",
"output": "2"
},
{
"input": "11 10 19",
"output": "-1"
},
{
"input": "100 199 99",
"output": "-1"
},
{
"input": "2537 8926 1523",
"output": "-1"
},
{
"input": "11 0 5",
"output": "-1"
},
{
"input": "5 1 11",
"output": "-1"
},
{
"input": "12 13 5",
"output": "-1"
},
{
"input": "10 12 0",
"output": "-1"
},
{
"input": "5 4 7",
"output": "-1"
},
{
"input": "12 25 1",
"output": "-1"
},
{
"input": "7 9 0",
"output": "-1"
},
{
"input": "4 15 0",
"output": "-1"
},
{
"input": "5 11 2",
"output": "-1"
},
{
"input": "11 58 3",
"output": "-1"
},
{
"input": "10 11 5",
"output": "-1"
},
{
"input": "10 3 1003",
"output": "-1"
},
{
"input": "11 14 0",
"output": "-1"
},
{
"input": "11 8 23",
"output": "-1"
},
{
"input": "11 22 4",
"output": "2"
},
{
"input": "5 2 0",
"output": "-1"
},
{
"input": "11 1 35",
"output": "-1"
},
{
"input": "12 25 5",
"output": "-1"
},
{
"input": "11 37 4",
"output": "-1"
},
{
"input": "20 42 3",
"output": "-1"
},
{
"input": "10 12 2",
"output": "-1"
},
{
"input": "4 1 5",
"output": "-1"
},
{
"input": "5 16 0",
"output": "-1"
},
{
"input": "11 13 7",
"output": "-1"
},
{
"input": "5 0 3",
"output": "-1"
},
{
"input": "11 2 11",
"output": "1"
},
{
"input": "3 2 2000",
"output": "-1"
},
{
"input": "3 0 4241",
"output": "-1"
},
{
"input": "2 12 11",
"output": "11"
},
{
"input": "10 2 82",
"output": "-1"
},
{
"input": "11 0 11",
"output": "1"
},
{
"input": "11 20 20",
"output": "2"
},
{
"input": "5 0 10",
"output": "2"
},
{
"input": "11 1 0",
"output": "-1"
},
{
"input": "11 13 13",
"output": "2"
}
] | 1,634,245,669 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 1 | 61 | 0 | k,a,b = list(map(int, input().split()))
if k > a:
if b%k == 0:
print(b//k)
else:
print(-1)
if k > b:
if a%k == 0:
print(a//k)
else:
print(-1)
if a > k and b > k:
print((a//k) + (b//k)) | Title: Table Tennis Game 2
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Misha and Vanya have played several table tennis sets. Each set consists of several serves, each serve is won by one of the players, he receives one point and the loser receives nothing. Once one of the players scores exactly *k* points, the score is reset and a new set begins.
Across all the sets Misha scored *a* points in total, and Vanya scored *b* points. Given this information, determine the maximum number of sets they could have played, or that the situation is impossible.
Note that the game consisted of several complete sets.
Input Specification:
The first line contains three space-separated integers *k*, *a* and *b* (1<=≤<=*k*<=≤<=109, 0<=≤<=*a*,<=*b*<=≤<=109, *a*<=+<=*b*<=><=0).
Output Specification:
If the situation is impossible, print a single number -1. Otherwise, print the maximum possible number of sets.
Demo Input:
['11 11 5\n', '11 2 3\n']
Demo Output:
['1\n', '-1\n']
Note:
Note that the rules of the game in this problem differ from the real table tennis game, for example, the rule of "balance" (the winning player has to be at least two points ahead to win a set) has no power within the present problem. | ```python
k,a,b = list(map(int, input().split()))
if k > a:
if b%k == 0:
print(b//k)
else:
print(-1)
if k > b:
if a%k == 0:
print(a//k)
else:
print(-1)
if a > k and b > k:
print((a//k) + (b//k))
``` | 0 |
|
93 | E | Lostborn | PROGRAMMING | 2,600 | [
"dp",
"math",
"number theory"
] | E. Lostborn | 2 | 256 | Igor K. very much likes a multiplayer role playing game WineAge II. Who knows, perhaps, that might be the reason for his poor performance at the university. As any person who plays the game, he is interested in equipping his hero with as good weapon and outfit as possible.
One day, as he was reading the game's forum yet again, he discovered a very interesting fact. As it turns out, each weapon in the game is characterised with *k* different numbers: *a*1,<=...,<=*a**k*. They are called hit indicators and according to the game developers' plan they are pairwise coprime.
The damage that is inflicted during a hit depends not only on the weapon's characteristics, but also on the hero's strength parameter. Thus, if the hero's strength equals *n*, than the inflicted damage will be calculated as the number of numbers on the segment , that aren't divisible by any hit indicator *a**i*.
Recently, having fulfilled another quest, Igor K. found a new Lostborn sword. He wants to know how much damage he will inflict upon his enemies if he uses it. | The first line contains two integers: *n* and *k* (1<=≤<=*n*<=≤<=1013, 1<=≤<=*k*<=≤<=100). They are the indicator of Igor K's hero's strength and the number of hit indicators.
The next line contains space-separated *k* integers *a**i* (1<=≤<=*a**i*<=≤<=1000). They are Lostborn sword's hit indicators. The given *k* numbers are pairwise coprime. | Print the single number — the damage that will be inflicted by Igor K.'s hero when he uses his new weapon.
Please, do not use the %lld specificator to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specificator. | [
"20 3\n2 3 5\n",
"50 2\n15 8\n"
] | [
"6\n",
"41\n"
] | none | 2,500 | [] | 1,669,444,008 | 2,147,483,647 | PyPy 3-64 | TIME_LIMIT_EXCEEDED | TESTS | 50 | 2,000 | 10,240,000 | import math
iin,k = [int(x) for x in input().split(' ')]
a = [int(x) for x in input().split(' ')]
a.sort(reverse = True)
def c(n,y):
if y == len(a)-1:
return n-math.floor(n/a[-1])
elif n < a[-1]:
return n
else:
return c(n,y+1)-c(math.floor(n/a[y]),y+1)
if a[-1] == 1:
print('0')
else:
print(c(iin,0))
| Title: Lostborn
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Igor K. very much likes a multiplayer role playing game WineAge II. Who knows, perhaps, that might be the reason for his poor performance at the university. As any person who plays the game, he is interested in equipping his hero with as good weapon and outfit as possible.
One day, as he was reading the game's forum yet again, he discovered a very interesting fact. As it turns out, each weapon in the game is characterised with *k* different numbers: *a*1,<=...,<=*a**k*. They are called hit indicators and according to the game developers' plan they are pairwise coprime.
The damage that is inflicted during a hit depends not only on the weapon's characteristics, but also on the hero's strength parameter. Thus, if the hero's strength equals *n*, than the inflicted damage will be calculated as the number of numbers on the segment , that aren't divisible by any hit indicator *a**i*.
Recently, having fulfilled another quest, Igor K. found a new Lostborn sword. He wants to know how much damage he will inflict upon his enemies if he uses it.
Input Specification:
The first line contains two integers: *n* and *k* (1<=≤<=*n*<=≤<=1013, 1<=≤<=*k*<=≤<=100). They are the indicator of Igor K's hero's strength and the number of hit indicators.
The next line contains space-separated *k* integers *a**i* (1<=≤<=*a**i*<=≤<=1000). They are Lostborn sword's hit indicators. The given *k* numbers are pairwise coprime.
Output Specification:
Print the single number — the damage that will be inflicted by Igor K.'s hero when he uses his new weapon.
Please, do not use the %lld specificator to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams or the %I64d specificator.
Demo Input:
['20 3\n2 3 5\n', '50 2\n15 8\n']
Demo Output:
['6\n', '41\n']
Note:
none | ```python
import math
iin,k = [int(x) for x in input().split(' ')]
a = [int(x) for x in input().split(' ')]
a.sort(reverse = True)
def c(n,y):
if y == len(a)-1:
return n-math.floor(n/a[-1])
elif n < a[-1]:
return n
else:
return c(n,y+1)-c(math.floor(n/a[y]),y+1)
if a[-1] == 1:
print('0')
else:
print(c(iin,0))
``` | 0 |
845 | C | Two TVs | PROGRAMMING | 1,500 | [
"data structures",
"greedy",
"sortings"
] | null | null | Polycarp is a great fan of television.
He wrote down all the TV programs he is interested in for today. His list contains *n* shows, *i*-th of them starts at moment *l**i* and ends at moment *r**i*.
Polycarp owns two TVs. He can watch two different shows simultaneously with two TVs but he can only watch one show at any given moment on a single TV. If one show ends at the same moment some other show starts then you can't watch them on a single TV.
Polycarp wants to check out all *n* shows. Are two TVs enough to do so? | The first line contains one integer *n* (1<=≤<=*n*<=≤<=2·105) — the number of shows.
Each of the next *n* lines contains two integers *l**i* and *r**i* (0<=≤<=*l**i*<=<<=*r**i*<=≤<=109) — starting and ending time of *i*-th show. | If Polycarp is able to check out all the shows using only two TVs then print "YES" (without quotes). Otherwise, print "NO" (without quotes). | [
"3\n1 2\n2 3\n4 5\n",
"4\n1 2\n2 3\n2 3\n1 2\n"
] | [
"YES\n",
"NO\n"
] | none | 0 | [
{
"input": "3\n1 2\n2 3\n4 5",
"output": "YES"
},
{
"input": "4\n1 2\n2 3\n2 3\n1 2",
"output": "NO"
},
{
"input": "4\n0 1\n1 2\n2 3\n3 4",
"output": "YES"
},
{
"input": "3\n1 2\n2 3\n2 4",
"output": "NO"
},
{
"input": "3\n0 100\n0 100\n0 100",
"output": "NO"
},
{
"input": "1\n0 1000000000",
"output": "YES"
},
{
"input": "2\n0 1\n0 1",
"output": "YES"
},
{
"input": "3\n2 3\n4 5\n1 6",
"output": "YES"
},
{
"input": "5\n1 3\n1 4\n4 10\n5 8\n9 11",
"output": "YES"
},
{
"input": "3\n1 2\n1 2\n2 3",
"output": "NO"
},
{
"input": "4\n1 100\n10 15\n20 25\n30 35",
"output": "YES"
},
{
"input": "3\n1 8\n6 7\n8 11",
"output": "YES"
},
{
"input": "5\n1 2\n3 5\n4 7\n8 9\n5 10",
"output": "NO"
},
{
"input": "4\n1 7\n2 3\n4 5\n6 7",
"output": "YES"
},
{
"input": "4\n1 100\n50 51\n60 90\n51 52",
"output": "NO"
},
{
"input": "3\n1 10\n2 9\n3 8",
"output": "NO"
},
{
"input": "2\n0 4\n0 4",
"output": "YES"
},
{
"input": "2\n0 2\n0 6",
"output": "YES"
},
{
"input": "5\n3 4\n21 26\n12 17\n9 14\n15 16",
"output": "YES"
},
{
"input": "5\n1 4\n13 15\n11 12\n9 15\n2 5",
"output": "YES"
},
{
"input": "4\n16 19\n9 14\n14 15\n15 19",
"output": "YES"
},
{
"input": "5\n16 19\n23 29\n3 8\n23 26\n22 23",
"output": "NO"
},
{
"input": "5\n19 23\n12 17\n16 21\n20 23\n8 10",
"output": "NO"
},
{
"input": "5\n8 10\n4 10\n3 4\n14 15\n17 19",
"output": "YES"
},
{
"input": "3\n2 8\n5 7\n6 7",
"output": "NO"
},
{
"input": "5\n10 12\n4 6\n21 24\n9 12\n7 13",
"output": "NO"
},
{
"input": "5\n0 3\n14 16\n6 8\n5 9\n9 15",
"output": "YES"
},
{
"input": "5\n6 12\n23 25\n6 7\n19 25\n10 11",
"output": "YES"
},
{
"input": "5\n15 18\n23 24\n23 28\n22 24\n15 19",
"output": "NO"
},
{
"input": "4\n1 8\n8 9\n5 7\n1 4",
"output": "YES"
},
{
"input": "3\n6 10\n1 9\n2 5",
"output": "YES"
},
{
"input": "3\n1 8\n5 6\n6 9",
"output": "NO"
},
{
"input": "4\n2 3\n5 9\n8 10\n9 10",
"output": "NO"
},
{
"input": "4\n0 8\n6 7\n5 9\n1 4",
"output": "NO"
},
{
"input": "3\n6 9\n0 1\n0 2",
"output": "YES"
},
{
"input": "5\n0 6\n21 25\n18 19\n0 3\n6 12",
"output": "YES"
},
{
"input": "4\n1 5\n6 9\n4 8\n1 3",
"output": "YES"
},
{
"input": "2\n2 5\n0 5",
"output": "YES"
},
{
"input": "4\n5 8\n11 15\n3 7\n10 14",
"output": "YES"
},
{
"input": "3\n12 14\n0 4\n2 3",
"output": "YES"
},
{
"input": "4\n4 10\n0 1\n2 10\n0 5",
"output": "NO"
},
{
"input": "4\n0 3\n0 1\n2 4\n2 5",
"output": "NO"
}
] | 1,506,002,891 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 10 | 1,107 | 22,835,200 | n=int(input())
A=[]
for i in range(n):
a=list(map(int,input().split()))
A.append(a)
A.sort()
m=0
for i in range(n):
if i>0:
if A[i][0]>=A[i-1][1]:
continue
else:
m+=1
break
if m>0:
print('NO')
else:
print('YES') | Title: Two TVs
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Polycarp is a great fan of television.
He wrote down all the TV programs he is interested in for today. His list contains *n* shows, *i*-th of them starts at moment *l**i* and ends at moment *r**i*.
Polycarp owns two TVs. He can watch two different shows simultaneously with two TVs but he can only watch one show at any given moment on a single TV. If one show ends at the same moment some other show starts then you can't watch them on a single TV.
Polycarp wants to check out all *n* shows. Are two TVs enough to do so?
Input Specification:
The first line contains one integer *n* (1<=≤<=*n*<=≤<=2·105) — the number of shows.
Each of the next *n* lines contains two integers *l**i* and *r**i* (0<=≤<=*l**i*<=<<=*r**i*<=≤<=109) — starting and ending time of *i*-th show.
Output Specification:
If Polycarp is able to check out all the shows using only two TVs then print "YES" (without quotes). Otherwise, print "NO" (without quotes).
Demo Input:
['3\n1 2\n2 3\n4 5\n', '4\n1 2\n2 3\n2 3\n1 2\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none | ```python
n=int(input())
A=[]
for i in range(n):
a=list(map(int,input().split()))
A.append(a)
A.sort()
m=0
for i in range(n):
if i>0:
if A[i][0]>=A[i-1][1]:
continue
else:
m+=1
break
if m>0:
print('NO')
else:
print('YES')
``` | 0 |
|
689 | A | Mike and Cellphone | PROGRAMMING | 1,400 | [
"brute force",
"constructive algorithms",
"implementation"
] | null | null | While swimming at the beach, Mike has accidentally dropped his cellphone into the water. There was no worry as he bought a cheap replacement phone with an old-fashioned keyboard. The keyboard has only ten digital equal-sized keys, located in the following way:
Together with his old phone, he lost all his contacts and now he can only remember the way his fingers moved when he put some number in. One can formally consider finger movements as a sequence of vectors connecting centers of keys pressed consecutively to put in a number. For example, the finger movements for number "586" are the same as finger movements for number "253":
Mike has already put in a number by his "finger memory" and started calling it, so he is now worrying, can he be sure that he is calling the correct number? In other words, is there any other number, that has the same finger movements? | The first line of the input contains the only integer *n* (1<=≤<=*n*<=≤<=9) — the number of digits in the phone number that Mike put in.
The second line contains the string consisting of *n* digits (characters from '0' to '9') representing the number that Mike put in. | If there is no other phone number with the same finger movements and Mike can be sure he is calling the correct number, print "YES" (without quotes) in the only line.
Otherwise print "NO" (without quotes) in the first line. | [
"3\n586\n",
"2\n09\n",
"9\n123456789\n",
"3\n911\n"
] | [
"NO\n",
"NO\n",
"YES\n",
"YES\n"
] | You can find the picture clarifying the first sample case in the statement above. | 500 | [
{
"input": "3\n586",
"output": "NO"
},
{
"input": "2\n09",
"output": "NO"
},
{
"input": "9\n123456789",
"output": "YES"
},
{
"input": "3\n911",
"output": "YES"
},
{
"input": "3\n089",
"output": "NO"
},
{
"input": "3\n159",
"output": "YES"
},
{
"input": "9\n000000000",
"output": "NO"
},
{
"input": "4\n0874",
"output": "NO"
},
{
"input": "6\n235689",
"output": "NO"
},
{
"input": "2\n10",
"output": "YES"
},
{
"input": "3\n358",
"output": "NO"
},
{
"input": "6\n123456",
"output": "NO"
},
{
"input": "1\n0",
"output": "NO"
},
{
"input": "4\n0068",
"output": "NO"
},
{
"input": "6\n021149",
"output": "YES"
},
{
"input": "5\n04918",
"output": "YES"
},
{
"input": "2\n05",
"output": "NO"
},
{
"input": "4\n0585",
"output": "NO"
},
{
"input": "4\n0755",
"output": "NO"
},
{
"input": "2\n08",
"output": "NO"
},
{
"input": "4\n0840",
"output": "NO"
},
{
"input": "9\n103481226",
"output": "YES"
},
{
"input": "4\n1468",
"output": "NO"
},
{
"input": "7\n1588216",
"output": "NO"
},
{
"input": "9\n188758557",
"output": "NO"
},
{
"input": "1\n2",
"output": "NO"
},
{
"input": "2\n22",
"output": "NO"
},
{
"input": "8\n23482375",
"output": "YES"
},
{
"input": "9\n246112056",
"output": "YES"
},
{
"input": "9\n256859223",
"output": "NO"
},
{
"input": "6\n287245",
"output": "NO"
},
{
"input": "8\n28959869",
"output": "NO"
},
{
"input": "9\n289887167",
"output": "YES"
},
{
"input": "4\n3418",
"output": "NO"
},
{
"input": "4\n3553",
"output": "NO"
},
{
"input": "2\n38",
"output": "NO"
},
{
"input": "6\n386126",
"output": "NO"
},
{
"input": "6\n392965",
"output": "NO"
},
{
"input": "1\n4",
"output": "NO"
},
{
"input": "6\n423463",
"output": "NO"
},
{
"input": "4\n4256",
"output": "NO"
},
{
"input": "8\n42937903",
"output": "YES"
},
{
"input": "1\n5",
"output": "NO"
},
{
"input": "8\n50725390",
"output": "YES"
},
{
"input": "9\n515821866",
"output": "NO"
},
{
"input": "2\n56",
"output": "NO"
},
{
"input": "2\n57",
"output": "NO"
},
{
"input": "7\n5740799",
"output": "NO"
},
{
"input": "9\n582526521",
"output": "NO"
},
{
"input": "9\n585284126",
"output": "NO"
},
{
"input": "1\n6",
"output": "NO"
},
{
"input": "3\n609",
"output": "NO"
},
{
"input": "2\n63",
"output": "NO"
},
{
"input": "3\n633",
"output": "NO"
},
{
"input": "7\n6668940",
"output": "NO"
},
{
"input": "5\n66883",
"output": "NO"
},
{
"input": "2\n68",
"output": "NO"
},
{
"input": "5\n69873",
"output": "YES"
},
{
"input": "1\n7",
"output": "NO"
},
{
"input": "4\n7191",
"output": "YES"
},
{
"input": "9\n722403540",
"output": "YES"
},
{
"input": "9\n769554547",
"output": "NO"
},
{
"input": "3\n780",
"output": "NO"
},
{
"input": "5\n78248",
"output": "NO"
},
{
"input": "4\n7844",
"output": "NO"
},
{
"input": "4\n7868",
"output": "NO"
},
{
"input": "1\n8",
"output": "NO"
},
{
"input": "6\n817332",
"output": "YES"
},
{
"input": "7\n8465393",
"output": "YES"
},
{
"input": "7\n8526828",
"output": "NO"
},
{
"input": "8\n85812664",
"output": "NO"
},
{
"input": "8\n93008225",
"output": "YES"
},
{
"input": "7\n9454566",
"output": "NO"
},
{
"input": "4\n9625",
"output": "NO"
},
{
"input": "8\n97862407",
"output": "YES"
},
{
"input": "3\n993",
"output": "NO"
},
{
"input": "3\n267",
"output": "YES"
},
{
"input": "3\n249",
"output": "YES"
},
{
"input": "3\n672",
"output": "YES"
},
{
"input": "3\n176",
"output": "YES"
},
{
"input": "3\n123",
"output": "NO"
},
{
"input": "3\n367",
"output": "YES"
},
{
"input": "2\n12",
"output": "NO"
},
{
"input": "4\n2580",
"output": "YES"
},
{
"input": "2\n20",
"output": "YES"
},
{
"input": "3\n492",
"output": "YES"
},
{
"input": "3\n167",
"output": "YES"
},
{
"input": "3\n970",
"output": "NO"
},
{
"input": "3\n460",
"output": "NO"
},
{
"input": "4\n4268",
"output": "NO"
},
{
"input": "4\n9394",
"output": "YES"
},
{
"input": "2\n13",
"output": "NO"
},
{
"input": "3\n729",
"output": "YES"
},
{
"input": "6\n456893",
"output": "YES"
}
] | 1,468,074,376 | 2,147,483,647 | PyPy 3 | OK | TESTS | 94 | 140 | 0 | n = input()
s = set(map(int,input()))
if all(map(lambda x: x&s!=set(),({1,4,7,0},{3,6,9,0},{7,0,9},{1,2,3}))):
print("YES")
else:
print("NO") | Title: Mike and Cellphone
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
While swimming at the beach, Mike has accidentally dropped his cellphone into the water. There was no worry as he bought a cheap replacement phone with an old-fashioned keyboard. The keyboard has only ten digital equal-sized keys, located in the following way:
Together with his old phone, he lost all his contacts and now he can only remember the way his fingers moved when he put some number in. One can formally consider finger movements as a sequence of vectors connecting centers of keys pressed consecutively to put in a number. For example, the finger movements for number "586" are the same as finger movements for number "253":
Mike has already put in a number by his "finger memory" and started calling it, so he is now worrying, can he be sure that he is calling the correct number? In other words, is there any other number, that has the same finger movements?
Input Specification:
The first line of the input contains the only integer *n* (1<=≤<=*n*<=≤<=9) — the number of digits in the phone number that Mike put in.
The second line contains the string consisting of *n* digits (characters from '0' to '9') representing the number that Mike put in.
Output Specification:
If there is no other phone number with the same finger movements and Mike can be sure he is calling the correct number, print "YES" (without quotes) in the only line.
Otherwise print "NO" (without quotes) in the first line.
Demo Input:
['3\n586\n', '2\n09\n', '9\n123456789\n', '3\n911\n']
Demo Output:
['NO\n', 'NO\n', 'YES\n', 'YES\n']
Note:
You can find the picture clarifying the first sample case in the statement above. | ```python
n = input()
s = set(map(int,input()))
if all(map(lambda x: x&s!=set(),({1,4,7,0},{3,6,9,0},{7,0,9},{1,2,3}))):
print("YES")
else:
print("NO")
``` | 3 |
|
255 | A | Greg's Workout | PROGRAMMING | 800 | [
"implementation"
] | null | null | Greg is a beginner bodybuilder. Today the gym coach gave him the training plan. All it had was *n* integers *a*1,<=*a*2,<=...,<=*a**n*. These numbers mean that Greg needs to do exactly *n* exercises today. Besides, Greg should repeat the *i*-th in order exercise *a**i* times.
Greg now only does three types of exercises: "chest" exercises, "biceps" exercises and "back" exercises. Besides, his training is cyclic, that is, the first exercise he does is a "chest" one, the second one is "biceps", the third one is "back", the fourth one is "chest", the fifth one is "biceps", and so on to the *n*-th exercise.
Now Greg wonders, which muscle will get the most exercise during his training. We know that the exercise Greg repeats the maximum number of times, trains the corresponding muscle the most. Help Greg, determine which muscle will get the most training. | The first line contains integer *n* (1<=≤<=*n*<=≤<=20). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=25) — the number of times Greg repeats the exercises. | Print word "chest" (without the quotes), if the chest gets the most exercise, "biceps" (without the quotes), if the biceps gets the most exercise and print "back" (without the quotes) if the back gets the most exercise.
It is guaranteed that the input is such that the answer to the problem is unambiguous. | [
"2\n2 8\n",
"3\n5 1 10\n",
"7\n3 3 2 7 9 6 8\n"
] | [
"biceps\n",
"back\n",
"chest\n"
] | In the first sample Greg does 2 chest, 8 biceps and zero back exercises, so the biceps gets the most exercises.
In the second sample Greg does 5 chest, 1 biceps and 10 back exercises, so the back gets the most exercises.
In the third sample Greg does 18 chest, 12 biceps and 8 back exercises, so the chest gets the most exercise. | 500 | [
{
"input": "2\n2 8",
"output": "biceps"
},
{
"input": "3\n5 1 10",
"output": "back"
},
{
"input": "7\n3 3 2 7 9 6 8",
"output": "chest"
},
{
"input": "4\n5 6 6 2",
"output": "chest"
},
{
"input": "5\n8 2 2 6 3",
"output": "chest"
},
{
"input": "6\n8 7 2 5 3 4",
"output": "chest"
},
{
"input": "8\n7 2 9 10 3 8 10 6",
"output": "chest"
},
{
"input": "9\n5 4 2 3 4 4 5 2 2",
"output": "chest"
},
{
"input": "10\n4 9 8 5 3 8 8 10 4 2",
"output": "biceps"
},
{
"input": "11\n10 9 7 6 1 3 9 7 1 3 5",
"output": "chest"
},
{
"input": "12\n24 22 6 16 5 21 1 7 2 19 24 5",
"output": "chest"
},
{
"input": "13\n24 10 5 7 16 17 2 7 9 20 15 2 24",
"output": "chest"
},
{
"input": "14\n13 14 19 8 5 17 9 16 15 9 5 6 3 7",
"output": "back"
},
{
"input": "15\n24 12 22 21 25 23 21 5 3 24 23 13 12 16 12",
"output": "chest"
},
{
"input": "16\n12 6 18 6 25 7 3 1 1 17 25 17 6 8 17 8",
"output": "biceps"
},
{
"input": "17\n13 8 13 4 9 21 10 10 9 22 14 23 22 7 6 14 19",
"output": "chest"
},
{
"input": "18\n1 17 13 6 11 10 25 13 24 9 21 17 3 1 17 12 25 21",
"output": "back"
},
{
"input": "19\n22 22 24 25 19 10 7 10 4 25 19 14 1 14 3 18 4 19 24",
"output": "chest"
},
{
"input": "20\n9 8 22 11 18 14 15 10 17 11 2 1 25 20 7 24 4 25 9 20",
"output": "chest"
},
{
"input": "1\n10",
"output": "chest"
},
{
"input": "2\n15 3",
"output": "chest"
},
{
"input": "3\n21 11 19",
"output": "chest"
},
{
"input": "4\n19 24 13 15",
"output": "chest"
},
{
"input": "5\n4 24 1 9 19",
"output": "biceps"
},
{
"input": "6\n6 22 24 7 15 24",
"output": "back"
},
{
"input": "7\n10 8 23 23 14 18 14",
"output": "chest"
},
{
"input": "8\n5 16 8 9 17 16 14 7",
"output": "biceps"
},
{
"input": "9\n12 3 10 23 6 4 22 13 12",
"output": "chest"
},
{
"input": "10\n1 9 20 18 20 17 7 24 23 2",
"output": "back"
},
{
"input": "11\n22 25 8 2 18 15 1 13 1 11 4",
"output": "biceps"
},
{
"input": "12\n20 12 14 2 15 6 24 3 11 8 11 14",
"output": "chest"
},
{
"input": "13\n2 18 8 8 8 20 5 22 15 2 5 19 18",
"output": "back"
},
{
"input": "14\n1 6 10 25 17 13 21 11 19 4 15 24 5 22",
"output": "biceps"
},
{
"input": "15\n13 5 25 13 17 25 19 21 23 17 12 6 14 8 6",
"output": "back"
},
{
"input": "16\n10 15 2 17 22 12 14 14 6 11 4 13 9 8 21 14",
"output": "chest"
},
{
"input": "17\n7 22 9 22 8 7 20 22 23 5 12 11 1 24 17 20 10",
"output": "biceps"
},
{
"input": "18\n18 15 4 25 5 11 21 25 12 14 25 23 19 19 13 6 9 17",
"output": "chest"
},
{
"input": "19\n3 1 3 15 15 25 10 25 23 10 9 21 13 23 19 3 24 21 14",
"output": "back"
},
{
"input": "20\n19 18 11 3 6 14 3 3 25 3 1 19 25 24 23 12 7 4 8 6",
"output": "back"
},
{
"input": "1\n19",
"output": "chest"
},
{
"input": "2\n1 7",
"output": "biceps"
},
{
"input": "3\n18 18 23",
"output": "back"
},
{
"input": "4\n12 15 1 13",
"output": "chest"
},
{
"input": "5\n11 14 25 21 21",
"output": "biceps"
},
{
"input": "6\n11 9 12 11 22 18",
"output": "biceps"
},
{
"input": "7\n11 1 16 20 21 25 20",
"output": "chest"
},
{
"input": "8\n1 2 20 9 3 22 17 4",
"output": "back"
},
{
"input": "9\n19 2 10 19 15 20 3 1 13",
"output": "back"
},
{
"input": "10\n11 2 11 8 21 16 2 3 19 9",
"output": "back"
},
{
"input": "20\n25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 25 24",
"output": "chest"
},
{
"input": "12\n4 24 21 3 13 24 22 13 12 21 1 15",
"output": "back"
},
{
"input": "13\n14 14 16 2 13 5 1 14 9 4 16 8 3",
"output": "biceps"
},
{
"input": "14\n1 9 15 4 11 8 25 3 9 14 13 2 1 11",
"output": "biceps"
},
{
"input": "15\n4 19 10 6 16 12 5 11 7 23 1 24 11 7 17",
"output": "back"
},
{
"input": "16\n2 8 2 8 13 22 20 12 22 23 18 13 18 22 11 17",
"output": "chest"
},
{
"input": "17\n24 5 5 16 10 8 22 6 4 13 10 10 5 23 8 20 8",
"output": "chest"
},
{
"input": "18\n14 8 9 12 11 18 24 1 14 24 18 5 12 17 1 10 1 22",
"output": "chest"
},
{
"input": "19\n21 2 10 6 9 1 24 5 2 19 10 13 10 7 19 2 6 13 24",
"output": "chest"
},
{
"input": "20\n7 1 14 17 6 6 18 13 12 3 25 4 3 19 22 24 16 14 1 23",
"output": "biceps"
},
{
"input": "1\n19",
"output": "chest"
},
{
"input": "20\n2 1 2 2 1 2 2 1 2 1 1 1 1 1 1 1 1 1 1 22",
"output": "biceps"
}
] | 1,650,824,920 | 2,147,483,647 | Python 3 | OK | TESTS | 61 | 92 | 0 | n=int(input())
a=list(map(int,input().split(" ")))
chest=0
biceps=0
back=0
for i in range(n):
if(i%3==0):
chest+=a[i]
elif(i%3==1):
biceps+=a[i]
elif(i%3==2):
back+=a[i]
if(chest>biceps and chest>back):
print("chest")
elif(biceps>chest and biceps>back):
print("biceps")
else:
if(back>chest and back>biceps):
print("back") | Title: Greg's Workout
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Greg is a beginner bodybuilder. Today the gym coach gave him the training plan. All it had was *n* integers *a*1,<=*a*2,<=...,<=*a**n*. These numbers mean that Greg needs to do exactly *n* exercises today. Besides, Greg should repeat the *i*-th in order exercise *a**i* times.
Greg now only does three types of exercises: "chest" exercises, "biceps" exercises and "back" exercises. Besides, his training is cyclic, that is, the first exercise he does is a "chest" one, the second one is "biceps", the third one is "back", the fourth one is "chest", the fifth one is "biceps", and so on to the *n*-th exercise.
Now Greg wonders, which muscle will get the most exercise during his training. We know that the exercise Greg repeats the maximum number of times, trains the corresponding muscle the most. Help Greg, determine which muscle will get the most training.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=20). The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=25) — the number of times Greg repeats the exercises.
Output Specification:
Print word "chest" (without the quotes), if the chest gets the most exercise, "biceps" (without the quotes), if the biceps gets the most exercise and print "back" (without the quotes) if the back gets the most exercise.
It is guaranteed that the input is such that the answer to the problem is unambiguous.
Demo Input:
['2\n2 8\n', '3\n5 1 10\n', '7\n3 3 2 7 9 6 8\n']
Demo Output:
['biceps\n', 'back\n', 'chest\n']
Note:
In the first sample Greg does 2 chest, 8 biceps and zero back exercises, so the biceps gets the most exercises.
In the second sample Greg does 5 chest, 1 biceps and 10 back exercises, so the back gets the most exercises.
In the third sample Greg does 18 chest, 12 biceps and 8 back exercises, so the chest gets the most exercise. | ```python
n=int(input())
a=list(map(int,input().split(" ")))
chest=0
biceps=0
back=0
for i in range(n):
if(i%3==0):
chest+=a[i]
elif(i%3==1):
biceps+=a[i]
elif(i%3==2):
back+=a[i]
if(chest>biceps and chest>back):
print("chest")
elif(biceps>chest and biceps>back):
print("biceps")
else:
if(back>chest and back>biceps):
print("back")
``` | 3 |
|
39 | F | Pacifist frogs | PROGRAMMING | 1,300 | [
"implementation"
] | F. Pacifist frogs | 2 | 64 | Thumbelina has had an accident. She has found herself on a little island in the middle of a swamp and wants to get to the shore very much.
One can get to the shore only by hills that are situated along a straight line that connects the little island with the shore. Let us assume that the hills are numbered from 1 to *n* and the number of a hill is equal to the distance in meters between it and the island. The distance between the *n*-th hill and the shore is also 1 meter.
Thumbelina is too small to make such jumps. Fortunately, a family of frogs living in the swamp suggests to help her. Each frog agrees to give Thumbelina a ride but Thumbelina should choose only one frog. Each frog has a certain jump length. If Thumbelina agrees to accept help from a frog whose jump length is *d*, the frog will jump from the island on the hill *d*, then — on the hill 2*d*, then 3*d* and so on until they get to the shore (i.e. find itself beyond the hill *n*).
However, there is one more problem: mosquitoes also live in the swamp. At the moment they have a siesta, and they are having a nap on some hills. If the frog jumps on a hill with a mosquito the frog will smash it. The frogs Thumbelina has met are pacifists, so they will find the death of each mosquito very much sad. Help Thumbelina choose a frog that will bring her to the shore and smash as small number of mosquitoes as possible. | The first line contains three integers *n*, *m* and *k* (1<=≤<=*n*<=≤<=109, 1<=≤<=*m*,<=*k*<=≤<=100) — the number of hills, frogs and mosquitoes respectively. The second line contains *m* integers *d**i* (1<=≤<=*d**i*<=≤<=109) — the lengths of the frogs’ jumps. The third line contains *k* integers — the numbers of the hills on which each mosquito is sleeping. No more than one mosquito can sleep on each hill. The numbers in the lines are separated by single spaces. | In the first line output the number of frogs that smash the minimal number of mosquitoes, in the second line — their numbers in increasing order separated by spaces. The frogs are numbered from 1 to *m* in the order of the jump length given in the input data. | [
"5 3 5\n2 3 4\n1 2 3 4 5\n",
"1000000000 2 3\n2 5\n999999995 999999998 999999996\n"
] | [
"2\n2 3\n",
"1\n2\n"
] | none | 0 | [
{
"input": "5 3 5\n2 3 4\n1 2 3 4 5",
"output": "2\n2 3"
},
{
"input": "1000000000 2 3\n2 5\n999999995 999999998 999999996",
"output": "1\n2"
},
{
"input": "1 1 1\n1\n1",
"output": "1\n1"
},
{
"input": "2 2 1\n2 1\n1",
"output": "1\n1"
},
{
"input": "3 2 2\n2 4\n3 2",
"output": "1\n2"
},
{
"input": "10 3 6\n5 2 8\n5 6 7 8 9 10",
"output": "1\n3"
},
{
"input": "10 10 9\n10 9 8 7 6 5 4 3 2 1\n10 9 8 7 5 4 3 2 1",
"output": "1\n5"
},
{
"input": "20 3 5\n2 3 5\n2 5 6 10 15",
"output": "1\n2"
},
{
"input": "20 4 8\n1 2 3 4\n2 4 6 8 10 12 14 16",
"output": "1\n3"
},
{
"input": "10 5 5\n1 5 3 5 1\n1 6 5 7 2",
"output": "3\n2 3 4"
},
{
"input": "20 10 5\n1 12 6 11 9 21 15 16 8 9\n11 13 15 2 1",
"output": "7\n2 3 5 6 8 9 10"
},
{
"input": "20 10 10\n9 8 21 8 7 2 13 17 20 18\n7 16 20 3 6 1 11 18 15 17",
"output": "2\n3 7"
},
{
"input": "20 10 10\n6 17 14 12 13 15 6 14 16 17\n1 6 16 14 7 8 9 12 10 2",
"output": "4\n2 5 6 10"
},
{
"input": "100 30 30\n25 34 81 32 96 79 36 21 53 15 51 69 78 99 60 2 80 37 61 70 32 31 31 6 7 38 95 70 81 39\n1 50 75 8 90 69 13 57 6 4 60 19 94 52 45 42 95 88 21 22 96 2 56 61 31 78 7 62 68 72",
"output": "11\n3 6 9 11 14 17 18 20 26 28 29"
},
{
"input": "200 35 67\n152 112 102 46 54 189 56 76 10 39 157 6 84 188 122 117 51 163 6 50 195 34 44 178 28 32 100 67 74 48 88 100 91 50 91\n126 68 138 157 92 128 183 36 175 49 168 198 116 20 31 88 61 46 12 179 137 130 185 5 171 96 184 85 37 147 50 75 93 103 160 10 120 140 59 98 131 124 121 190 169 141 165 39 47 28 90 139 148 119 73 6 51 94 21 52 89 35 97 79 3 13 142",
"output": "17\n1 2 3 5 6 8 14 15 16 18 21 24 27 28 32 33 35"
},
{
"input": "200 72 29\n201 145 169 163 32 126 131 71 26 130 2 61 110 17 179 114 79 30 192 91 141 70 101 119 185 66 72 76 164 144 106 162 122 146 119 181 184 61 131 131 140 152 60 65 183 154 32 33 108 77 29 102 67 5 125 26 126 104 20 89 183 21 126 195 198 24 123 173 135 164 141 32\n160 65 136 22 194 110 155 138 92 118 87 40 49 191 190 99 157 3 23 17 34 123 31 81 67 86 196 45 109",
"output": "59\n1 2 3 4 6 7 8 9 10 12 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 45 46 49 50 52 55 56 57 58 60 61 62 63 64 65 66 68 69 70 71"
},
{
"input": "500 46 46\n363 441 170 289 389 394 488 72 332 285 445 185 221 183 397 175 98 192 202 16 123 436 336 260 212 229 459 473 66 19 445 153 476 234 396 159 289 137 331 18 268 224 71 133 196 7\n454 64 417 129 95 162 496 300 234 359 224 354 334 155 191 82 35 319 244 126 292 108 321 93 77 311 107 487 121 431 235 100 445 68 338 467 133 307 4 220 245 84 468 141 436 363",
"output": "35\n2 3 4 5 6 7 8 9 10 12 13 14 15 16 17 18 19 21 23 24 25 26 27 28 29 32 33 35 36 37 38 39 41 43 45"
},
{
"input": "1000 19 27\n656 162 264 790 579 786 877 998 516 247 650 150 858 281 279 549 354 353 533\n349 411 1 248 22 649 726 382 423 832 172 864 17 658 840 572 564 287 800 919 500 575 461 40 1000 383 624",
"output": "19\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19"
}
] | 1,578,281,796 | 2,147,483,647 | Python 3 | OK | TESTS | 35 | 218 | 307,200 | n, m, k = map(int, input().split())
x, y = n, []
a = map(int, input().split())
b = list(map(int, input().split()))
for i, d in enumerate(a):
c = 0
for t in b:
if 0 == t % d:
c += 1
if c < x:
x = c
y = [i + 1]
elif c == x:
y += i + 1,
print(len(y))
print(' '.join(map(str, y)))
| Title: Pacifist frogs
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
Thumbelina has had an accident. She has found herself on a little island in the middle of a swamp and wants to get to the shore very much.
One can get to the shore only by hills that are situated along a straight line that connects the little island with the shore. Let us assume that the hills are numbered from 1 to *n* and the number of a hill is equal to the distance in meters between it and the island. The distance between the *n*-th hill and the shore is also 1 meter.
Thumbelina is too small to make such jumps. Fortunately, a family of frogs living in the swamp suggests to help her. Each frog agrees to give Thumbelina a ride but Thumbelina should choose only one frog. Each frog has a certain jump length. If Thumbelina agrees to accept help from a frog whose jump length is *d*, the frog will jump from the island on the hill *d*, then — on the hill 2*d*, then 3*d* and so on until they get to the shore (i.e. find itself beyond the hill *n*).
However, there is one more problem: mosquitoes also live in the swamp. At the moment they have a siesta, and they are having a nap on some hills. If the frog jumps on a hill with a mosquito the frog will smash it. The frogs Thumbelina has met are pacifists, so they will find the death of each mosquito very much sad. Help Thumbelina choose a frog that will bring her to the shore and smash as small number of mosquitoes as possible.
Input Specification:
The first line contains three integers *n*, *m* and *k* (1<=≤<=*n*<=≤<=109, 1<=≤<=*m*,<=*k*<=≤<=100) — the number of hills, frogs and mosquitoes respectively. The second line contains *m* integers *d**i* (1<=≤<=*d**i*<=≤<=109) — the lengths of the frogs’ jumps. The third line contains *k* integers — the numbers of the hills on which each mosquito is sleeping. No more than one mosquito can sleep on each hill. The numbers in the lines are separated by single spaces.
Output Specification:
In the first line output the number of frogs that smash the minimal number of mosquitoes, in the second line — their numbers in increasing order separated by spaces. The frogs are numbered from 1 to *m* in the order of the jump length given in the input data.
Demo Input:
['5 3 5\n2 3 4\n1 2 3 4 5\n', '1000000000 2 3\n2 5\n999999995 999999998 999999996\n']
Demo Output:
['2\n2 3\n', '1\n2\n']
Note:
none | ```python
n, m, k = map(int, input().split())
x, y = n, []
a = map(int, input().split())
b = list(map(int, input().split()))
for i, d in enumerate(a):
c = 0
for t in b:
if 0 == t % d:
c += 1
if c < x:
x = c
y = [i + 1]
elif c == x:
y += i + 1,
print(len(y))
print(' '.join(map(str, y)))
``` | 3.943211 |
664 | A | Complicated GCD | PROGRAMMING | 800 | [
"math",
"number theory"
] | null | null | Greatest common divisor *GCD*(*a*,<=*b*) of two positive integers *a* and *b* is equal to the biggest integer *d* such that both integers *a* and *b* are divisible by *d*. There are many efficient algorithms to find greatest common divisor *GCD*(*a*,<=*b*), for example, Euclid algorithm.
Formally, find the biggest integer *d*, such that all integers *a*,<=*a*<=+<=1,<=*a*<=+<=2,<=...,<=*b* are divisible by *d*. To make the problem even more complicated we allow *a* and *b* to be up to googol, 10100 — such number do not fit even in 64-bit integer type! | The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10100). | Output one integer — greatest common divisor of all integers from *a* to *b* inclusive. | [
"1 2\n",
"61803398874989484820458683436563811772030917980576 61803398874989484820458683436563811772030917980576\n"
] | [
"1\n",
"61803398874989484820458683436563811772030917980576\n"
] | none | 500 | [
{
"input": "1 2",
"output": "1"
},
{
"input": "61803398874989484820458683436563811772030917980576 61803398874989484820458683436563811772030917980576",
"output": "61803398874989484820458683436563811772030917980576"
},
{
"input": "1 100",
"output": "1"
},
{
"input": "100 100000",
"output": "1"
},
{
"input": "12345 67890123456789123457",
"output": "1"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "8392739158839273915883927391588392739158839273915883927391588392739158839273915883927391588392739158 8392739158839273915883927391588392739158839273915883927391588392739158839273915883927391588392739158",
"output": "8392739158839273915883927391588392739158839273915883927391588392739158839273915883927391588392739158"
},
{
"input": "1 10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "1"
},
{
"input": "8328748239473982794239847237438782379810988324751 9328748239473982794239847237438782379810988324751",
"output": "1"
},
{
"input": "1029398958432734901284327523909481928483573793 1029398958432734901284327523909481928483573794",
"output": "1"
},
{
"input": "10000 1000000000",
"output": "1"
},
{
"input": "10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000 10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000",
"output": "10000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000"
},
{
"input": "11210171722243 65715435710585778347",
"output": "1"
},
{
"input": "2921881079263974825226940825843 767693191032295360887755303860323261471",
"output": "1"
},
{
"input": "8025352957265704896940312528736939363590612908210603 96027920417708260814607687034511406492969694925539085",
"output": "1"
},
{
"input": "23510978780782786207241069904470895053213996267165977112058175452757132930 210352653280909370107314249722987050753257161175393375412301228883856435481424",
"output": "1"
},
{
"input": "8150070767079366215626260746398623663859344142817267779361251788637547414925170226504788118262 49924902262298336032630839998470954964895251605110946547855439236151401194070172107435992986913614",
"output": "1"
},
{
"input": "15943150466658398903 15943150466658398903",
"output": "15943150466658398903"
},
{
"input": "410470228200245407491525399055972 410470228200245407491525399055972",
"output": "410470228200245407491525399055972"
},
{
"input": "51894705655711504622197349350106792045098781545973899451307 51894705655711504622197349350106792045098781545973899451307",
"output": "51894705655711504622197349350106792045098781545973899451307"
},
{
"input": "60353594589897438036015726222485085035927634677598681595162804007836722215668410 60353594589897438036015726222485085035927634677598681595162804007836722215668410",
"output": "60353594589897438036015726222485085035927634677598681595162804007836722215668410"
},
{
"input": "761733780145118977868180796896376577405349682060892737466239031663476251177476275459280340045369535 761733780145118977868180796896376577405349682060892737466239031663476251177476275459280340045369535",
"output": "761733780145118977868180796896376577405349682060892737466239031663476251177476275459280340045369535"
},
{
"input": "1 2000000000",
"output": "1"
},
{
"input": "13 1928834874",
"output": "1"
},
{
"input": "87 2938984237482934238",
"output": "1"
},
{
"input": "213 413",
"output": "1"
},
{
"input": "3 4",
"output": "1"
}
] | 1,693,763,992 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 3 | 46 | 0 | import math
import sys
#from decimal import Decimal, getcontext
#getcontext().prec = 100
inputs = sys.stdin.read().splitlines()
outputs = []
ln = 0
'''
9xZER0
'''
if __name__ == "__main__":
# Inputs
n, m = map(int, inputs[ln].split())
# ln+=1
# n = int(inputs[ln])
#ln += 1
# l = [int(i) for i in inputs[ln].split()]
# ln += 1
# s1 = list(inputs[ln].split(' '))
# ln += 1
# s2 = list(map(int,inputs[ln].split('.')))
#s = inputs[ln]
#########################
# Code Goes From Here #
#########################
if m > n :
n, m = m, n
while m > 0:
n %= m
if m > n :
n, m = m, n
outputs.append(str(n))
# output
sys.stdout.write('\n'.join(outputs))
# stdout.flush()
| Title: Complicated GCD
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Greatest common divisor *GCD*(*a*,<=*b*) of two positive integers *a* and *b* is equal to the biggest integer *d* such that both integers *a* and *b* are divisible by *d*. There are many efficient algorithms to find greatest common divisor *GCD*(*a*,<=*b*), for example, Euclid algorithm.
Formally, find the biggest integer *d*, such that all integers *a*,<=*a*<=+<=1,<=*a*<=+<=2,<=...,<=*b* are divisible by *d*. To make the problem even more complicated we allow *a* and *b* to be up to googol, 10100 — such number do not fit even in 64-bit integer type!
Input Specification:
The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=10100).
Output Specification:
Output one integer — greatest common divisor of all integers from *a* to *b* inclusive.
Demo Input:
['1 2\n', '61803398874989484820458683436563811772030917980576 61803398874989484820458683436563811772030917980576\n']
Demo Output:
['1\n', '61803398874989484820458683436563811772030917980576\n']
Note:
none | ```python
import math
import sys
#from decimal import Decimal, getcontext
#getcontext().prec = 100
inputs = sys.stdin.read().splitlines()
outputs = []
ln = 0
'''
9xZER0
'''
if __name__ == "__main__":
# Inputs
n, m = map(int, inputs[ln].split())
# ln+=1
# n = int(inputs[ln])
#ln += 1
# l = [int(i) for i in inputs[ln].split()]
# ln += 1
# s1 = list(inputs[ln].split(' '))
# ln += 1
# s2 = list(map(int,inputs[ln].split('.')))
#s = inputs[ln]
#########################
# Code Goes From Here #
#########################
if m > n :
n, m = m, n
while m > 0:
n %= m
if m > n :
n, m = m, n
outputs.append(str(n))
# output
sys.stdout.write('\n'.join(outputs))
# stdout.flush()
``` | 0 |
|
612 | A | The Text Splitting | PROGRAMMING | 1,300 | [
"brute force",
"implementation",
"strings"
] | null | null | You are given the string *s* of length *n* and the numbers *p*,<=*q*. Split the string *s* to pieces of length *p* and *q*.
For example, the string "Hello" for *p*<==<=2, *q*<==<=3 can be split to the two strings "Hel" and "lo" or to the two strings "He" and "llo".
Note it is allowed to split the string *s* to the strings only of length *p* or to the strings only of length *q* (see the second sample test). | The first line contains three positive integers *n*,<=*p*,<=*q* (1<=≤<=*p*,<=*q*<=≤<=*n*<=≤<=100).
The second line contains the string *s* consists of lowercase and uppercase latin letters and digits. | If it's impossible to split the string *s* to the strings of length *p* and *q* print the only number "-1".
Otherwise in the first line print integer *k* — the number of strings in partition of *s*.
Each of the next *k* lines should contain the strings in partition. Each string should be of the length *p* or *q*. The string should be in order of their appearing in string *s* — from left to right.
If there are several solutions print any of them. | [
"5 2 3\nHello\n",
"10 9 5\nCodeforces\n",
"6 4 5\nPrivet\n",
"8 1 1\nabacabac\n"
] | [
"2\nHe\nllo\n",
"2\nCodef\norces\n",
"-1\n",
"8\na\nb\na\nc\na\nb\na\nc\n"
] | none | 0 | [
{
"input": "5 2 3\nHello",
"output": "2\nHe\nllo"
},
{
"input": "10 9 5\nCodeforces",
"output": "2\nCodef\norces"
},
{
"input": "6 4 5\nPrivet",
"output": "-1"
},
{
"input": "8 1 1\nabacabac",
"output": "8\na\nb\na\nc\na\nb\na\nc"
},
{
"input": "1 1 1\n1",
"output": "1\n1"
},
{
"input": "10 8 1\nuTl9w4lcdo",
"output": "10\nu\nT\nl\n9\nw\n4\nl\nc\nd\no"
},
{
"input": "20 6 4\nfmFRpk2NrzSvnQC9gB61",
"output": "5\nfmFR\npk2N\nrzSv\nnQC9\ngB61"
},
{
"input": "30 23 6\nWXDjl9kitaDTY673R5xyTlbL9gqeQ6",
"output": "5\nWXDjl9\nkitaDT\nY673R5\nxyTlbL\n9gqeQ6"
},
{
"input": "40 14 3\nSOHBIkWEv7ScrkHgMtFFxP9G7JQLYXFoH1sJDAde",
"output": "6\nSOHBIkWEv7Scrk\nHgMtFFxP9G7JQL\nYXF\noH1\nsJD\nAde"
},
{
"input": "50 16 3\nXCgVJUu4aMQ7HMxZjNxe3XARNiahK303g9y7NV8oN6tWdyXrlu",
"output": "8\nXCgVJUu4aMQ7HMxZ\njNxe3XARNiahK303\ng9y\n7NV\n8oN\n6tW\ndyX\nrlu"
},
{
"input": "60 52 8\nhae0PYwXcW2ziQCOSci5VaElHLZCZI81ULSHgpyG3fuZaP0fHjN4hCKogONj",
"output": "2\nhae0PYwXcW2ziQCOSci5VaElHLZCZI81ULSHgpyG3fuZaP0fHjN4\nhCKogONj"
},
{
"input": "70 50 5\n1BH1ECq7hjzooQOZdbiYHTAgATcP5mxI7kLI9rqA9AriWc9kE5KoLa1zmuTDFsd2ClAPPY",
"output": "14\n1BH1E\nCq7hj\nzooQO\nZdbiY\nHTAgA\nTcP5m\nxI7kL\nI9rqA\n9AriW\nc9kE5\nKoLa1\nzmuTD\nFsd2C\nlAPPY"
},
{
"input": "80 51 8\no2mpu1FCofuiLQb472qczCNHfVzz5TfJtVMrzgN3ff7FwlAY0fQ0ROhWmIX2bggodORNA76bHMjA5yyc",
"output": "10\no2mpu1FC\nofuiLQb4\n72qczCNH\nfVzz5TfJ\ntVMrzgN3\nff7FwlAY\n0fQ0ROhW\nmIX2bggo\ndORNA76b\nHMjA5yyc"
},
{
"input": "90 12 7\nclcImtsw176FFOA6OHGFxtEfEyhFh5bH4iktV0Y8onIcn0soTwiiHUFRWC6Ow36tT5bsQjgrVSTcB8fAVoe7dJIWkE",
"output": "10\nclcImtsw176F\nFOA6OHGFxtEf\nEyhFh5bH4ikt\nV0Y8onIcn0so\nTwiiHUF\nRWC6Ow3\n6tT5bsQ\njgrVSTc\nB8fAVoe\n7dJIWkE"
},
{
"input": "100 25 5\n2SRB9mRpXMRND5zQjeRxc4GhUBlEQSmLgnUtB9xTKoC5QM9uptc8dKwB88XRJy02r7edEtN2C6D60EjzK1EHPJcWNj6fbF8kECeB",
"output": "20\n2SRB9\nmRpXM\nRND5z\nQjeRx\nc4GhU\nBlEQS\nmLgnU\ntB9xT\nKoC5Q\nM9upt\nc8dKw\nB88XR\nJy02r\n7edEt\nN2C6D\n60Ejz\nK1EHP\nJcWNj\n6fbF8\nkECeB"
},
{
"input": "100 97 74\nxL8yd8lENYnXZs28xleyci4SxqsjZqkYzkEbQXfLQ4l4gKf9QQ9xjBjeZ0f9xQySf5psDUDkJEtPLsa62n4CLc6lF6E2yEqvt4EJ",
"output": "-1"
},
{
"input": "51 25 11\nwpk5wqrB6d3qE1slUrzJwMFafnnOu8aESlvTEb7Pp42FDG2iGQn",
"output": "-1"
},
{
"input": "70 13 37\nfzL91QIJvNoZRP4A9aNRT2GTksd8jEb1713pnWFaCGKHQ1oYvlTHXIl95lqyZRKJ1UPYvT",
"output": "-1"
},
{
"input": "10 3 1\nXQ2vXLPShy",
"output": "10\nX\nQ\n2\nv\nX\nL\nP\nS\nh\ny"
},
{
"input": "4 2 3\naaaa",
"output": "2\naa\naa"
},
{
"input": "100 1 1\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaabbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "100\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb\nb"
},
{
"input": "99 2 4\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "-1"
},
{
"input": "11 2 3\nhavanahavan",
"output": "4\nha\nvan\naha\nvan"
},
{
"input": "100 2 2\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "50\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa\naa"
},
{
"input": "17 3 5\ngopstopmipodoshli",
"output": "5\ngop\nsto\npmi\npod\noshli"
},
{
"input": "5 4 3\nfoyku",
"output": "-1"
},
{
"input": "99 2 2\n123456789012345678901234567890123456789012345678901234567890123456789012345678901234567890123456789",
"output": "-1"
},
{
"input": "99 2 2\nrecursionishellrecursionishellrecursionishellrecursionishellrecursionishellrecursionishelldontuseit",
"output": "-1"
},
{
"input": "11 2 3\nqibwnnvqqgo",
"output": "4\nqi\nbwn\nnvq\nqgo"
},
{
"input": "4 4 3\nhhhh",
"output": "1\nhhhh"
},
{
"input": "99 2 2\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "-1"
},
{
"input": "99 2 5\nhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh",
"output": "21\nhh\nhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh\nhhhhh"
},
{
"input": "10 5 9\nCodeforces",
"output": "2\nCodef\norces"
},
{
"input": "10 5 9\naaaaaaaaaa",
"output": "2\naaaaa\naaaaa"
},
{
"input": "11 3 2\nmlmqpohwtsf",
"output": "5\nmlm\nqp\noh\nwt\nsf"
},
{
"input": "3 3 2\nzyx",
"output": "1\nzyx"
},
{
"input": "100 3 3\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "-1"
},
{
"input": "4 2 3\nzyxw",
"output": "2\nzy\nxw"
},
{
"input": "3 2 3\nejt",
"output": "1\nejt"
},
{
"input": "5 2 4\nzyxwv",
"output": "-1"
},
{
"input": "100 1 1\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "100\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na\na"
},
{
"input": "100 5 4\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "25\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa\naaaa"
},
{
"input": "3 2 2\nzyx",
"output": "-1"
},
{
"input": "99 2 2\nhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh",
"output": "-1"
},
{
"input": "26 8 9\nabcabcabcabcabcabcabcabcab",
"output": "3\nabcabcab\ncabcabcab\ncabcabcab"
},
{
"input": "6 3 5\naaaaaa",
"output": "2\naaa\naaa"
},
{
"input": "3 2 3\nzyx",
"output": "1\nzyx"
},
{
"input": "5 5 2\naaaaa",
"output": "1\naaaaa"
},
{
"input": "4 3 2\nzyxw",
"output": "2\nzy\nxw"
},
{
"input": "5 4 3\nzyxwv",
"output": "-1"
},
{
"input": "95 3 29\nabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcab",
"output": "23\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabc\nabcabcabcabcabcabcabcabcabcab"
},
{
"input": "3 2 2\naaa",
"output": "-1"
},
{
"input": "91 62 3\nfjzhkfwzoabaauvbkuzaahkozofaophaafhfpuhobufawkzbavaazwavwppfwapkapaofbfjwaavajojgjguahphofj",
"output": "-1"
},
{
"input": "99 2 2\nabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabc",
"output": "-1"
},
{
"input": "56 13 5\nabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcab",
"output": "8\nabcabcabcabca\nbcabcabcabcab\ncabca\nbcabc\nabcab\ncabca\nbcabc\nabcab"
},
{
"input": "79 7 31\nabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabcabca",
"output": "-1"
},
{
"input": "92 79 6\nxlvplpckwnhmctoethhslkcyashqtsoeltriddglfwtgkfvkvgytygbcyohrvcxvosdioqvackxiuifmkgdngvbbudcb",
"output": "-1"
},
{
"input": "48 16 13\nibhfinipihcbsqnvtgsbkobepmwymlyfmlfgblvhlfhyojsy",
"output": "3\nibhfinipihcbsqnv\ntgsbkobepmwymlyf\nmlfgblvhlfhyojsy"
},
{
"input": "16 3 7\naaaaaaaaaaaaaaaa",
"output": "4\naaa\naaa\naaa\naaaaaaa"
},
{
"input": "11 10 3\naaaaaaaaaaa",
"output": "-1"
},
{
"input": "11 8 8\naaaaaaaaaaa",
"output": "-1"
},
{
"input": "11 7 3\naaaaaaaaaaa",
"output": "-1"
},
{
"input": "41 3 4\nabcabcabcabcabcabcabcabcabcabcabcabcabcab",
"output": "11\nabc\nabc\nabc\nabca\nbcab\ncabc\nabca\nbcab\ncabc\nabca\nbcab"
},
{
"input": "11 3 2\naaaaaaaaaaa",
"output": "5\naaa\naa\naa\naa\naa"
},
{
"input": "14 9 4\nabcdefghijklmn",
"output": "-1"
},
{
"input": "9 9 5\n123456789",
"output": "1\n123456789"
},
{
"input": "92 10 41\nmeotryyfneonmnrvfnhqlehlxtvpracifpadcofecvbikoitrlgeftiqofpvacgocrdiquhatlqosqvtduenaqkwrnnw",
"output": "3\nmeotryyfne\nonmnrvfnhqlehlxtvpracifpadcofecvbikoitrlg\neftiqofpvacgocrdiquhatlqosqvtduenaqkwrnnw"
},
{
"input": "17 16 3\ndxyhgtsxtuyljmclj",
"output": "-1"
},
{
"input": "82 13 30\nfmtwumakkejtolxqxrnydhqoufwtdwldfxcfjrndauqcarhbwmdwxsxfbqjsfspuxobywhcrvlndsdmkqd",
"output": "5\nfmtwumakkejto\nlxqxrnydhqouf\nwtdwldfxcfjrn\ndauqcarhbwmdw\nxsxfbqjsfspuxobywhcrvlndsdmkqd"
},
{
"input": "95 3 3\nihnfqcswushyoirjxlxxnwqtwtaowounkumxukwpacxwatimhhhoggqwkkspcplvyndfukbxickcixidgxkjtnpkoeiwlor",
"output": "-1"
},
{
"input": "7 5 3\nzyxwvut",
"output": "-1"
},
{
"input": "17 16 4\nctvfhkiakagcilrdw",
"output": "-1"
}
] | 1,588,871,796 | 2,147,483,647 | Python 3 | OK | TESTS | 72 | 124 | 6,963,200 | n, p, q = map(int, input().split())
s = input()
if p > q:
p, q = q, p
for i in range(0, n + 1, q):
if (n - i) % p == 0:
print(i // q + (n - i) // p)
for j in range(0, i, q):
print(s[j:j + q])
for j in range(i, n, p):
print(s[j:j + p])
exit(0)
print(-1)
| Title: The Text Splitting
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given the string *s* of length *n* and the numbers *p*,<=*q*. Split the string *s* to pieces of length *p* and *q*.
For example, the string "Hello" for *p*<==<=2, *q*<==<=3 can be split to the two strings "Hel" and "lo" or to the two strings "He" and "llo".
Note it is allowed to split the string *s* to the strings only of length *p* or to the strings only of length *q* (see the second sample test).
Input Specification:
The first line contains three positive integers *n*,<=*p*,<=*q* (1<=≤<=*p*,<=*q*<=≤<=*n*<=≤<=100).
The second line contains the string *s* consists of lowercase and uppercase latin letters and digits.
Output Specification:
If it's impossible to split the string *s* to the strings of length *p* and *q* print the only number "-1".
Otherwise in the first line print integer *k* — the number of strings in partition of *s*.
Each of the next *k* lines should contain the strings in partition. Each string should be of the length *p* or *q*. The string should be in order of their appearing in string *s* — from left to right.
If there are several solutions print any of them.
Demo Input:
['5 2 3\nHello\n', '10 9 5\nCodeforces\n', '6 4 5\nPrivet\n', '8 1 1\nabacabac\n']
Demo Output:
['2\nHe\nllo\n', '2\nCodef\norces\n', '-1\n', '8\na\nb\na\nc\na\nb\na\nc\n']
Note:
none | ```python
n, p, q = map(int, input().split())
s = input()
if p > q:
p, q = q, p
for i in range(0, n + 1, q):
if (n - i) % p == 0:
print(i // q + (n - i) // p)
for j in range(0, i, q):
print(s[j:j + q])
for j in range(i, n, p):
print(s[j:j + p])
exit(0)
print(-1)
``` | 3 |
|
538 | B | Quasi Binary | PROGRAMMING | 1,400 | [
"constructive algorithms",
"dp",
"greedy",
"implementation"
] | null | null | A number is called quasibinary if its decimal representation contains only digits 0 or 1. For example, numbers 0, 1, 101, 110011 — are quasibinary and numbers 2, 12, 900 are not.
You are given a positive integer *n*. Represent it as a sum of minimum number of quasibinary numbers. | The first line contains a single integer *n* (1<=≤<=*n*<=≤<=106). | In the first line print a single integer *k* — the minimum number of numbers in the representation of number *n* as a sum of quasibinary numbers.
In the second line print *k* numbers — the elements of the sum. All these numbers should be quasibinary according to the definition above, their sum should equal *n*. Do not have to print the leading zeroes in the numbers. The order of numbers doesn't matter. If there are multiple possible representations, you are allowed to print any of them. | [
"9\n",
"32\n"
] | [
"9\n1 1 1 1 1 1 1 1 1 \n",
"3\n10 11 11 \n"
] | none | 1,000 | [
{
"input": "9",
"output": "9\n1 1 1 1 1 1 1 1 1 "
},
{
"input": "32",
"output": "3\n10 11 11 "
},
{
"input": "1",
"output": "1\n1 "
},
{
"input": "415",
"output": "5\n1 101 101 101 111 "
},
{
"input": "10011",
"output": "1\n10011 "
},
{
"input": "10201",
"output": "2\n100 10101 "
},
{
"input": "314159",
"output": "9\n1 1 1 1 11 1011 101011 101011 111111 "
},
{
"input": "999999",
"output": "9\n111111 111111 111111 111111 111111 111111 111111 111111 111111 "
},
{
"input": "2",
"output": "2\n1 1 "
},
{
"input": "10",
"output": "1\n10 "
},
{
"input": "21",
"output": "2\n10 11 "
},
{
"input": "98",
"output": "9\n10 11 11 11 11 11 11 11 11 "
},
{
"input": "102030",
"output": "3\n10 1010 101010 "
},
{
"input": "909090",
"output": "9\n101010 101010 101010 101010 101010 101010 101010 101010 101010 "
},
{
"input": "909823",
"output": "9\n101000 101100 101100 101100 101100 101100 101101 101111 101111 "
},
{
"input": "1000000",
"output": "1\n1000000 "
},
{
"input": "111111",
"output": "1\n111111 "
},
{
"input": "123456",
"output": "6\n1 11 111 1111 11111 111111 "
},
{
"input": "987654",
"output": "9\n100000 110000 111000 111100 111110 111111 111111 111111 111111 "
},
{
"input": "908172",
"output": "9\n100000 101000 101010 101010 101010 101010 101010 101011 101111 "
},
{
"input": "8",
"output": "8\n1 1 1 1 1 1 1 1 "
},
{
"input": "100009",
"output": "9\n1 1 1 1 1 1 1 1 100001 "
},
{
"input": "900000",
"output": "9\n100000 100000 100000 100000 100000 100000 100000 100000 100000 "
},
{
"input": "1435",
"output": "5\n1 101 111 111 1111 "
},
{
"input": "1453",
"output": "5\n10 110 111 111 1111 "
}
] | 1,609,939,970 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 3 | 124 | 0 | p = int(input())
a = [int(x) for x in str(p)]
n, m = len(a), max(a)
ans = [['0'] * n for i in range(m)]
for i in range(n):
for j in range(a[i]):
ans[j][i] = '1'
print(m)
print(*[''.join(ans[i]) for i in range(m)])
| Title: Quasi Binary
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A number is called quasibinary if its decimal representation contains only digits 0 or 1. For example, numbers 0, 1, 101, 110011 — are quasibinary and numbers 2, 12, 900 are not.
You are given a positive integer *n*. Represent it as a sum of minimum number of quasibinary numbers.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=106).
Output Specification:
In the first line print a single integer *k* — the minimum number of numbers in the representation of number *n* as a sum of quasibinary numbers.
In the second line print *k* numbers — the elements of the sum. All these numbers should be quasibinary according to the definition above, their sum should equal *n*. Do not have to print the leading zeroes in the numbers. The order of numbers doesn't matter. If there are multiple possible representations, you are allowed to print any of them.
Demo Input:
['9\n', '32\n']
Demo Output:
['9\n1 1 1 1 1 1 1 1 1 \n', '3\n10 11 11 \n']
Note:
none | ```python
p = int(input())
a = [int(x) for x in str(p)]
n, m = len(a), max(a)
ans = [['0'] * n for i in range(m)]
for i in range(n):
for j in range(a[i]):
ans[j][i] = '1'
print(m)
print(*[''.join(ans[i]) for i in range(m)])
``` | 0 |
|
424 | B | Megacity | PROGRAMMING | 1,200 | [
"binary search",
"greedy",
"implementation",
"sortings"
] | null | null | The administration of the Tomsk Region firmly believes that it's time to become a megacity (that is, get population of one million). Instead of improving the demographic situation, they decided to achieve its goal by expanding the boundaries of the city.
The city of Tomsk can be represented as point on the plane with coordinates (0; 0). The city is surrounded with *n* other locations, the *i*-th one has coordinates (*x**i*, *y**i*) with the population of *k**i* people. You can widen the city boundaries to a circle of radius *r*. In such case all locations inside the circle and on its border are included into the city.
Your goal is to write a program that will determine the minimum radius *r*, to which is necessary to expand the boundaries of Tomsk, so that it becomes a megacity. | The first line of the input contains two integers *n* and *s* (1<=≤<=*n*<=≤<=103; 1<=≤<=*s*<=<<=106) — the number of locatons around Tomsk city and the population of the city. Then *n* lines follow. The *i*-th line contains three integers — the *x**i* and *y**i* coordinate values of the *i*-th location and the number *k**i* of people in it (1<=≤<=*k**i*<=<<=106). Each coordinate is an integer and doesn't exceed 104 in its absolute value.
It is guaranteed that no two locations are at the same point and no location is at point (0; 0). | In the output, print "-1" (without the quotes), if Tomsk won't be able to become a megacity. Otherwise, in the first line print a single real number — the minimum radius of the circle that the city needs to expand to in order to become a megacity.
The answer is considered correct if the absolute or relative error don't exceed 10<=-<=6. | [
"4 999998\n1 1 1\n2 2 1\n3 3 1\n2 -2 1\n",
"4 999998\n1 1 2\n2 2 1\n3 3 1\n2 -2 1\n",
"2 1\n1 1 999997\n2 2 1\n"
] | [
"2.8284271\n",
"1.4142136\n",
"-1"
] | none | 1,000 | [
{
"input": "4 999998\n1 1 1\n2 2 1\n3 3 1\n2 -2 1",
"output": "2.8284271"
},
{
"input": "4 999998\n1 1 2\n2 2 1\n3 3 1\n2 -2 1",
"output": "1.4142136"
},
{
"input": "2 1\n1 1 999997\n2 2 1",
"output": "-1"
},
{
"input": "4 999998\n3 3 10\n-3 3 10\n3 -3 10\n-3 -3 10",
"output": "4.2426407"
},
{
"input": "15 95473\n-9 6 199715\n0 -8 110607\n0 2 6621\n-3 -2 59894\n-10 -8 175440\n-2 0 25814\n10 -4 68131\n7 1 9971\n6 7 821\n6 5 20208\n6 2 68468\n0 7 37427\n1 -3 13337\n-10 7 113041\n-6 -2 44028",
"output": "12.8062485"
},
{
"input": "20 93350\n13 -28 486\n26 -26 48487\n5 -23 143368\n-23 -25 10371\n-2 -7 75193\n0 -8 3\n-6 -11 5015\n-19 -18 315278\n28 -15 45801\n21 8 4590\n-4 -28 12926\n-16 17 9405\n-28 -23 222092\n1 -10 1857\n14 -28 35170\n-4 -22 22036\n-2 -10 1260\n-1 12 375745\n-19 -24 38845\n10 -25 9256",
"output": "26.1725047"
},
{
"input": "30 505231\n-18 16 88130\n-10 16 15693\n16 -32 660\n-27 17 19042\n30 -37 6680\n36 19 299674\n-45 21 3300\n11 27 76\n-49 -34 28649\n-1 11 31401\n25 42 20858\n-40 6 455660\n-29 43 105001\n-38 10 6042\n19 -45 65551\n20 -9 148533\n-5 -24 393442\n-43 2 8577\n-39 18 97059\n12 28 39189\n35 23 28178\n40 -34 51687\n23 41 219028\n21 -44 927\n47 8 13206\n33 41 97342\n10 18 24895\n0 12 288\n0 -44 1065\n-25 43 44231",
"output": "24.5153013"
},
{
"input": "2 500000\n936 1000 500000\n961 976 500000",
"output": "1369.7065379"
},
{
"input": "10 764008\n959 32 23049\n-513 797 38979\n-603 -838 24916\n598 -430 25414\n-280 -624 18714\n330 891 21296\n-347 -68 27466\n650 -842 30125\n-314 889 35394\n275 969 5711",
"output": "1063.7029661"
},
{
"input": "30 295830\n1 -4 24773\n4 3 26175\n-2 -3 14789\n2 -1 46618\n-2 -2 52997\n-3 0 517\n-2 0 18173\n-4 -3 54465\n2 4 63579\n4 -4 41821\n2 2 11018\n0 4 42856\n0 -1 51885\n-3 4 57137\n3 0 4688\n0 2 60137\n-4 4 33484\n-1 3 66196\n3 -1 53634\n0 -2 41630\n-2 1 54606\n2 -2 2978\n2 -3 23733\n1 -2 35248\n-3 -3 15124\n-2 -4 26518\n4 0 28151\n4 -1 18348\n3 3 16914\n-4 2 26013",
"output": "4.4721360"
},
{
"input": "10 511500\n-5129 -3858 76954\n1296 1130 36126\n1219 6732 102003\n-8026 -178 4150\n-3261 1342 105429\n7965 -3013 62561\n5607 8963 53539\n-9044 -3999 16509\n1406 4103 115667\n-3716 2522 110626",
"output": "6841.4753526"
},
{
"input": "20 39342\n2 0 36476\n-3 1 136925\n1 3 31234\n0 -3 23785\n-1 3 77700\n-3 -1 50490\n-1 -3 13965\n-3 2 121093\n3 0 118933\n-3 0 125552\n-3 3 54779\n-2 0 96250\n1 2 142643\n2 2 23848\n0 2 29845\n0 -2 80462\n-1 1 91852\n-1 2 26526\n0 -1 136272\n1 1 108999",
"output": "3.0000000"
},
{
"input": "2 1\n1 0 1\n0 1 999999",
"output": "1.0000000"
},
{
"input": "2 999997\n1 1 1\n1 2 1",
"output": "-1"
}
] | 1,398,423,205 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 62 | 0 | from math import*
n, s = map(int, input().split())
dist = []
for i in range(n):
a, b, c = map(int, input().split())
dist.append((a*a + b*b, c))
dist = sorted(dist)
i = 0
while s < 1000000 and i < n - 1:
s += dist[0][1]
print(s)
i += 1
if s < 1000000:
print(-1)
if i == 0:
print(0)
else:
print(sqrt(dist[i - 1][0]))
print(dist) | Title: Megacity
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The administration of the Tomsk Region firmly believes that it's time to become a megacity (that is, get population of one million). Instead of improving the demographic situation, they decided to achieve its goal by expanding the boundaries of the city.
The city of Tomsk can be represented as point on the plane with coordinates (0; 0). The city is surrounded with *n* other locations, the *i*-th one has coordinates (*x**i*, *y**i*) with the population of *k**i* people. You can widen the city boundaries to a circle of radius *r*. In such case all locations inside the circle and on its border are included into the city.
Your goal is to write a program that will determine the minimum radius *r*, to which is necessary to expand the boundaries of Tomsk, so that it becomes a megacity.
Input Specification:
The first line of the input contains two integers *n* and *s* (1<=≤<=*n*<=≤<=103; 1<=≤<=*s*<=<<=106) — the number of locatons around Tomsk city and the population of the city. Then *n* lines follow. The *i*-th line contains three integers — the *x**i* and *y**i* coordinate values of the *i*-th location and the number *k**i* of people in it (1<=≤<=*k**i*<=<<=106). Each coordinate is an integer and doesn't exceed 104 in its absolute value.
It is guaranteed that no two locations are at the same point and no location is at point (0; 0).
Output Specification:
In the output, print "-1" (without the quotes), if Tomsk won't be able to become a megacity. Otherwise, in the first line print a single real number — the minimum radius of the circle that the city needs to expand to in order to become a megacity.
The answer is considered correct if the absolute or relative error don't exceed 10<=-<=6.
Demo Input:
['4 999998\n1 1 1\n2 2 1\n3 3 1\n2 -2 1\n', '4 999998\n1 1 2\n2 2 1\n3 3 1\n2 -2 1\n', '2 1\n1 1 999997\n2 2 1\n']
Demo Output:
['2.8284271\n', '1.4142136\n', '-1']
Note:
none | ```python
from math import*
n, s = map(int, input().split())
dist = []
for i in range(n):
a, b, c = map(int, input().split())
dist.append((a*a + b*b, c))
dist = sorted(dist)
i = 0
while s < 1000000 and i < n - 1:
s += dist[0][1]
print(s)
i += 1
if s < 1000000:
print(-1)
if i == 0:
print(0)
else:
print(sqrt(dist[i - 1][0]))
print(dist)
``` | 0 |
|
435 | B | Pasha Maximizes | PROGRAMMING | 1,400 | [
"greedy"
] | null | null | Pasha has a positive integer *a* without leading zeroes. Today he decided that the number is too small and he should make it larger. Unfortunately, the only operation Pasha can do is to swap two adjacent decimal digits of the integer.
Help Pasha count the maximum number he can get if he has the time to make at most *k* swaps. | The single line contains two integers *a* and *k* (1<=≤<=*a*<=≤<=1018; 0<=≤<=*k*<=≤<=100). | Print the maximum number that Pasha can get if he makes at most *k* swaps. | [
"1990 1\n",
"300 0\n",
"1034 2\n",
"9090000078001234 6\n"
] | [
"9190\n",
"300\n",
"3104\n",
"9907000008001234\n"
] | none | 1,000 | [
{
"input": "1990 1",
"output": "9190"
},
{
"input": "300 0",
"output": "300"
},
{
"input": "1034 2",
"output": "3104"
},
{
"input": "9090000078001234 6",
"output": "9907000008001234"
},
{
"input": "1234 3",
"output": "4123"
},
{
"input": "5 100",
"output": "5"
},
{
"input": "1234 5",
"output": "4312"
},
{
"input": "1234 6",
"output": "4321"
},
{
"input": "9022 2",
"output": "9220"
},
{
"input": "66838 4",
"output": "86863"
},
{
"input": "39940894417248510 10",
"output": "99984304417248510"
},
{
"input": "5314 4",
"output": "5431"
},
{
"input": "1026 9",
"output": "6210"
},
{
"input": "4529 8",
"output": "9542"
},
{
"input": "83811284 3",
"output": "88321184"
},
{
"input": "92153348 6",
"output": "98215334"
},
{
"input": "5846059 3",
"output": "8654059"
},
{
"input": "521325125110071928 4",
"output": "552132125110071928"
},
{
"input": "39940894417248510 10",
"output": "99984304417248510"
},
{
"input": "77172428736634377 29",
"output": "87777764122363437"
},
{
"input": "337775999910796051 37",
"output": "999997733751076051"
},
{
"input": "116995340392134308 27",
"output": "999654331120134308"
},
{
"input": "10120921290110921 20",
"output": "99221010120110921"
},
{
"input": "929201010190831892 30",
"output": "999928201010103182"
},
{
"input": "111111111111111119 8",
"output": "111111111911111111"
},
{
"input": "219810011901120912 100",
"output": "999822211111110000"
},
{
"input": "191919191919119911 100",
"output": "999999991111111111"
},
{
"input": "801211288881101019 22",
"output": "982111028888110101"
},
{
"input": "619911311932347059 3",
"output": "969111311932347059"
},
{
"input": "620737553540689123 2",
"output": "672037553540689123"
},
{
"input": "621563797296514835 3",
"output": "662153797296514835"
},
{
"input": "915277434701161 9",
"output": "977541234701161"
},
{
"input": "15603712376708 28",
"output": "87761503123670"
},
{
"input": "784069392990841 0",
"output": "784069392990841"
},
{
"input": "787464780004 2",
"output": "877644780004"
},
{
"input": "74604713975 29",
"output": "97776544310"
},
{
"input": "901000000954321789 5",
"output": "910009000054321789"
},
{
"input": "901000000954321789 10",
"output": "991000000504321789"
},
{
"input": "901000000954321789 28",
"output": "999100050000432178"
},
{
"input": "901000000954321789 40",
"output": "999810000050043217"
},
{
"input": "901000000954321789 70",
"output": "999875410000300021"
},
{
"input": "1234567891234567 99",
"output": "9877665544332211"
},
{
"input": "123456789123456789 100",
"output": "998877665544213123"
},
{
"input": "12345670123456789 100",
"output": "98776655443322101"
},
{
"input": "12 100",
"output": "21"
},
{
"input": "11223344556677889 47",
"output": "98821213344556677"
}
] | 1,664,002,891 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 3 | 46 | 0 | a, b = map(int, input().split())
num=[int(x) for x in str(a)]
k=0
yup=num
def f(o):
x=o
global b
global k
p=0
if x.index(max(x))<=b:
while max(x)!=x[0]:
l = x.index(max(x))
x[l-1], x[l] = x[l], x[l-1]
k=b
return x
else:
return x
num1=f(yup)
for i in range(len(num)-1):
for j in range(len(num)-i-1):
if k <= b:
num = num
while k<b:
if num[j] < num[j + 1]:
num[j], num[j + 1] = num[j + 1], num[j]
k+=1
j=0
if num[j] > num[j+1]:
j+=1
if num[j] == num[j+1]:
j+=1
num = max(num, num1)
print(''.join(map(str, num))) | Title: Pasha Maximizes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Pasha has a positive integer *a* without leading zeroes. Today he decided that the number is too small and he should make it larger. Unfortunately, the only operation Pasha can do is to swap two adjacent decimal digits of the integer.
Help Pasha count the maximum number he can get if he has the time to make at most *k* swaps.
Input Specification:
The single line contains two integers *a* and *k* (1<=≤<=*a*<=≤<=1018; 0<=≤<=*k*<=≤<=100).
Output Specification:
Print the maximum number that Pasha can get if he makes at most *k* swaps.
Demo Input:
['1990 1\n', '300 0\n', '1034 2\n', '9090000078001234 6\n']
Demo Output:
['9190\n', '300\n', '3104\n', '9907000008001234\n']
Note:
none | ```python
a, b = map(int, input().split())
num=[int(x) for x in str(a)]
k=0
yup=num
def f(o):
x=o
global b
global k
p=0
if x.index(max(x))<=b:
while max(x)!=x[0]:
l = x.index(max(x))
x[l-1], x[l] = x[l], x[l-1]
k=b
return x
else:
return x
num1=f(yup)
for i in range(len(num)-1):
for j in range(len(num)-i-1):
if k <= b:
num = num
while k<b:
if num[j] < num[j + 1]:
num[j], num[j + 1] = num[j + 1], num[j]
k+=1
j=0
if num[j] > num[j+1]:
j+=1
if num[j] == num[j+1]:
j+=1
num = max(num, num1)
print(''.join(map(str, num)))
``` | 0 |
|
591 | A | Wizards' Duel | PROGRAMMING | 900 | [
"implementation",
"math"
] | null | null | Harry Potter and He-Who-Must-Not-Be-Named engaged in a fight to the death once again. This time they are located at opposite ends of the corridor of length *l*. Two opponents simultaneously charge a deadly spell in the enemy. We know that the impulse of Harry's magic spell flies at a speed of *p* meters per second, and the impulse of You-Know-Who's magic spell flies at a speed of *q* meters per second.
The impulses are moving through the corridor toward each other, and at the time of the collision they turn round and fly back to those who cast them without changing their original speeds. Then, as soon as the impulse gets back to it's caster, the wizard reflects it and sends again towards the enemy, without changing the original speed of the impulse.
Since Harry has perfectly mastered the basics of magic, he knows that after the second collision both impulses will disappear, and a powerful explosion will occur exactly in the place of their collision. However, the young wizard isn't good at math, so he asks you to calculate the distance from his position to the place of the second meeting of the spell impulses, provided that the opponents do not change positions during the whole fight. | The first line of the input contains a single integer *l* (1<=≤<=*l*<=≤<=1<=000) — the length of the corridor where the fight takes place.
The second line contains integer *p*, the third line contains integer *q* (1<=≤<=*p*,<=*q*<=≤<=500) — the speeds of magical impulses for Harry Potter and He-Who-Must-Not-Be-Named, respectively. | Print a single real number — the distance from the end of the corridor, where Harry is located, to the place of the second meeting of the spell impulses. Your answer will be considered correct if its absolute or relative error will not exceed 10<=-<=4.
Namely: let's assume that your answer equals *a*, and the answer of the jury is *b*. The checker program will consider your answer correct if . | [
"100\n50\n50\n",
"199\n60\n40\n"
] | [
"50\n",
"119.4\n"
] | In the first sample the speeds of the impulses are equal, so both of their meetings occur exactly in the middle of the corridor. | 500 | [
{
"input": "100\n50\n50",
"output": "50"
},
{
"input": "199\n60\n40",
"output": "119.4"
},
{
"input": "1\n1\n1",
"output": "0.5"
},
{
"input": "1\n1\n500",
"output": "0.001996007984"
},
{
"input": "1\n500\n1",
"output": "0.998003992"
},
{
"input": "1\n500\n500",
"output": "0.5"
},
{
"input": "1000\n1\n1",
"output": "500"
},
{
"input": "1000\n1\n500",
"output": "1.996007984"
},
{
"input": "1000\n500\n1",
"output": "998.003992"
},
{
"input": "1000\n500\n500",
"output": "500"
},
{
"input": "101\n11\n22",
"output": "33.66666667"
},
{
"input": "987\n1\n3",
"output": "246.75"
},
{
"input": "258\n25\n431",
"output": "14.14473684"
},
{
"input": "979\n39\n60",
"output": "385.6666667"
},
{
"input": "538\n479\n416",
"output": "287.9351955"
},
{
"input": "583\n112\n248",
"output": "181.3777778"
},
{
"input": "978\n467\n371",
"output": "545.0190931"
},
{
"input": "980\n322\n193",
"output": "612.7378641"
},
{
"input": "871\n401\n17",
"output": "835.576555"
},
{
"input": "349\n478\n378",
"output": "194.885514"
},
{
"input": "425\n458\n118",
"output": "337.9340278"
},
{
"input": "919\n323\n458",
"output": "380.0729834"
},
{
"input": "188\n59\n126",
"output": "59.95675676"
},
{
"input": "644\n428\n484",
"output": "302.2280702"
},
{
"input": "253\n80\n276",
"output": "56.85393258"
},
{
"input": "745\n152\n417",
"output": "199.0158172"
},
{
"input": "600\n221\n279",
"output": "265.2"
},
{
"input": "690\n499\n430",
"output": "370.6243272"
},
{
"input": "105\n68\n403",
"output": "15.15923567"
},
{
"input": "762\n462\n371",
"output": "422.6218487"
},
{
"input": "903\n460\n362",
"output": "505.3284672"
},
{
"input": "886\n235\n95",
"output": "630.9393939"
},
{
"input": "655\n203\n18",
"output": "601.6515837"
},
{
"input": "718\n29\n375",
"output": "51.53960396"
},
{
"input": "296\n467\n377",
"output": "163.7819905"
},
{
"input": "539\n61\n56",
"output": "281.017094"
},
{
"input": "133\n53\n124",
"output": "39.82485876"
},
{
"input": "998\n224\n65",
"output": "773.5363322"
},
{
"input": "961\n173\n47",
"output": "755.6954545"
},
{
"input": "285\n468\n62",
"output": "251.6603774"
},
{
"input": "496\n326\n429",
"output": "214.1668874"
},
{
"input": "627\n150\n285",
"output": "216.2068966"
},
{
"input": "961\n443\n50",
"output": "863.535497"
},
{
"input": "623\n422\n217",
"output": "411.4334898"
},
{
"input": "678\n295\n29",
"output": "617.3148148"
}
] | 1,681,089,878 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 30 | 0 | a = int(input())
b = int(input())
c = int(input())
x = b * a /100
print(x)
| Title: Wizards' Duel
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Harry Potter and He-Who-Must-Not-Be-Named engaged in a fight to the death once again. This time they are located at opposite ends of the corridor of length *l*. Two opponents simultaneously charge a deadly spell in the enemy. We know that the impulse of Harry's magic spell flies at a speed of *p* meters per second, and the impulse of You-Know-Who's magic spell flies at a speed of *q* meters per second.
The impulses are moving through the corridor toward each other, and at the time of the collision they turn round and fly back to those who cast them without changing their original speeds. Then, as soon as the impulse gets back to it's caster, the wizard reflects it and sends again towards the enemy, without changing the original speed of the impulse.
Since Harry has perfectly mastered the basics of magic, he knows that after the second collision both impulses will disappear, and a powerful explosion will occur exactly in the place of their collision. However, the young wizard isn't good at math, so he asks you to calculate the distance from his position to the place of the second meeting of the spell impulses, provided that the opponents do not change positions during the whole fight.
Input Specification:
The first line of the input contains a single integer *l* (1<=≤<=*l*<=≤<=1<=000) — the length of the corridor where the fight takes place.
The second line contains integer *p*, the third line contains integer *q* (1<=≤<=*p*,<=*q*<=≤<=500) — the speeds of magical impulses for Harry Potter and He-Who-Must-Not-Be-Named, respectively.
Output Specification:
Print a single real number — the distance from the end of the corridor, where Harry is located, to the place of the second meeting of the spell impulses. Your answer will be considered correct if its absolute or relative error will not exceed 10<=-<=4.
Namely: let's assume that your answer equals *a*, and the answer of the jury is *b*. The checker program will consider your answer correct if .
Demo Input:
['100\n50\n50\n', '199\n60\n40\n']
Demo Output:
['50\n', '119.4\n']
Note:
In the first sample the speeds of the impulses are equal, so both of their meetings occur exactly in the middle of the corridor. | ```python
a = int(input())
b = int(input())
c = int(input())
x = b * a /100
print(x)
``` | 0 |
|
109 | A | Lucky Sum of Digits | PROGRAMMING | 1,000 | [
"brute force",
"implementation"
] | A. Lucky Sum of Digits | 2 | 256 | Petya loves lucky numbers. We all know that lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Petya wonders eagerly what minimum lucky number has the sum of digits equal to *n*. Help him cope with the task. | The single line contains an integer *n* (1<=≤<=*n*<=≤<=106) — the sum of digits of the required lucky number. | Print on the single line the result — the minimum lucky number, whose sum of digits equals *n*. If such number does not exist, print -1. | [
"11\n",
"10\n"
] | [
"47\n",
"-1\n"
] | none | 500 | [
{
"input": "11",
"output": "47"
},
{
"input": "10",
"output": "-1"
},
{
"input": "64",
"output": "4477777777"
},
{
"input": "1",
"output": "-1"
},
{
"input": "4",
"output": "4"
},
{
"input": "7",
"output": "7"
},
{
"input": "12",
"output": "444"
},
{
"input": "1000000",
"output": "4477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "47",
"output": "44477777"
},
{
"input": "100",
"output": "4444777777777777"
},
{
"input": "700",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "485",
"output": "44447777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "111",
"output": "444447777777777777"
},
{
"input": "85",
"output": "4477777777777"
},
{
"input": "114",
"output": "444477777777777777"
},
{
"input": "474",
"output": "444777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "74",
"output": "47777777777"
},
{
"input": "1000",
"output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "1024",
"output": "4444777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "4444",
"output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "45784",
"output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "10000",
"output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "9854",
"output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "186",
"output": "477777777777777777777777777"
},
{
"input": "10416",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "10417",
"output": "4477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "3840",
"output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "100000",
"output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "9876",
"output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "99999",
"output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "777777",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "854759",
"output": "4444447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "11000",
"output": "4444447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "18951",
"output": "4444777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "999999",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "888887",
"output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "999998",
"output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "40008",
"output": "4444447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "10691",
"output": "4444777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "5",
"output": "-1"
},
{
"input": "6",
"output": "-1"
},
{
"input": "9",
"output": "-1"
},
{
"input": "8",
"output": "44"
},
{
"input": "2",
"output": "-1"
},
{
"input": "3",
"output": "-1"
},
{
"input": "999997",
"output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "999996",
"output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "999990",
"output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "999980",
"output": "4444777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "800000",
"output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "980000",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
}
] | 1,620,451,374 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 92 | 6,656,000 | n = int(input())
if(n%4==0):
print("4"*(n//4))
elif(n%7==0):
print("4"*(n//4))
else:
c=0
while(n>0):
n-=4
c+=1
if(n%7==0):
print("4"*c + "7"*(n//7))
exit(0)
print(-1) | Title: Lucky Sum of Digits
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Petya loves lucky numbers. We all know that lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Petya wonders eagerly what minimum lucky number has the sum of digits equal to *n*. Help him cope with the task.
Input Specification:
The single line contains an integer *n* (1<=≤<=*n*<=≤<=106) — the sum of digits of the required lucky number.
Output Specification:
Print on the single line the result — the minimum lucky number, whose sum of digits equals *n*. If such number does not exist, print -1.
Demo Input:
['11\n', '10\n']
Demo Output:
['47\n', '-1\n']
Note:
none | ```python
n = int(input())
if(n%4==0):
print("4"*(n//4))
elif(n%7==0):
print("4"*(n//4))
else:
c=0
while(n>0):
n-=4
c+=1
if(n%7==0):
print("4"*c + "7"*(n//7))
exit(0)
print(-1)
``` | 0 |
16 | B | Burglar and Matches | PROGRAMMING | 900 | [
"greedy",
"implementation",
"sortings"
] | B. Burglar and Matches | 0 | 64 | A burglar got into a matches warehouse and wants to steal as many matches as possible. In the warehouse there are *m* containers, in the *i*-th container there are *a**i* matchboxes, and each matchbox contains *b**i* matches. All the matchboxes are of the same size. The burglar's rucksack can hold *n* matchboxes exactly. Your task is to find out the maximum amount of matches that a burglar can carry away. He has no time to rearrange matches in the matchboxes, that's why he just chooses not more than *n* matchboxes so that the total amount of matches in them is maximal. | The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=2·108) and integer *m* (1<=≤<=*m*<=≤<=20). The *i*<=+<=1-th line contains a pair of numbers *a**i* and *b**i* (1<=≤<=*a**i*<=≤<=108,<=1<=≤<=*b**i*<=≤<=10). All the input numbers are integer. | Output the only number — answer to the problem. | [
"7 3\n5 10\n2 5\n3 6\n",
"3 3\n1 3\n2 2\n3 1\n"
] | [
"62\n",
"7\n"
] | none | 0 | [
{
"input": "7 3\n5 10\n2 5\n3 6",
"output": "62"
},
{
"input": "3 3\n1 3\n2 2\n3 1",
"output": "7"
},
{
"input": "1 1\n1 2",
"output": "2"
},
{
"input": "1 2\n1 9\n1 6",
"output": "9"
},
{
"input": "1 10\n1 1\n1 9\n1 3\n1 9\n1 7\n1 10\n1 4\n1 7\n1 3\n1 1",
"output": "10"
},
{
"input": "2 1\n2 1",
"output": "2"
},
{
"input": "2 2\n2 4\n1 4",
"output": "8"
},
{
"input": "2 3\n1 7\n1 2\n1 5",
"output": "12"
},
{
"input": "4 1\n2 2",
"output": "4"
},
{
"input": "4 2\n1 10\n4 4",
"output": "22"
},
{
"input": "4 3\n1 4\n6 4\n1 7",
"output": "19"
},
{
"input": "5 1\n10 5",
"output": "25"
},
{
"input": "5 2\n3 9\n2 2",
"output": "31"
},
{
"input": "5 5\n2 9\n3 1\n2 1\n1 8\n2 8",
"output": "42"
},
{
"input": "5 10\n1 3\n1 2\n1 9\n1 10\n1 1\n1 5\n1 10\n1 2\n1 3\n1 7",
"output": "41"
},
{
"input": "10 1\n9 4",
"output": "36"
},
{
"input": "10 2\n14 3\n1 3",
"output": "30"
},
{
"input": "10 7\n4 8\n1 10\n1 10\n1 2\n3 3\n1 3\n1 10",
"output": "71"
},
{
"input": "10 10\n1 8\n2 10\n1 9\n1 1\n1 9\n1 6\n1 4\n2 5\n1 2\n1 4",
"output": "70"
},
{
"input": "10 4\n1 5\n5 2\n1 9\n3 3",
"output": "33"
},
{
"input": "100 5\n78 6\n29 10\n3 6\n7 3\n2 4",
"output": "716"
},
{
"input": "1000 7\n102 10\n23 6\n79 4\n48 1\n34 10\n839 8\n38 4",
"output": "8218"
},
{
"input": "10000 10\n336 2\n2782 5\n430 10\n1893 7\n3989 10\n2593 8\n165 6\n1029 2\n2097 4\n178 10",
"output": "84715"
},
{
"input": "100000 3\n2975 2\n35046 4\n61979 9",
"output": "703945"
},
{
"input": "1000000 4\n314183 9\n304213 4\n16864 5\n641358 9",
"output": "8794569"
},
{
"input": "10000000 10\n360313 10\n416076 1\n435445 9\n940322 7\n1647581 7\n4356968 10\n3589256 2\n2967933 5\n2747504 7\n1151633 3",
"output": "85022733"
},
{
"input": "100000000 7\n32844337 7\n11210848 7\n47655987 1\n33900472 4\n9174763 2\n32228738 10\n29947408 5",
"output": "749254060"
},
{
"input": "200000000 10\n27953106 7\n43325979 4\n4709522 1\n10975786 4\n67786538 8\n48901838 7\n15606185 6\n2747583 1\n100000000 1\n633331 3",
"output": "1332923354"
},
{
"input": "200000000 9\n17463897 9\n79520463 1\n162407 4\n41017993 8\n71054118 4\n9447587 2\n5298038 9\n3674560 7\n20539314 5",
"output": "996523209"
},
{
"input": "200000000 8\n6312706 6\n2920548 2\n16843192 3\n1501141 2\n13394704 6\n10047725 10\n4547663 6\n54268518 6",
"output": "630991750"
},
{
"input": "200000000 7\n25621043 2\n21865270 1\n28833034 1\n22185073 5\n100000000 2\n13891017 9\n61298710 8",
"output": "931584598"
},
{
"input": "200000000 6\n7465600 6\n8453505 10\n4572014 8\n8899499 3\n86805622 10\n64439238 6",
"output": "1447294907"
},
{
"input": "200000000 5\n44608415 6\n100000000 9\n51483223 9\n44136047 1\n52718517 1",
"output": "1634907859"
},
{
"input": "200000000 4\n37758556 10\n100000000 6\n48268521 3\n20148178 10",
"output": "1305347138"
},
{
"input": "200000000 3\n65170000 7\n20790088 1\n74616133 4",
"output": "775444620"
},
{
"input": "200000000 2\n11823018 6\n100000000 9",
"output": "970938108"
},
{
"input": "200000000 1\n100000000 6",
"output": "600000000"
},
{
"input": "200000000 10\n12097724 9\n41745972 5\n26982098 9\n14916995 7\n21549986 7\n3786630 9\n8050858 7\n27994924 4\n18345001 5\n8435339 5",
"output": "1152034197"
},
{
"input": "200000000 10\n55649 8\n10980981 9\n3192542 8\n94994808 4\n3626106 1\n100000000 6\n5260110 9\n4121453 2\n15125061 4\n669569 6",
"output": "1095537357"
},
{
"input": "10 20\n1 7\n1 7\n1 8\n1 3\n1 10\n1 7\n1 7\n1 9\n1 3\n1 1\n1 2\n1 1\n1 3\n1 10\n1 9\n1 8\n1 8\n1 6\n1 7\n1 5",
"output": "83"
},
{
"input": "10000000 20\n4594 7\n520836 8\n294766 6\n298672 4\n142253 6\n450626 1\n1920034 9\n58282 4\n1043204 1\n683045 1\n1491746 5\n58420 4\n451217 2\n129423 4\n246113 5\n190612 8\n912923 6\n473153 6\n783733 6\n282411 10",
"output": "54980855"
},
{
"input": "200000000 20\n15450824 5\n839717 10\n260084 8\n1140850 8\n28744 6\n675318 3\n25161 2\n5487 3\n6537698 9\n100000000 5\n7646970 9\n16489 6\n24627 3\n1009409 5\n22455 1\n25488456 4\n484528 9\n32663641 3\n750968 4\n5152 6",
"output": "939368573"
},
{
"input": "200000000 20\n16896 2\n113 3\n277 2\n299 7\n69383562 2\n3929 8\n499366 4\n771846 5\n9 4\n1278173 7\n90 2\n54 7\n72199858 10\n17214 5\n3 10\n1981618 3\n3728 2\n141 8\n2013578 9\n51829246 5",
"output": "1158946383"
},
{
"input": "200000000 20\n983125 2\n7453215 9\n9193588 2\n11558049 7\n28666199 1\n34362244 1\n5241493 5\n15451270 4\n19945845 8\n6208681 3\n38300385 7\n6441209 8\n21046742 7\n577198 10\n3826434 8\n9764276 8\n6264675 7\n8567063 3\n3610303 4\n2908232 3",
"output": "1131379312"
},
{
"input": "10 15\n1 6\n2 6\n3 4\n1 3\n1 2\n1 5\n1 6\n1 2\n2 9\n1 10\n1 3\n1 7\n1 8\n1 2\n2 9",
"output": "79"
},
{
"input": "10000000 15\n111 5\n914124 3\n3 9\n177790 1\n2352 3\n32138 9\n104477 1\n1223 4\n18 6\n6655580 4\n57643 10\n94309 2\n37 1\n227002 10\n1733193 7",
"output": "45116295"
},
{
"input": "200000000 15\n7069868 1\n5567826 8\n2310059 10\n13539782 7\n38420939 4\n29911411 8\n52256316 1\n12265839 9\n2074265 1\n24896428 9\n72470695 5\n3236301 1\n3890243 2\n65168965 8\n65724 6",
"output": "1489289257"
},
{
"input": "200000000 15\n12044094 7\n2475138 10\n944451 7\n4854766 2\n3809145 10\n7727571 2\n43908937 6\n2745883 1\n427511 2\n100000000 5\n190914 6\n554889 3\n288798 4\n1848572 5\n893874 3",
"output": "961871671"
},
{
"input": "200000000 15\n6334191 7\n1927941 4\n5175933 10\n468389 1\n433043 10\n6863198 5\n7480646 4\n14774279 10\n2921129 8\n18325627 7\n6973152 9\n8277324 9\n21522856 2\n2058070 1\n2444742 4",
"output": "664376069"
}
] | 1,651,302,791 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 6 | 62 | 102,400 | from collections import Counter
n, m = map(int,input().split())
p = Counter()
while m > 0:
a,b = map(int,input().split())
p[b] = a
m -= 1
s = 0
while n > 0:
mx = max(p)
if p[mx] > 0:
s += mx
p[mx] -= 1
n -= 1
else:
p.pop(mx)
# if p[mx] == 0:
# break
print(s)
| Title: Burglar and Matches
Time Limit: 0 seconds
Memory Limit: 64 megabytes
Problem Description:
A burglar got into a matches warehouse and wants to steal as many matches as possible. In the warehouse there are *m* containers, in the *i*-th container there are *a**i* matchboxes, and each matchbox contains *b**i* matches. All the matchboxes are of the same size. The burglar's rucksack can hold *n* matchboxes exactly. Your task is to find out the maximum amount of matches that a burglar can carry away. He has no time to rearrange matches in the matchboxes, that's why he just chooses not more than *n* matchboxes so that the total amount of matches in them is maximal.
Input Specification:
The first line of the input contains integer *n* (1<=≤<=*n*<=≤<=2·108) and integer *m* (1<=≤<=*m*<=≤<=20). The *i*<=+<=1-th line contains a pair of numbers *a**i* and *b**i* (1<=≤<=*a**i*<=≤<=108,<=1<=≤<=*b**i*<=≤<=10). All the input numbers are integer.
Output Specification:
Output the only number — answer to the problem.
Demo Input:
['7 3\n5 10\n2 5\n3 6\n', '3 3\n1 3\n2 2\n3 1\n']
Demo Output:
['62\n', '7\n']
Note:
none | ```python
from collections import Counter
n, m = map(int,input().split())
p = Counter()
while m > 0:
a,b = map(int,input().split())
p[b] = a
m -= 1
s = 0
while n > 0:
mx = max(p)
if p[mx] > 0:
s += mx
p[mx] -= 1
n -= 1
else:
p.pop(mx)
# if p[mx] == 0:
# break
print(s)
``` | -1 |
295 | B | Greg and Graph | PROGRAMMING | 1,700 | [
"dp",
"graphs",
"shortest paths"
] | null | null | Greg has a weighed directed graph, consisting of *n* vertices. In this graph any pair of distinct vertices has an edge between them in both directions. Greg loves playing with the graph and now he has invented a new game:
- The game consists of *n* steps. - On the *i*-th step Greg removes vertex number *x**i* from the graph. As Greg removes a vertex, he also removes all the edges that go in and out of this vertex. - Before executing each step, Greg wants to know the sum of lengths of the shortest paths between all pairs of the remaining vertices. The shortest path can go through any remaining vertex. In other words, if we assume that *d*(*i*,<=*v*,<=*u*) is the shortest path between vertices *v* and *u* in the graph that formed before deleting vertex *x**i*, then Greg wants to know the value of the following sum: .
Help Greg, print the value of the required sum before each step. | The first line contains integer *n* (1<=≤<=*n*<=≤<=500) — the number of vertices in the graph.
Next *n* lines contain *n* integers each — the graph adjacency matrix: the *j*-th number in the *i*-th line *a**ij* (1<=≤<=*a**ij*<=≤<=105,<=*a**ii*<==<=0) represents the weight of the edge that goes from vertex *i* to vertex *j*.
The next line contains *n* distinct integers: *x*1,<=*x*2,<=...,<=*x**n* (1<=≤<=*x**i*<=≤<=*n*) — the vertices that Greg deletes. | Print *n* integers — the *i*-th number equals the required sum before the *i*-th step.
Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams of the %I64d specifier. | [
"1\n0\n1\n",
"2\n0 5\n4 0\n1 2\n",
"4\n0 3 1 1\n6 0 400 1\n2 4 0 1\n1 1 1 0\n4 1 2 3\n"
] | [
"0 ",
"9 0 ",
"17 23 404 0 "
] | none | 1,000 | [
{
"input": "1\n0\n1",
"output": "0 "
},
{
"input": "2\n0 5\n4 0\n1 2",
"output": "9 0 "
},
{
"input": "4\n0 3 1 1\n6 0 400 1\n2 4 0 1\n1 1 1 0\n4 1 2 3",
"output": "17 23 404 0 "
},
{
"input": "4\n0 57148 51001 13357\n71125 0 98369 67226\n49388 90852 0 66291\n39573 38165 97007 0\n2 3 1 4",
"output": "723897 306638 52930 0 "
},
{
"input": "5\n0 27799 15529 16434 44291\n47134 0 90227 26873 52252\n41605 21269 0 9135 55784\n70744 17563 79061 0 73981\n70529 35681 91073 52031 0\n5 2 3 1 4",
"output": "896203 429762 232508 87178 0 "
},
{
"input": "6\n0 72137 71041 29217 96749 46417\n40199 0 55907 57677 68590 78796\n83463 50721 0 30963 31779 28646\n94529 47831 98222 0 61665 73941\n24397 66286 2971 81613 0 52501\n26285 3381 51438 45360 20160 0\n6 3 2 4 5 1",
"output": "1321441 1030477 698557 345837 121146 0 "
},
{
"input": "7\n0 34385 31901 51111 10191 14089 95685\n11396 0 8701 33277 1481 517 46253\n51313 2255 0 5948 66085 37201 65310\n21105 60985 10748 0 89271 42883 77345\n34686 29401 73565 47795 0 13793 66997\n70279 49576 62900 40002 70943 0 89601\n65045 1681 28239 12023 40414 89585 0\n3 5 7 6 1 2 4",
"output": "1108867 1016339 729930 407114 206764 94262 0 "
},
{
"input": "8\n0 74961 47889 4733 72876 21399 63105 48239\n15623 0 9680 89133 57989 63401 26001 29608\n42369 82390 0 32866 46171 11871 67489 54070\n23425 80027 18270 0 28105 42657 40876 29267\n78793 18701 7655 94798 0 88885 71424 86914\n44835 76636 11553 46031 13617 0 16971 51915\n33037 53719 43116 52806 56897 71241 0 11629\n2119 62373 93265 69513 5770 90751 36619 0\n3 7 6 5 8 1 2 4",
"output": "1450303 1188349 900316 531281 383344 219125 169160 0 "
},
{
"input": "9\n0 85236 27579 82251 69479 24737 87917 15149 52311\n59640 0 74687 34711 3685 30121 4961 7552 83399\n33376 68733 0 81357 18042 74297 15466 29476 5865\n7493 5601 3321 0 20263 55901 45756 55361 87633\n26751 17161 76681 40376 0 39745 50717 56887 90055\n18885 76353 47089 43601 21561 0 60571 33551 53753\n74595 877 71853 93156 97499 70876 0 22713 63961\n67725 25309 56358 92376 40641 35433 39781 0 97482\n81818 12561 85961 81445 3941 76799 31701 43725 0\n6 2 9 3 5 7 1 4 8",
"output": "2106523 1533575 1645151 1255230 946667 618567 287636 147737 0 "
}
] | 1,682,487,385 | 2,147,483,647 | PyPy 3-64 | TIME_LIMIT_EXCEEDED | TESTS | 13 | 3,000 | 8,499,200 | import sys
n = int(sys.stdin.readline())
dis = [[1 << 31] * (n + 1) for _ in range(n + 1)]
for i in range(1, n + 1):
w = map(int, sys.stdin.readline().split())
for j, v in enumerate(w):
dis[i][j + 1] = v
permutation = [0] + list(map(int, sys.stdin.readline().split()))
st = [False] * (n + 1)
sum = [0] * (n + 1)
for k in range(n, 0, -1):
p = permutation[k]
st[p] = True
for i in range(1, n + 1):
for j in range(1, n + 1):
dis[i][j] = min(dis[i][j], dis[i][p] + dis[p][j])
for i in range(1, n + 1):
for j in range(1, n + 1):
if st[i] == True and st[j] == True:
sum[k] += dis[i][j]
for i in range(1, n + 1):
print(sum[i], end = ' ') | Title: Greg and Graph
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Greg has a weighed directed graph, consisting of *n* vertices. In this graph any pair of distinct vertices has an edge between them in both directions. Greg loves playing with the graph and now he has invented a new game:
- The game consists of *n* steps. - On the *i*-th step Greg removes vertex number *x**i* from the graph. As Greg removes a vertex, he also removes all the edges that go in and out of this vertex. - Before executing each step, Greg wants to know the sum of lengths of the shortest paths between all pairs of the remaining vertices. The shortest path can go through any remaining vertex. In other words, if we assume that *d*(*i*,<=*v*,<=*u*) is the shortest path between vertices *v* and *u* in the graph that formed before deleting vertex *x**i*, then Greg wants to know the value of the following sum: .
Help Greg, print the value of the required sum before each step.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=500) — the number of vertices in the graph.
Next *n* lines contain *n* integers each — the graph adjacency matrix: the *j*-th number in the *i*-th line *a**ij* (1<=≤<=*a**ij*<=≤<=105,<=*a**ii*<==<=0) represents the weight of the edge that goes from vertex *i* to vertex *j*.
The next line contains *n* distinct integers: *x*1,<=*x*2,<=...,<=*x**n* (1<=≤<=*x**i*<=≤<=*n*) — the vertices that Greg deletes.
Output Specification:
Print *n* integers — the *i*-th number equals the required sum before the *i*-th step.
Please, do not use the %lld specifier to read or write 64-bit integers in C++. It is preferred to use the cin, cout streams of the %I64d specifier.
Demo Input:
['1\n0\n1\n', '2\n0 5\n4 0\n1 2\n', '4\n0 3 1 1\n6 0 400 1\n2 4 0 1\n1 1 1 0\n4 1 2 3\n']
Demo Output:
['0 ', '9 0 ', '17 23 404 0 ']
Note:
none | ```python
import sys
n = int(sys.stdin.readline())
dis = [[1 << 31] * (n + 1) for _ in range(n + 1)]
for i in range(1, n + 1):
w = map(int, sys.stdin.readline().split())
for j, v in enumerate(w):
dis[i][j + 1] = v
permutation = [0] + list(map(int, sys.stdin.readline().split()))
st = [False] * (n + 1)
sum = [0] * (n + 1)
for k in range(n, 0, -1):
p = permutation[k]
st[p] = True
for i in range(1, n + 1):
for j in range(1, n + 1):
dis[i][j] = min(dis[i][j], dis[i][p] + dis[p][j])
for i in range(1, n + 1):
for j in range(1, n + 1):
if st[i] == True and st[j] == True:
sum[k] += dis[i][j]
for i in range(1, n + 1):
print(sum[i], end = ' ')
``` | 0 |
|
542 | C | Idempotent functions | PROGRAMMING | 2,000 | [
"constructive algorithms",
"graphs",
"math"
] | null | null | Some time ago Leonid have known about idempotent functions. Idempotent function defined on a set {1,<=2,<=...,<=*n*} is such function , that for any the formula *g*(*g*(*x*))<==<=*g*(*x*) holds.
Let's denote as *f*(*k*)(*x*) the function *f* applied *k* times to the value *x*. More formally, *f*(1)(*x*)<==<=*f*(*x*), *f*(*k*)(*x*)<==<=*f*(*f*(*k*<=-<=1)(*x*)) for each *k*<=><=1.
You are given some function . Your task is to find minimum positive integer *k* such that function *f*(*k*)(*x*) is idempotent. | In the first line of the input there is a single integer *n* (1<=≤<=*n*<=≤<=200) — the size of function *f* domain.
In the second line follow *f*(1),<=*f*(2),<=...,<=*f*(*n*) (1<=≤<=*f*(*i*)<=≤<=*n* for each 1<=≤<=*i*<=≤<=*n*), the values of a function. | Output minimum *k* such that function *f*(*k*)(*x*) is idempotent. | [
"4\n1 2 2 4\n",
"3\n2 3 3\n",
"3\n2 3 1\n"
] | [
"1\n",
"2\n",
"3\n"
] | In the first sample test function *f*(*x*) = *f*<sup class="upper-index">(1)</sup>(*x*) is already idempotent since *f*(*f*(1)) = *f*(1) = 1, *f*(*f*(2)) = *f*(2) = 2, *f*(*f*(3)) = *f*(3) = 2, *f*(*f*(4)) = *f*(4) = 4.
In the second sample test:
- function *f*(*x*) = *f*<sup class="upper-index">(1)</sup>(*x*) isn't idempotent because *f*(*f*(1)) = 3 but *f*(1) = 2; - function *f*(*x*) = *f*<sup class="upper-index">(2)</sup>(*x*) is idempotent since for any *x* it is true that *f*<sup class="upper-index">(2)</sup>(*x*) = 3, so it is also true that *f*<sup class="upper-index">(2)</sup>(*f*<sup class="upper-index">(2)</sup>(*x*)) = 3.
In the third sample test:
- function *f*(*x*) = *f*<sup class="upper-index">(1)</sup>(*x*) isn't idempotent because *f*(*f*(1)) = 3 but *f*(1) = 2; - function *f*(*f*(*x*)) = *f*<sup class="upper-index">(2)</sup>(*x*) isn't idempotent because *f*<sup class="upper-index">(2)</sup>(*f*<sup class="upper-index">(2)</sup>(1)) = 2 but *f*<sup class="upper-index">(2)</sup>(1) = 3; - function *f*(*f*(*f*(*x*))) = *f*<sup class="upper-index">(3)</sup>(*x*) is idempotent since it is identity function: *f*<sup class="upper-index">(3)</sup>(*x*) = *x* for any <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/46a8c73444c646004dfde04451775e7af924d108.png" style="max-width: 100.0%;max-height: 100.0%;"/> meaning that the formula *f*<sup class="upper-index">(3)</sup>(*f*<sup class="upper-index">(3)</sup>(*x*)) = *f*<sup class="upper-index">(3)</sup>(*x*) also holds. | 750 | [
{
"input": "4\n1 2 2 4",
"output": "1"
},
{
"input": "3\n2 3 3",
"output": "2"
},
{
"input": "3\n2 3 1",
"output": "3"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "16\n1 4 13 9 11 16 14 6 5 12 7 8 15 2 3 10",
"output": "105"
},
{
"input": "20\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20",
"output": "1"
},
{
"input": "20\n11 14 2 10 17 5 9 6 18 3 17 7 4 15 17 1 4 14 10 11",
"output": "7"
},
{
"input": "100\n46 7 63 48 75 82 85 90 65 23 36 96 96 29 76 67 26 2 72 76 18 30 48 98 100 61 55 74 18 28 36 89 4 65 94 48 53 19 66 77 91 35 94 97 19 45 82 56 11 23 24 51 62 85 25 11 68 19 57 92 53 31 36 28 70 36 62 78 19 10 12 35 46 74 31 79 15 98 15 80 24 59 98 96 92 1 92 16 13 73 99 100 76 52 52 40 85 54 49 89",
"output": "24"
},
{
"input": "100\n61 41 85 52 22 82 98 25 60 35 67 78 65 69 55 86 34 91 92 36 24 2 26 15 76 99 4 95 79 31 13 16 100 83 21 90 73 32 19 33 77 40 72 62 88 43 84 14 10 9 46 70 23 45 42 96 94 38 97 58 47 93 59 51 57 7 27 74 1 30 64 3 63 49 50 54 5 37 48 11 81 44 12 17 75 71 89 39 56 20 6 8 53 28 80 66 29 87 18 68",
"output": "14549535"
},
{
"input": "2\n1 2",
"output": "1"
},
{
"input": "2\n1 1",
"output": "1"
},
{
"input": "2\n2 2",
"output": "1"
},
{
"input": "2\n2 1",
"output": "2"
},
{
"input": "5\n2 1 2 3 4",
"output": "4"
},
{
"input": "3\n2 1 2",
"output": "2"
},
{
"input": "4\n2 1 2 3",
"output": "2"
},
{
"input": "6\n2 1 2 3 4 5",
"output": "4"
},
{
"input": "4\n2 3 1 1",
"output": "3"
},
{
"input": "5\n2 3 1 1 4",
"output": "3"
},
{
"input": "6\n2 3 1 1 4 5",
"output": "3"
},
{
"input": "7\n2 3 1 1 4 5 6",
"output": "6"
},
{
"input": "8\n2 3 1 1 4 5 6 7",
"output": "6"
},
{
"input": "142\n131 32 130 139 5 11 36 2 39 92 111 91 8 14 65 82 90 72 140 80 26 124 97 15 43 77 58 132 21 68 31 45 6 69 70 79 141 27 125 78 93 88 115 104 17 55 86 28 56 117 121 136 12 59 85 95 74 18 87 22 106 112 60 119 81 66 52 14 25 127 29 103 24 48 126 30 120 107 51 47 133 129 96 138 113 37 64 114 53 73 108 62 1 123 63 57 142 76 16 4 35 54 19 110 42 116 7 10 118 9 71 49 75 23 89 99 3 137 38 98 61 128 102 13 122 33 50 94 100 105 109 134 40 20 135 46 34 41 83 67 44 84",
"output": "137"
},
{
"input": "142\n34 88 88 88 88 88 131 53 88 130 131 88 88 130 88 131 53 130 130 34 88 88 131 130 53 88 88 34 131 130 88 131 130 34 130 53 53 34 53 34 130 34 88 88 130 88 131 130 34 53 88 34 53 88 130 53 34 53 88 131 130 34 88 88 130 88 130 130 131 131 130 53 131 130 131 130 53 34 131 34 88 53 88 53 34 130 88 88 130 53 130 34 131 130 53 131 130 88 130 131 53 130 34 130 88 53 88 88 53 88 34 131 88 131 130 53 130 130 53 130 88 88 131 53 88 53 53 34 53 130 131 130 34 131 34 53 130 88 34 34 53 34",
"output": "1"
},
{
"input": "142\n25 46 7 30 112 34 76 5 130 122 7 132 54 82 139 97 79 112 79 79 112 43 25 50 118 112 87 11 51 30 90 56 119 46 9 81 5 103 78 18 49 37 43 129 124 90 109 6 31 50 90 20 79 99 130 31 131 62 50 84 5 34 6 41 79 112 9 30 141 114 34 11 46 92 97 30 95 112 24 24 74 121 65 31 127 28 140 30 79 90 9 10 56 88 9 65 128 79 56 37 109 37 30 95 37 105 3 102 120 18 28 90 107 29 128 137 59 62 62 77 34 43 26 5 99 97 44 130 115 130 130 47 83 53 77 80 131 79 28 98 10 52",
"output": "8"
},
{
"input": "142\n138 102 2 111 17 64 25 11 3 90 118 120 46 33 131 87 119 9 72 141 62 116 44 136 81 122 93 106 123 62 35 17 98 49 46 124 32 67 93 90 91 99 36 46 138 5 52 73 139 2 11 97 6 9 47 56 134 134 112 90 94 55 97 98 118 37 109 31 132 58 95 98 76 76 63 7 110 28 133 50 46 136 115 57 113 55 4 96 63 66 9 52 107 17 95 78 95 118 69 105 18 10 52 94 29 36 113 86 132 39 77 42 113 116 135 93 136 39 48 119 124 35 10 133 138 45 78 107 132 130 49 28 73 85 135 4 119 38 78 116 108 125",
"output": "20"
},
{
"input": "9\n7 3 8 9 9 3 5 3 2",
"output": "6"
},
{
"input": "5\n2 1 4 5 3",
"output": "6"
},
{
"input": "7\n2 3 4 5 6 7 6",
"output": "6"
},
{
"input": "129\n2 1 4 5 3 7 8 9 10 6 12 13 14 15 16 17 11 19 20 21 22 23 24 25 26 27 28 18 30 31 32 33 34 35 36 37 38 39 40 41 29 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 42 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 59 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 78 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 101",
"output": "6469693230"
},
{
"input": "4\n2 3 4 1",
"output": "4"
}
] | 1,430,670,997 | 2,197 | Python 3 | OK | TESTS | 65 | 93 | 0 | N =int(input())
inp =input().split()
F =[0 for i in range(N)]
for i in range(N): F[i] =int(inp[i])-1
ans_small =[0 for i in range(N+1)]
for i in range(N):
x =i
y =i
for j in range(N):
x =F[x]
y =F[F[y]]
if x == y:
ans_small[j+1] +=1
ans =-1
for i in range(1,N+1):
if ans == -1:
if ans_small[i] == N:
ans =i
#dlhe
pw =[0 for i in range(500)]
for i in range(N):
vis =[False for j in range(N)]
vis[i] =True
x =F[i]
while vis[x] == False:
vis[x] =True
x =F[x]
vis2 =[False for j in range(N)]
vis2[x] =True
x =F[x]
while vis2[x] == False:
vis2[x] =True
x =F[x]
c =0
for j in range(N):
if vis2[j]: c +=1
j =2
while j <= c:
p =0
while c%j == 0:
c //=j
p +=1
pw[j] =max(pw[j],p)
j +=1
if ans == -1:
ans =1
for i in range(1,500):
for j in range(pw[i]):
ans *=i
ans0 =ans
while ans <= N:
ans +=ans0
print(ans) | Title: Idempotent functions
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Some time ago Leonid have known about idempotent functions. Idempotent function defined on a set {1,<=2,<=...,<=*n*} is such function , that for any the formula *g*(*g*(*x*))<==<=*g*(*x*) holds.
Let's denote as *f*(*k*)(*x*) the function *f* applied *k* times to the value *x*. More formally, *f*(1)(*x*)<==<=*f*(*x*), *f*(*k*)(*x*)<==<=*f*(*f*(*k*<=-<=1)(*x*)) for each *k*<=><=1.
You are given some function . Your task is to find minimum positive integer *k* such that function *f*(*k*)(*x*) is idempotent.
Input Specification:
In the first line of the input there is a single integer *n* (1<=≤<=*n*<=≤<=200) — the size of function *f* domain.
In the second line follow *f*(1),<=*f*(2),<=...,<=*f*(*n*) (1<=≤<=*f*(*i*)<=≤<=*n* for each 1<=≤<=*i*<=≤<=*n*), the values of a function.
Output Specification:
Output minimum *k* such that function *f*(*k*)(*x*) is idempotent.
Demo Input:
['4\n1 2 2 4\n', '3\n2 3 3\n', '3\n2 3 1\n']
Demo Output:
['1\n', '2\n', '3\n']
Note:
In the first sample test function *f*(*x*) = *f*<sup class="upper-index">(1)</sup>(*x*) is already idempotent since *f*(*f*(1)) = *f*(1) = 1, *f*(*f*(2)) = *f*(2) = 2, *f*(*f*(3)) = *f*(3) = 2, *f*(*f*(4)) = *f*(4) = 4.
In the second sample test:
- function *f*(*x*) = *f*<sup class="upper-index">(1)</sup>(*x*) isn't idempotent because *f*(*f*(1)) = 3 but *f*(1) = 2; - function *f*(*x*) = *f*<sup class="upper-index">(2)</sup>(*x*) is idempotent since for any *x* it is true that *f*<sup class="upper-index">(2)</sup>(*x*) = 3, so it is also true that *f*<sup class="upper-index">(2)</sup>(*f*<sup class="upper-index">(2)</sup>(*x*)) = 3.
In the third sample test:
- function *f*(*x*) = *f*<sup class="upper-index">(1)</sup>(*x*) isn't idempotent because *f*(*f*(1)) = 3 but *f*(1) = 2; - function *f*(*f*(*x*)) = *f*<sup class="upper-index">(2)</sup>(*x*) isn't idempotent because *f*<sup class="upper-index">(2)</sup>(*f*<sup class="upper-index">(2)</sup>(1)) = 2 but *f*<sup class="upper-index">(2)</sup>(1) = 3; - function *f*(*f*(*f*(*x*))) = *f*<sup class="upper-index">(3)</sup>(*x*) is idempotent since it is identity function: *f*<sup class="upper-index">(3)</sup>(*x*) = *x* for any <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/46a8c73444c646004dfde04451775e7af924d108.png" style="max-width: 100.0%;max-height: 100.0%;"/> meaning that the formula *f*<sup class="upper-index">(3)</sup>(*f*<sup class="upper-index">(3)</sup>(*x*)) = *f*<sup class="upper-index">(3)</sup>(*x*) also holds. | ```python
N =int(input())
inp =input().split()
F =[0 for i in range(N)]
for i in range(N): F[i] =int(inp[i])-1
ans_small =[0 for i in range(N+1)]
for i in range(N):
x =i
y =i
for j in range(N):
x =F[x]
y =F[F[y]]
if x == y:
ans_small[j+1] +=1
ans =-1
for i in range(1,N+1):
if ans == -1:
if ans_small[i] == N:
ans =i
#dlhe
pw =[0 for i in range(500)]
for i in range(N):
vis =[False for j in range(N)]
vis[i] =True
x =F[i]
while vis[x] == False:
vis[x] =True
x =F[x]
vis2 =[False for j in range(N)]
vis2[x] =True
x =F[x]
while vis2[x] == False:
vis2[x] =True
x =F[x]
c =0
for j in range(N):
if vis2[j]: c +=1
j =2
while j <= c:
p =0
while c%j == 0:
c //=j
p +=1
pw[j] =max(pw[j],p)
j +=1
if ans == -1:
ans =1
for i in range(1,500):
for j in range(pw[i]):
ans *=i
ans0 =ans
while ans <= N:
ans +=ans0
print(ans)
``` | 3 |
|
227 | B | Effective Approach | PROGRAMMING | 1,100 | [
"implementation"
] | null | null | Once at a team training Vasya, Petya and Sasha got a problem on implementing linear search in an array.
According to the boys, linear search works as follows. The array elements in a pre-selected order are in turn compared with the number that you need to find. Once you find the array element that is equal to the required one, the search ends. The efficiency of the algorithm is the number of performed comparisons. The fewer comparisons the linear search has made, the more effective it is.
Vasya believes that a linear search would work better if it sequentially iterates through the elements, starting with the 1-st one (in this problem we consider the elements of the array indexed from 1 to *n*) and ending with the *n*-th one. And Petya says that Vasya is wrong: the search will need less comparisons if it sequentially iterates the elements starting from the *n*-th and ending with the 1-st one. Sasha argues that the two approaches are equivalent.
To finally begin the task, the teammates decided to settle the debate and compare the two approaches on an example. For this, they took an array that is a permutation of integers from 1 to *n*, and generated *m* queries of the form: find element with value *b**i* in the array. They want to calculate for both approaches how many comparisons in total the linear search will need to respond to all queries. If the first search needs fewer comparisons, then the winner of the dispute is Vasya. If the second one does, then the winner is Petya. If both approaches make the same number of comparisons, then Sasha's got the upper hand.
But the problem is, linear search is too slow. That's why the boys aren't going to find out who is right before the end of the training, unless you come in here. Help them to determine who will win the dispute. | The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of elements in the array. The second line contains *n* distinct space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — the elements of array.
The third line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of queries. The last line contains *m* space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=*n*) — the search queries. Note that the queries can repeat. | Print two integers, showing how many comparisons Vasya's approach needs and how many comparisons Petya's approach needs. Separate the numbers by spaces.
Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use cin, cout streams or the %I64d specifier. | [
"2\n1 2\n1\n1\n",
"2\n2 1\n1\n1\n",
"3\n3 1 2\n3\n1 2 3\n"
] | [
"1 2\n",
"2 1\n",
"6 6\n"
] | In the first sample Vasya's approach will make one comparison (it starts with the 1-st element and immediately finds the required number), and Petya's approach makes two comparisons (first he compares with the 2-nd array element, doesn't find the search item and compares with the 1-st element).
In the second sample, on the contrary, Vasya's approach will need two comparisons (first with 1-st element, and then with the 2-nd), and Petya's approach will find the required value in one comparison (the first comparison with the 2-nd element). | 1,000 | [
{
"input": "2\n1 2\n1\n1",
"output": "1 2"
},
{
"input": "2\n2 1\n1\n1",
"output": "2 1"
},
{
"input": "3\n3 1 2\n3\n1 2 3",
"output": "6 6"
},
{
"input": "9\n2 9 3 1 6 4 7 8 5\n9\n5 1 5 2 8 4 4 4 5",
"output": "58 32"
},
{
"input": "10\n3 10 9 2 7 6 5 8 4 1\n1\n4",
"output": "9 2"
},
{
"input": "10\n5 2 10 8 3 1 9 7 6 4\n9\n2 5 9 2 3 2 5 9 8",
"output": "31 68"
},
{
"input": "9\n3 8 4 7 1 2 5 6 9\n3\n2 7 1",
"output": "15 15"
},
{
"input": "9\n5 3 8 4 2 6 1 7 9\n4\n6 1 9 2",
"output": "27 13"
},
{
"input": "4\n1 3 2 4\n4\n3 1 2 3",
"output": "8 12"
},
{
"input": "3\n1 2 3\n8\n3 2 1 1 2 3 1 2",
"output": "15 17"
}
] | 1,685,428,630 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 5 | 2,000 | 12,083,200 | n = int(input())
l1 = list(map(int, input().split()))
l2 = l1[::-1]
#print(l1, l2)
m = int(input())
ml = list(map(int, input().split()))
count1 = 0
count2 = 0
for i in ml:
count1 += l1.index(i) + 1
count2 += l2.index(i) + 1
print(count1, count2) | Title: Effective Approach
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Once at a team training Vasya, Petya and Sasha got a problem on implementing linear search in an array.
According to the boys, linear search works as follows. The array elements in a pre-selected order are in turn compared with the number that you need to find. Once you find the array element that is equal to the required one, the search ends. The efficiency of the algorithm is the number of performed comparisons. The fewer comparisons the linear search has made, the more effective it is.
Vasya believes that a linear search would work better if it sequentially iterates through the elements, starting with the 1-st one (in this problem we consider the elements of the array indexed from 1 to *n*) and ending with the *n*-th one. And Petya says that Vasya is wrong: the search will need less comparisons if it sequentially iterates the elements starting from the *n*-th and ending with the 1-st one. Sasha argues that the two approaches are equivalent.
To finally begin the task, the teammates decided to settle the debate and compare the two approaches on an example. For this, they took an array that is a permutation of integers from 1 to *n*, and generated *m* queries of the form: find element with value *b**i* in the array. They want to calculate for both approaches how many comparisons in total the linear search will need to respond to all queries. If the first search needs fewer comparisons, then the winner of the dispute is Vasya. If the second one does, then the winner is Petya. If both approaches make the same number of comparisons, then Sasha's got the upper hand.
But the problem is, linear search is too slow. That's why the boys aren't going to find out who is right before the end of the training, unless you come in here. Help them to determine who will win the dispute.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of elements in the array. The second line contains *n* distinct space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — the elements of array.
The third line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of queries. The last line contains *m* space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=*n*) — the search queries. Note that the queries can repeat.
Output Specification:
Print two integers, showing how many comparisons Vasya's approach needs and how many comparisons Petya's approach needs. Separate the numbers by spaces.
Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use cin, cout streams or the %I64d specifier.
Demo Input:
['2\n1 2\n1\n1\n', '2\n2 1\n1\n1\n', '3\n3 1 2\n3\n1 2 3\n']
Demo Output:
['1 2\n', '2 1\n', '6 6\n']
Note:
In the first sample Vasya's approach will make one comparison (it starts with the 1-st element and immediately finds the required number), and Petya's approach makes two comparisons (first he compares with the 2-nd array element, doesn't find the search item and compares with the 1-st element).
In the second sample, on the contrary, Vasya's approach will need two comparisons (first with 1-st element, and then with the 2-nd), and Petya's approach will find the required value in one comparison (the first comparison with the 2-nd element). | ```python
n = int(input())
l1 = list(map(int, input().split()))
l2 = l1[::-1]
#print(l1, l2)
m = int(input())
ml = list(map(int, input().split()))
count1 = 0
count2 = 0
for i in ml:
count1 += l1.index(i) + 1
count2 += l2.index(i) + 1
print(count1, count2)
``` | 0 |
|
89 | E | Fire and Ice | PROGRAMMING | 2,900 | [
"greedy"
] | E. Fire and Ice | 0 | 256 | The Fire Lord attacked the Frost Kingdom. He has already got to the Ice Fortress, where the Snow Queen dwells. He arranged his army on a segment *n* in length not far from the city walls. And only the frost magician Solomon can save the Frost Kingdom.
The *n*-long segment is located at a distance equal exactly to 1 from the castle walls. It can be imaginarily divided into unit segments. On some of the unit segments fire demons are located — no more than one demon per position. Each demon is characterised by his strength - by some positive integer. We can regard the fire demons being idle.
Initially Solomon is positioned on the fortress wall. He can perform the following actions several times in a row:
- "L" — Solomon shifts one unit to the left. This movement cannot be performed on the castle wall.- "R" — Solomon shifts one unit to the left. This movement cannot be performed if there's no ice block to the right.- "A" — If there's nothing to the right of Solomon, then Solomon creates an ice block that immediately freezes to the block that Solomon is currently standing on. If there already is an ice block, then Solomon destroys it. At that the ice blocks to the right of the destroyed one can remain but they are left unsupported. Those ice blocks fall down.
Solomon spends exactly a second on each of these actions.
As the result of Solomon's actions, ice blocks' segments fall down. When an ice block falls on a fire demon, the block evaporates and the demon's strength is reduced by 1. When the demons' strength is equal to 0, the fire demon vanishes. The picture below shows how it happens. The ice block that falls on the position with no demon, breaks into lots of tiny pieces and vanishes without hurting anybody.
Help Solomon destroy all the Fire Lord's army in minimum time. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=1000). The next line contains *n* numbers, the *i*-th of them represents the strength of the fire demon standing of the *i*-th position, an integer from 1 to 100. If there's no demon on the *i*-th position, then the *i*-th number equals to 0. It is guaranteed that the input data have at least one fire demon. | Print a string of minimum length, containing characters "L", "R" and "A" — the succession of actions leading to the required result.
If there are several possible answers, print any of them. | [
"3\n1 0 1\n",
"3\n0 2 0\n"
] | [
"ARARARALLLA",
"ARARALAARALA"
] | none | 2,500 | [
{
"input": "3\n1 0 1",
"output": "ARARARALLLA"
},
{
"input": "3\n0 2 0",
"output": "ARARALAARALA"
},
{
"input": "5\n3 1 2 2 4",
"output": "ARALAARALAARARARARARALLLAARARARALAARALAARALLLLLA"
},
{
"input": "4\n2 2 2 2",
"output": "ARARARARALLLLAARARARARALLLLA"
},
{
"input": "7\n5 3 3 4 2 1 0",
"output": "ARARARARARALLLLLAARARARARALLLLAARALAARALAARARARARALAARARARALLLLLLA"
},
{
"input": "10\n0 0 0 0 0 0 0 1 1 0",
"output": "ARARARARARARARARARALLA"
},
{
"input": "17\n5 10 6 7 3 1 1 1 5 9 2 2 2 2 2 2 2",
"output": "ARARARARARALLLLLAARARARARARALLLLLAARARARARALLLLAARARARARALLLLAARARARARALLLAARALAARALAARALAARALAARARARALAARARARARARARARARARARARARARARALLLLLLLLLAARARALLAARARALLAARARALLAARARALAARALAARALAARALAARARARARARARARARALLLLLLLLLLLLLLLLLA"
},
{
"input": "1\n1",
"output": "ARALA"
},
{
"input": "1\n52",
"output": "ARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALA"
},
{
"input": "1\n100",
"output": "ARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALA"
},
{
"input": "2\n0 1",
"output": "ARARALA"
},
{
"input": "2\n1 0",
"output": "ARALA"
},
{
"input": "2\n1 1",
"output": "ARARALLA"
},
{
"input": "2\n0 100",
"output": "ARARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALA"
},
{
"input": "2\n100 0",
"output": "ARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALA"
},
{
"input": "2\n100 100",
"output": "ARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALLAARARALL..."
},
{
"input": "3\n1 0 100",
"output": "ARARARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALLLA"
},
{
"input": "3\n100 0 100",
"output": "ARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARARARALAARALAAR..."
},
{
"input": "3\n0 100 1",
"output": "ARARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARARALLA"
},
{
"input": "3\n1 100 1",
"output": "ARARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARALAARARALLLA"
},
{
"input": "9\n3 0 1 0 0 2 1 3 2",
"output": "ARALAARALAARARARARARARALAARARARARALLAARALAARARALLLLLLLLLA"
},
{
"input": "10\n1 1 1 6 5 9 9 9 5 2",
"output": "ARARARARARARARARARARALLLLLLLAARARARARARARALLLLLLAARARARARARARALLLLLLAARARARARARARALLLLLLAARALAARARARARARALLLAARARARALLLAARARARALLLAARARARALLLAARARARARARALLLLLLLLLLA"
},
{
"input": "58\n3 5 1 5 0 3 2 0 3 1 2 4 2 2 2 1 3 4 3 2 5 1 4 3 2 5 3 3 3 0 0 3 2 3 1 2 1 2 3 2 3 1 5 1 3 5 4 4 4 0 5 1 2 2 4 3 0 4",
"output": "ARARALLAARARALLAARARALAARALAARARARALAARALAARALAARALAARARARARALLAARALAARARARARALAARALAARARARARARARARALLLLLAARARALAARALAARARARARARARARARARARALLLLLAARARARALLLAARARALAARARARARALAARALAARALAARARARARARARARARARALLLLLLLAARARALLAARALAARARARARARARARALLLLAARALAARALAARARARARARARARARARALLLAARALAARARARALAARARARALAARARARARARARALLLLAARARALAARARARALAARARARALAARALAARALAARALAARARARARARARARALLLLLAARARARARARALLLLLAARARARARARALLLLAARALAARARARARARARALAARALAARALAARALAARARARARARARALLLLAARARARARALLAARALAARARARARALAARALAARALAARALLLLL..."
},
{
"input": "198\n0 6 6 9 9 9 1 7 15 3 4 10 15 10 12 0 6 14 15 11 15 3 15 10 11 10 9 2 7 8 2 15 7 15 2 5 8 9 12 2 12 8 11 14 14 13 3 10 8 0 7 4 4 12 9 5 2 3 1 5 11 3 3 0 0 10 11 15 0 15 2 3 6 12 2 6 14 3 15 1 15 14 7 8 1 10 11 9 9 6 14 4 7 12 7 10 5 4 15 13 5 4 12 13 1 9 1 11 8 13 1 1 6 2 13 7 9 0 12 11 2 0 1 5 3 7 0 12 6 13 14 15 10 5 15 6 2 2 0 8 12 8 11 10 7 3 3 11 12 4 3 3 12 9 0 8 8 12 0 2 5 1 9 10 3 1 14 14 3 2 14 15 4 2 11 1 13 14 10 4 4 14 4 12 4 8 15 3 1 4 5 10 12 7 3 11 15 8",
"output": "ARARARARARARALLLLLAARARARARARALLLLLAARARARARARALLLLLAARARARARARALLLLLAARARARARARALLLLLAARARARARARALLLAARARARALLLAARARARALLLAARARARARARARARARARARARARALLLLLLLLAARARARARARARARARALLLLLLLLAARARALLAARARALLAARARALLAARARALLAARARALAARALAARALAARALAARALAARALAARALAARALAARARARARARARARALLLLLAARARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARALAARALAARALAARALAARALAARARARALAARALAARARARARARARARARARARARARARARARARARARARARARARARARARARARARARARARARARARARALLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLLA..."
},
{
"input": "23\n99 100 99 100 100 100 100 99 100 99 99 100 100 100 99 99 100 100 100 99 99 99 99",
"output": "ARARARARARARARARARARARARARARARARARARARARARARARALLLLLLLLLLLLLLLLLLLLLLLAARARARARARARARARARARARARARARARARARARARARARARARALLLLLLLLLLLLLLLLLLLLLLLAARARARARARARARARARARARARARARARARARARARARARARARALLLLLLLLLLLLLLLLLLLLLLLAARARARARARARARARARARARARARARARARARARARARARARARALLLLLLLLLLLLLLLLLLLLLLLAARARARARARARARARARARARARARARARARARARARARARARARALLLLLLLLLLLLLLLLLLLLLLLAARARARARARARARARARARARARARARARARARARARARARARARALLLLLLLLLLLLLLLLLLLLLLLAARARARARARARARARARARARARARARARARARARARARARARARALLLLLLLLLLLLLLLLLLLLLLLAARARARARARARAR..."
},
{
"input": "2\n2 2",
"output": "ARARALLAARARALLA"
},
{
"input": "2\n1 2",
"output": "ARARALAARALLA"
},
{
"input": "2\n2 1",
"output": "ARALAARARALLA"
},
{
"input": "3\n1 2 1",
"output": "ARARALAARARALLLA"
},
{
"input": "7\n1 1 1 0 1 1 1",
"output": "ARARARARARARARALLLLLLLA"
},
{
"input": "8\n1 0 0 0 0 0 0 1",
"output": "ARALAARARARARARARARARALA"
},
{
"input": "10\n1 0 0 0 0 0 0 1 0 1",
"output": "ARALAARARARARARARARARARARALLLA"
},
{
"input": "20\n2 0 0 0 0 0 0 1 0 0 0 0 0 1 1 0 0 1 0 1",
"output": "ARALAARALAARARARARARARARARALAARARARARARARARARARARARARARALLLLLLLA"
},
{
"input": "20\n2 0 0 0 0 0 0 1 0 0 0 1 0 100 100 100 100 1 0 1",
"output": "ARALAARALAARARARARARARARARARARARARARARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLLAARARARARALLLL..."
},
{
"input": "20\n10 9 8 7 6 5 4 3 0 0 0 1 0 0 0 0 0 0 0 1",
"output": "ARARARARARARARARALLLLLLLLAARARARARARARARARALLLLLLLLAARARARARARARARALLLLLLLAARARARARARARALLLLLLAARARARARARALLLLLAARARARARALLLLAARARARALLLAARARALLAARALAARARARARARARARARARARARARARARARARARARARARALLLLLLLLLLLLLLLLLLLLA"
}
] | 1,690,486,658 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 0 | 46 | 0 | print("_RANDOM_GUESS_1690486657.947529")# 1690486657.9475489 | Title: Fire and Ice
Time Limit: 0 seconds
Memory Limit: 256 megabytes
Problem Description:
The Fire Lord attacked the Frost Kingdom. He has already got to the Ice Fortress, where the Snow Queen dwells. He arranged his army on a segment *n* in length not far from the city walls. And only the frost magician Solomon can save the Frost Kingdom.
The *n*-long segment is located at a distance equal exactly to 1 from the castle walls. It can be imaginarily divided into unit segments. On some of the unit segments fire demons are located — no more than one demon per position. Each demon is characterised by his strength - by some positive integer. We can regard the fire demons being idle.
Initially Solomon is positioned on the fortress wall. He can perform the following actions several times in a row:
- "L" — Solomon shifts one unit to the left. This movement cannot be performed on the castle wall.- "R" — Solomon shifts one unit to the left. This movement cannot be performed if there's no ice block to the right.- "A" — If there's nothing to the right of Solomon, then Solomon creates an ice block that immediately freezes to the block that Solomon is currently standing on. If there already is an ice block, then Solomon destroys it. At that the ice blocks to the right of the destroyed one can remain but they are left unsupported. Those ice blocks fall down.
Solomon spends exactly a second on each of these actions.
As the result of Solomon's actions, ice blocks' segments fall down. When an ice block falls on a fire demon, the block evaporates and the demon's strength is reduced by 1. When the demons' strength is equal to 0, the fire demon vanishes. The picture below shows how it happens. The ice block that falls on the position with no demon, breaks into lots of tiny pieces and vanishes without hurting anybody.
Help Solomon destroy all the Fire Lord's army in minimum time.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=1000). The next line contains *n* numbers, the *i*-th of them represents the strength of the fire demon standing of the *i*-th position, an integer from 1 to 100. If there's no demon on the *i*-th position, then the *i*-th number equals to 0. It is guaranteed that the input data have at least one fire demon.
Output Specification:
Print a string of minimum length, containing characters "L", "R" and "A" — the succession of actions leading to the required result.
If there are several possible answers, print any of them.
Demo Input:
['3\n1 0 1\n', '3\n0 2 0\n']
Demo Output:
['ARARARALLLA', 'ARARALAARALA']
Note:
none | ```python
print("_RANDOM_GUESS_1690486657.947529")# 1690486657.9475489
``` | 0 |