Datasets:

Mohamed-BC

/

Articles

like 0

Review: “Into the Spider-Verse” swings above and beyond

Review: “Into the Spider-Verse” swings above and beyond Sony Pictures Animation has closed out the year with far and away one of the best films they’ve ever made, though that may not sound like it’s saying much.. We may be more familiar with the studio as the culprits of the notorious Emoji Movie and the live-action Smurfs franchise, but following less stellar critical and box office performances earlier in the year with Hotel Transylvania 3 and Goosebumps 2, the prolific duo of Phil Lord and Chris Miller (of Clone High, 21 Jump Street, and Lego Movie fame) have provided the studio with the distinction of having produced the best animated film of 2018. Incredibles 2 was fun and exciting, Ralph Breaks the Internet was creative and heartfelt, and Spider-Man: Into the Spider-Verse is all of those things and a hell of a lot more, using the medium of animation to its fullest extent technically, visually, and narratively. I admit I haven’t read many Marvel comics, but I fell in love with every main character, even those who had relatively little screentime in comparison to Miles Morales and Peter B. Parker (if you haven’t seen it, just know that middle initial is an important distinction). They all feel human and immediately become likable upon their respective introductions, so it’s easy to empathize with them even if we don’t know a ton about them. Even its main villain Kingpin has a backstory that makes his plan at least understandable, though his methods for achieving his end goal are deplorable at times. Another rather likable character is revealed later on to be doing some unsavory things, but their motivations are complex and they remain sympathetic. The various Spider-figures work off each other brilliantly, a highlight being the mentor/mentee relationship between Morales and a slightly more aged Parker. Their collective astonishment at discovering more and more people with their abilities makes for a good running gag when each one has to quickly go over the broad strokes of their backstory, and characters like Spider-Ham and Spider-Man Noir get some funny material out of the bizarre nature of their alternate universes — one of my only issues with the movie is that I felt there wasn’t quite enough of those two. Not only is the story great, the world of the film is fleshed out with real-world issues that aren’t made explicit or a main focus on any plot line, but also aren’t sanitized to an insensitive extent and are integral to the plot and characters. There are passing references to the Black Lives Matter movement not via scenes of police brutality or blatant racial profiling, but through the attitudes that lie at the root of the ongoing hostility toward people of color, something that will inevitably affect Miles’ outlook on the world as an Afro-Latino and ends up impacting him personally and becoming a part of what drives him to defend New York as his universe’s Spider-Man. The other major component of that drive is what he learns from Parker, who is portrayed with undercurrents of depression and suicidal ideation that results in a familiar yet still poignant message about looking to an uncertain future. The animation style, taking cues from the comics that served as the film’s inspiration (many of these characters, including Miles, are making their film debut) and becoming less cohesive between layers as Miles’ reality becomes more strained, complements the plot and emotion beautifully (though it could prove harmful to photosensitive people, so watch out for that). The backgrounds in the film’s climax make it difficult to gauge where the characters are spatially, but this is done intentionally to accent their feeling disoriented and on edge. New York is rendered in a way that makes it feel like our New York, but at the same time, not quite. Times Square is teeming with Easter eggs and advertisements for entries into real-world franchises that I truly wish were real, and the depth and dimension of the world makes for an immersive experience with or without the IMAX experience. Into the Spider-Verse is everything a great animated film and superhero film should be, and I’m excited to see where Sony can take these characters next. A junior at Hollins University whose penchant for Disney led into a love for all things film. Amateur film critic and aspiring screenwriter/director. View all posts by Mary McKeon

https://medium.com/@filmknife/review-into-the-spider-verse-swings-above-and-beyond-ab250f3ea843

['Mary Mckeon']

2019-07-20 04:21:27.088000+00:00

['Marvel', 'Movies', 'Film Reviews', 'Spider Man', 'Animation']

Title Review “Into SpiderVerse” swing beyondContent Review “Into SpiderVerse” swing beyond Sony Pictures Animation closed year far away one best film they’ve ever made though may sound like it’s saying much may familiar studio culprit notorious Emoji Movie liveaction Smurfs franchise following le stellar critical box office performance earlier year Hotel Transylvania 3 Goosebumps 2 prolific duo Phil Lord Chris Miller Clone High 21 Jump Street Lego Movie fame provided studio distinction produced best animated film 2018 Incredibles 2 fun exciting Ralph Breaks Internet creative heartfelt SpiderMan SpiderVerse thing hell lot using medium animation fullest extent technically visually narratively admit haven’t read many Marvel comic fell love every main character even relatively little screentime comparison Miles Morales Peter B Parker haven’t seen know middle initial important distinction feel human immediately become likable upon respective introduction it’s easy empathize even don’t know ton Even main villain Kingpin backstory make plan least understandable though method achieving end goal deplorable time Another rather likable character revealed later unsavory thing motivation complex remain sympathetic various Spiderfigures work brilliantly highlight mentormentee relationship Morales slightly aged Parker collective astonishment discovering people ability make good running gag one quickly go broad stroke backstory character like SpiderHam SpiderMan Noir get funny material bizarre nature alternate universe — one issue movie felt wasn’t quite enough two story great world film fleshed realworld issue aren’t made explicit main focus plot line also aren’t sanitized insensitive extent integral plot character passing reference Black Lives Matter movement via scene police brutality blatant racial profiling attitude lie root ongoing hostility toward people color something inevitably affect Miles’ outlook world AfroLatino end impacting personally becoming part drive defend New York universe’s SpiderMan major component drive learns Parker portrayed undercurrent depression suicidal ideation result familiar yet still poignant message looking uncertain future animation style taking cue comic served film’s inspiration many character including Miles making film debut becoming le cohesive layer Miles’ reality becomes strained complement plot emotion beautifully though could prove harmful photosensitive people watch background film’s climax make difficult gauge character spatially done intentionally accent feeling disoriented edge New York rendered way make feel like New York time quite Times Square teeming Easter egg advertisement entry realworld franchise truly wish real depth dimension world make immersive experience without IMAX experience SpiderVerse everything great animated film superhero film I’m excited see Sony take character next junior Hollins University whose penchant Disney led love thing film Amateur film critic aspiring screenwriterdirector View post Mary McKeonTags Marvel Movies Film Reviews Spider Man Animation

The Marvelous Adaptation of Heroes

Within the past few decades, superheroes have been flying onto our screens and pages, quipping a witty catchphrase, and stealing our hearts. Sure, there have always been superhero-like figures, such as the gods in Greek or Roman mythology, but recently flying men and women in spandex have been increasingly popular when it comes to otherworldly figures. A certainly notable piece of this uprise is Marvel Comics and, most importantly, their vast collection of crime-fighters. Ever since the organization’s creation in 1939 by Martin Goodman, Marvel characters (along with the guidelines of how new marvel characters are built) have adapted in several ways, the most notable of which being interworking current events, diversification of characters, and relation to the newest generations of people to stay relevant in our ever-changing society. Ever since the dawn of Marvel, the company has been intertwining current events with their entertainment to keep the viewers flowing in. In 1941 Captain America was introduced to the world through the pages of Marvel’s comic books. Captain America, also known as Steve Rogers, was a morally righteous, patriotic twenty-something less-than-average joe who was turned into super-soldier overnight for the sole purpose of doing right and serving his country. Of course, at the time this comic was released we were in the middle of the second World War. No one would be surprised to see that an uber-patriotic, nazi-punching, red-white-and-blue rocking hero would rise to fame in a time when American patriotism was most abundant. Captain America was a strong supporter of joining the Army and encouraged Americans to help fight this war and step up to be their own kind of superhero. Similarly, Black Panther was released to the public in 1966, during the Civil Rights Movement. Tim Posada, a professor at Saddleback college wrote about people who read the Black Panther comics feeling “…empowerment felt reading about Black Panther ‘fighting the KKK on their own turf in 1966’” (Posada). It’s no shock that a KKK-fighting Black superhero would become popular when African-Americans needed to be empowered and represented. Not only has Black Panther been around for the Civil Rights Movement, but the Black Panther movie (the first Marvel movie to have a person of color as the main character) was also released just a couple years ago in 2018, in a time when the Black Lives Matter movement has been most alive. Since then, Black Panther has become a symbol of black empowerment and a legend of the Marvel Cinematic Universe. Along with prominent movements like BLM, in recent years Marvel has become noticeably more liberal, especially in their 2017 film Thor: Ragnarok. The movie features subtle undertones of liberal ideals such as immigration. At the end of the movie (spoiler warning) the Asgardians are left as refugees from a destroyed land looking for a home, a situation very similar to a lot of immigrants in our world today coming from broken countries in search of a safe haven. Thor is a “…hero at the head of an ark full of people whose homeworld is on fire, looking for a new land to call their own. Immigrants all, refugees from a foreign land” (Bernardin). The most relevant example in the comics is the comics of Ms.Marvel. Ms. Marvel is embodied by Kamala Khan, “her newest iteration as a Pakistani Muslim young woman, challenges the conventions of race and American citizenship in the post-9/11 United States” (Landis). This comic is extremely relevant considering all the Islamophobia in the United States that have been occurring recently, including the recent travel ban created by Trump, nicknamed the “Muslim ban”, that restricts the travel of citizens of middle-eastern countries in the US. Weaving in these current events that are relevant to our political situations and ideals as a country over the years has surely gained Marvel the attention of many liberals who can either relate or sympathize with the predicaments throughout their lifespan as a company. . Not only do the Ms.Marvel comics work to tie together comics and current events but this specific series of comics, along with several others, is part of the new wave of diversity that Marvel is working to bring to all their universes. Originally, Ms.Marvel was Carol Danvers, a white woman who was part of the Air Force, before she took on the role of Captain Marvel. Danvers is also a part of the change in diversity but in the category of gender. She replaced the original Captain Marvel, a male Kree alien named Mar-Vell that went by the alias of Walter Lawson, making yet another pre-existing Marvel character more diverse. Several other heroes have gone through this type of adaptation, changing from one ethnicity, gender, or religion. The best example of all three would be the characters from Into the Spider-Verse. Though it is not technically a Marvel movie (Sony developed the movie), all of the characters in Into the Spider-Verse are Marvel characters that appear in their comics, movies, and television shows. Into the Spider-Verse was released last year and includes a very diverse cast of characters, including the lead, Miles Morales. Miles is a half Puerto Rican and half African American growing up in New York. There is also several other alternate Spider-Men, such as Spider-Gwen, an alternate universe’s Gwen Stacy turned Spider-Man, and Penny Parker, a young Asain girl who fights crime with the help of her robot. A good part of the movie to point out would be, as New York Times writer Eliana Dockterman said, “Spider-Verse does not make much hay of the gender or ethnicity of Miles, Gwen, and Peni” (Dockterman). Not only is there an abundance of race and gender diversity in this movie, but it has also been confirmed that Peter Parker from ‘our’ universe is Jewish, seeing as the movie depicts him breaking plates at his wedding which is a Jewish tradition. Going further into Marvel Comics, there is even an abundance of LGBTQ+ characters. Deadpool, America Chavez, Loki, and Mystique are just a few. As well as adapting old characters, Marvel writers have made new characters that more diverse, such as America Chavez and Karolina Dean. Even though there has been much change in the Marvel comics in relation to the amount of diversity, there has not been as much in the Marvel Cinematic Universe. Only in the past few years have they had a rise of minority and women superheroes, with Black Panther debuting in 2018 and Captain Marvel (Marvel’s first female-led movie) just this year. Future movies that will be released are in the works currently including women and minorities in leading roles such as Black Panther 2, Shang-Chi, Black Widow, and, even though it is technically a Sony movie, Into the Spider-Verse 2 (Donnelly). This newfound diversity in Marvel’s several universes will help them to bring in new viewers or readers who want to see someone like themselves reflected in entertainment. Diversity in Marvel will certainly help them stay relevant, especially with the wave of new generations that have arrived. . Of course, the main crowd Marvel has to worry about staying relevant with is the newest generations. The youngest generations alive right now, Gen Z and the Millennial Generation, have been the most liberal generations yet- these generations are super accepting, caring, and aware of others’ emotions. In an article from the Pew Research Center, 62% of Gen Z and 61% of Millenials say that increasing diversity is good for society. These percentages have a 9% or higher gap between them and other generations percentages, with the silent generation coming in dead last with 41%. Marvel doesn’t let this information fly over their heads. Their new diversity in their casts of characters and inclusion of current events bundle up into a well-rounded content that the youngest generations would be interested in consuming. Giving minorities and women bigger roles in the work will draw in these younger people who appreciate diversity and inclusion. Kids around my age are also attracted to the comedy and quirks that Marvel seems to be bringing to its content. Having little jokes like the ones Tom Holland’s Peter Parker makes or remarks from Shuri, sister of Black Panther, such as “What are those?!” (a reference to the late, great Vine, a social media platform that many younger kids, in particular, are well-versed in) is very appealing to kids because those small bits are something we can fully relate to and understand, as well as some of the jokes made by these Avengers utilizing the same sense of humor many kids have today. Younger people appreciate the effort that is made by Marvel when they choose to begin the process of de-sexualizing women superheroes in ways like a not-overly-sexualized-for-no-reason costume or by not making it such a big deal that women and minorities are getting huge roles. In Captain Marvel, instead of making Carol wear an ultra-tight, latex body-suit, the creative minds behind the movie made the decision to have her wear a less revealing suit that much more realistic for a woman that would be fighting evil forces and want her legs covered for the sensible purpose of protection. Making costumes less over-sexualized definitely helps to appeal to a younger audience that is still deciding if this brand of movies is worth their time or not and so far Marvel has been doing a great job of improving their material to become more geared to these younger generations down the road. . Marvel’s sly strategy of creating content for younger generations has certainly worked on me. For almost as long as I can remember, I’ve wanted to be a superhero. My dad started a tradition with me when I was a kid. He and I would go out to the theater, get some slushies, and we would watch the latest Marvel movie. I loved doing this. It was extra time I got to spend with my dad when he wasn’t traveling for work and it also led me to discover an affinity for superheroes. These heroes I love so dearly stand up for the helpless, rescue the endangered, and always do their best to be genuinely good. Plus they had super-powers, so that was a plus. These heroes all had special powers that made them unique, well, unique in most ways. Tony Stark: a genius with an iron super-suit; Steve Rogers: a less-than-average joe with a righteous moral compass and newly developed super-soldier strength; Thor: a god with the power of all the sky. All of these men were the focal point of the heroes seen on screen in the Marvel Universe, and all are heterosexual caucasian men. As a kid, I always loved these guys to the moon and back, but I felt like something was missing. I could only relate to them on a certain level and, besides that, I was confused. Why was it only guys that were allowed to be the hero that saved the world? There were virtually no women early on in Marvel’s cinematic life. Though, Peggy Carter, Pepper Potts, Jane Foster, and, later on down the road, Natasha Romanoff, main women characters that I looked up to and cherished deeply, were around to assist the main superheroes a few times, why wouldn’t they defeat Red-Skull or save a town from destruction? These are definitely questions other little kids like me were asking around that time. Why can’t someone who looks like me save the world? As we know, representation is important for everyone, especially women and minorities. Marika, an author of an article from the Geeks website, best describes the reason for representation being so important by stating, “We want to feel empowered after seeing a superhero movie, we want to believe we can be as strong and powerful as them. It’s sometimes hard to feel that way if you don’t look anything like the character”(Marika). Earlier this year, when Captain Marvel was released in all it’s glory, I watched in awe as Carol Danvers flew through spaceships and kicked butt with the same gusto that all of her male counterparts had for years prior. I knew that the little girl sitting in the theater with her dad all those years ago would be overflowing with joy. That is why Marvel’s diversity is so important in its relevance. As Eliana Dockterman so eloquently stated, “What matters is that they each remind audiences that, to quote Aunt May, ‘There’s a hero in all of us.’ More than half a century ago, Spider-Man became the original everyman. Now he’s finally starting to look like it”(Dockterman). People want to see others like them doing amazing things and see that they can be just as fantastic. It’s difficult to look at someone drastically different than you and think “Wow. If that guy can save all those people and perform so many heroic acts, then I can do great things with my life like him.” This is why heroes are inspiring to people who have similar characteristics (race, gender, sexuality, have the same disability). They can go through the same adversity that anyone like them is going through, push through it, and then go kick butt. Seeing a character look like yourself is a reassuring comfort that you are capable of being as amazing as them. . Through similarities to our current society and societies of the past, a newfound diversity in content, and the attraction of new generations, Marvel is able to stay relevant, and even thrive, in the world we live in today. Through and through, Marvel has evolved, growing more popular with each new movie or comic released. While it’s very possible Marvel is just another greedy corporation making a change for cash in return, there are wonderful people creating the content that have pure intentions and that truly care about having everyone feel represented and empowered. The radical change in Marvel’s entertainment has created a gateway towards new viewers, extending a hand to help everyone feel welcome and represented in our society. Through the attention, Marvel has managed to be stably relevant, remaining steady enough to keep the flow of astonishing, loveable characters coming to be consumed by adoring fans in a marvelous cycle of adaption. Works Cited Bernardin, Marc. “Thor: Ragnorak Is A Direct. Commentary On Trump’s America”. SyFy Wire, 5 November 2017, https://www.syfy.com/syfywire/thor-ragnarok-is-a-direct-commentary-on-trumps-america. Web. Accessed 5 November 2019. Dockterman, Eliana. “Spider-Man’s Sticking Power”. TIME International (South Pacific Edition), 27 August 2015, http://ezproxy.missouriwestern.edu:2139/eds/detail/detail?vid=1&sid=5ff814fd-8d4c-4977-b73d-7ac0575d74a3%40sessionmgr4006&bdata=JnNpdGU9ZWRzLWxpdmU%3d#AN=133447793&db=f5h. Web, Accessed 29 October 2019. Dockterman, Eliana. “Everyone’s A Superhero at Marvel”. TIME International, 17 December 2018, https://time.com/4012852/everyones-a-superhero-at-marvel/. Web. Accessed 29 October 2019. Donnelly, Matt. “Marvel Powers Up”. Variety, 9 July 2019, http://ezproxy.missouriwestern.edu:2117/eds/detail/detail?vid=4&sid=e006e0c1-2398-4826-a965-ac67bb660c27%40sessionmgr102&bdata=JnNpdGU9ZWRzLWxpdmU%3d#AN=137368500&db=f5h. Web. Accessed 29 October 2019. Parker, Kim. Graf, Nikki. Igielnik, Ruth. “Generation Z Looks a Lot Like Millennials on Key Social and Political Issues”. Pew Research Center, 17 January 2019, https://www.pewsocialtrends.org/2019/01/17/generation-z-looks-a-lot-like-millennials-on-key-social-and-political-issues/. Accessed 29 November 2019. Posada, Tim. “Afrofuturism, Power, and Marvel Comic’s Black Panther”. Journal of Pop Culture, June 2019, http://ezproxy.missouriwestern.edu:2117/eds/detail/detail?vid=6&sid=e006e0c1-2398-4826-a965-ac67bb660c27%40sessionmgr102&bdata=JnNpdGU9ZWRzLWxpdmU%3d#AN=201916063955&db=mzh. Web. Accessed 29 October 2019. Landis, Winona. “Ms.Marvel, Qahera, and Superheroism and Muslim Diaspora”. Continuum: Journal of Media and Cultural Studies, 2 April 2019, http://ezproxy.missouriwestern.edu:2117/eds/detail/detail?vid=1&sid=e006e0c1-2398-4826-a965-ac67bb660c27%40sessionmgr102&bdata=JnNpdGU9ZWRzLWxpdmU%3d#AN=135462173&db=a9h. Web. Accessed 29 October 2019. Marika. “Why ‘Captain Marvel’ is So Important”. Vocal, March 2019, https://vocal.media/geeks/why-captain-marvel-is-so-important. Web. Accessed 3 November 2019.

https://medium.com/@tanndoubleyou/the-marvelous-adaptation-of-heroes-ac63339b53d3

['Tay Waller']

2020-12-30 00:49:16.050000+00:00

['Marvel', 'Feminism', 'Comics']

Title Marvelous Adaptation HeroesContent Within past decade superheroes flying onto screen page quipping witty catchphrase stealing heart Sure always superherolike figure god Greek Roman mythology recently flying men woman spandex increasingly popular come otherworldly figure certainly notable piece uprise Marvel Comics importantly vast collection crimefighters Ever since organization’s creation 1939 Martin Goodman Marvel character along guideline new marvel character built adapted several way notable interworking current event diversification character relation newest generation people stay relevant everchanging society Ever since dawn Marvel company intertwining current event entertainment keep viewer flowing 1941 Captain America introduced world page Marvel’s comic book Captain America also known Steve Rogers morally righteous patriotic twentysomething lessthanaverage joe turned supersoldier overnight sole purpose right serving country course time comic released middle second World War one would surprised see uberpatriotic nazipunching redwhiteandblue rocking hero would rise fame time American patriotism abundant Captain America strong supporter joining Army encouraged Americans help fight war step kind superhero Similarly Black Panther released public 1966 Civil Rights Movement Tim Posada professor Saddleback college wrote people read Black Panther comic feeling “…empowerment felt reading Black Panther ‘fighting KKK turf 1966’” Posada It’s shock KKKfighting Black superhero would become popular AfricanAmericans needed empowered represented Black Panther around Civil Rights Movement Black Panther movie first Marvel movie person color main character also released couple year ago 2018 time Black Lives Matter movement alive Since Black Panther become symbol black empowerment legend Marvel Cinematic Universe Along prominent movement like BLM recent year Marvel become noticeably liberal especially 2017 film Thor Ragnarok movie feature subtle undertone liberal ideal immigration end movie spoiler warning Asgardians left refugee destroyed land looking home situation similar lot immigrant world today coming broken country search safe Thor “…hero head ark full people whose homeworld fire looking new land call Immigrants refugee foreign land” Bernardin relevant example comic comic MsMarvel Ms Marvel embodied Kamala Khan “her newest iteration Pakistani Muslim young woman challenge convention race American citizenship post911 United States” Landis comic extremely relevant considering Islamophobia United States occurring recently including recent travel ban created Trump nicknamed “Muslim ban” restricts travel citizen middleeastern country US Weaving current event relevant political situation ideal country year surely gained Marvel attention many liberal either relate sympathize predicament throughout lifespan company MsMarvel comic work tie together comic current event specific series comic along several others part new wave diversity Marvel working bring universe Originally MsMarvel Carol Danvers white woman part Air Force took role Captain Marvel Danvers also part change diversity category gender replaced original Captain Marvel male Kree alien named MarVell went alias Walter Lawson making yet another preexisting Marvel character diverse Several hero gone type adaptation changing one ethnicity gender religion best example three would character SpiderVerse Though technically Marvel movie Sony developed movie character SpiderVerse Marvel character appear comic movie television show SpiderVerse released last year includes diverse cast character including lead Miles Morales Miles half Puerto Rican half African American growing New York also several alternate SpiderMen SpiderGwen alternate universe’s Gwen Stacy turned SpiderMan Penny Parker young Asain girl fight crime help robot good part movie point would New York Times writer Eliana Dockterman said “SpiderVerse make much hay gender ethnicity Miles Gwen Peni” Dockterman abundance race gender diversity movie also confirmed Peter Parker ‘our’ universe Jewish seeing movie depicts breaking plate wedding Jewish tradition Going Marvel Comics even abundance LGBTQ character Deadpool America Chavez Loki Mystique well adapting old character Marvel writer made new character diverse America Chavez Karolina Dean Even though much change Marvel comic relation amount diversity much Marvel Cinematic Universe past year rise minority woman superheroes Black Panther debuting 2018 Captain Marvel Marvel’s first femaleled movie year Future movie released work currently including woman minority leading role Black Panther 2 ShangChi Black Widow even though technically Sony movie SpiderVerse 2 Donnelly newfound diversity Marvel’s several universe help bring new viewer reader want see someone like reflected entertainment Diversity Marvel certainly help stay relevant especially wave new generation arrived course main crowd Marvel worry staying relevant newest generation youngest generation alive right Gen Z Millennial Generation liberal generation yet generation super accepting caring aware others’ emotion article Pew Research Center 62 Gen Z 61 Millenials say increasing diversity good society percentage 9 higher gap generation percentage silent generation coming dead last 41 Marvel doesn’t let information fly head new diversity cast character inclusion current event bundle wellrounded content youngest generation would interested consuming Giving minority woman bigger role work draw younger people appreciate diversity inclusion Kids around age also attracted comedy quirk Marvel seems bringing content little joke like one Tom Holland’s Peter Parker make remark Shuri sister Black Panther “What those” reference late great Vine social medium platform many younger kid particular wellversed appealing kid small bit something fully relate understand well joke made Avengers utilizing sense humor many kid today Younger people appreciate effort made Marvel choose begin process desexualizing woman superheroes way like notoverlysexualizedfornoreason costume making big deal woman minority getting huge role Captain Marvel instead making Carol wear ultratight latex bodysuit creative mind behind movie made decision wear le revealing suit much realistic woman would fighting evil force want leg covered sensible purpose protection Making costume le oversexualized definitely help appeal younger audience still deciding brand movie worth time far Marvel great job improving material become geared younger generation road Marvel’s sly strategy creating content younger generation certainly worked almost long remember I’ve wanted superhero dad started tradition kid would go theater get slushies would watch latest Marvel movie loved extra time got spend dad wasn’t traveling work also led discover affinity superheroes hero love dearly stand helpless rescue endangered always best genuinely good Plus superpower plus hero special power made unique well unique way Tony Stark genius iron supersuit Steve Rogers lessthanaverage joe righteous moral compass newly developed supersoldier strength Thor god power sky men focal point hero seen screen Marvel Universe heterosexual caucasian men kid always loved guy moon back felt like something missing could relate certain level besides confused guy allowed hero saved world virtually woman early Marvel’s cinematic life Though Peggy Carter Pepper Potts Jane Foster later road Natasha Romanoff main woman character looked cherished deeply around assist main superheroes time wouldn’t defeat RedSkull save town destruction definitely question little kid like asking around time can’t someone look like save world know representation important everyone especially woman minority Marika author article Geeks website best describes reason representation important stating “We want feel empowered seeing superhero movie want believe strong powerful It’s sometimes hard feel way don’t look anything like character”Marika Earlier year Captain Marvel released it’s glory watched awe Carol Danvers flew spaceship kicked butt gusto male counterpart year prior knew little girl sitting theater dad year ago would overflowing joy Marvel’s diversity important relevance Eliana Dockterman eloquently stated “What matter remind audience quote Aunt May ‘There’s hero us’ half century ago SpiderMan became original everyman he’s finally starting look like it”Dockterman People want see others like amazing thing see fantastic It’s difficult look someone drastically different think “Wow guy save people perform many heroic act great thing life like him” hero inspiring people similar characteristic race gender sexuality disability go adversity anyone like going push go kick butt Seeing character look like reassuring comfort capable amazing similarity current society society past newfound diversity content attraction new generation Marvel able stay relevant even thrive world live today Marvel evolved growing popular new movie comic released it’s possible Marvel another greedy corporation making change cash return wonderful people creating content pure intention truly care everyone feel represented empowered radical change Marvel’s entertainment created gateway towards new viewer extending hand help everyone feel welcome represented society attention Marvel managed stably relevant remaining steady enough keep flow astonishing loveable character coming consumed adoring fan marvelous cycle adaption Works Cited Bernardin Marc “Thor Ragnorak Direct Commentary Trump’s America” SyFy Wire 5 November 2017 httpswwwsyfycomsyfywirethorragnarokisadirectcommentaryontrumpsamerica Web Accessed 5 November 2019 Dockterman Eliana “SpiderMan’s Sticking Power” TIME International South Pacific Edition 27 August 2015 httpezproxymissouriwesternedu2139edsdetaildetailvid1sid5ff814fd8d4c4977b73d7ac0575d74a340sessionmgr4006bdataJnNpdGU9ZWRzLWxpdmU3dAN133447793dbf5h Web Accessed 29 October 2019 Dockterman Eliana “Everyone’s Superhero Marvel” TIME International 17 December 2018 httpstimecom4012852everyonesasuperheroatmarvel Web Accessed 29 October 2019 Donnelly Matt “Marvel Powers Up” Variety 9 July 2019 httpezproxymissouriwesternedu2117edsdetaildetailvid4side006e0c123984826a965ac67bb660c2740sessionmgr102bdataJnNpdGU9ZWRzLWxpdmU3dAN137368500dbf5h Web Accessed 29 October 2019 Parker Kim Graf Nikki Igielnik Ruth “Generation Z Looks Lot Like Millennials Key Social Political Issues” Pew Research Center 17 January 2019 httpswwwpewsocialtrendsorg20190117generationzlooksalotlikemillennialsonkeysocialandpoliticalissues Accessed 29 November 2019 Posada Tim “Afrofuturism Power Marvel Comic’s Black Panther” Journal Pop Culture June 2019 httpezproxymissouriwesternedu2117edsdetaildetailvid6side006e0c123984826a965ac67bb660c2740sessionmgr102bdataJnNpdGU9ZWRzLWxpdmU3dAN201916063955dbmzh Web Accessed 29 October 2019 Landis Winona “MsMarvel Qahera Superheroism Muslim Diaspora” Continuum Journal Media Cultural Studies 2 April 2019 httpezproxymissouriwesternedu2117edsdetaildetailvid1side006e0c123984826a965ac67bb660c2740sessionmgr102bdataJnNpdGU9ZWRzLWxpdmU3dAN135462173dba9h Web Accessed 29 October 2019 Marika “Why ‘Captain Marvel’ Important” Vocal March 2019 httpsvocalmediageekswhycaptainmarvelissoimportant Web Accessed 3 November 2019Tags Marvel Feminism Comics

Holding out for a hero: Marvel and the need for superheroines

This is the time of the geek and the big screen superhero — but where are the superheroines? By Georgina Kiely Bring it on: Black Widow is just one of the many female superheroes ready to take centre stage. Photo: marvelousRoland/Flickr. It’s a fact that universally acknowledged that we’re not exactly short of superheroines who are ripe for their silver screen debut. The potential candidates are endless: Silver Sable, Thundra, Jean Grey, take your pick! Personally, I’d kill to see a Black Widow spin-off; Scarlett Johansson is certainly a big enough name for her own franchise and who doesn’t want to watch a film starring a kickass Russian assassin who could no doubt kill a man with her pinky alone? With so many examples of superheriones crying out for their time in the spotlight, it’s baffling to wonder why the idea hasn’t been picked up yet. I have no problems admitting to being a geek — this is our time. The rise of the geeks has been rapid and all-encompassing, and Marvel has seized the imaginations of our generation. We’re living through a superhero boom and with writers like Joss Whedon at the helm, you’d think we couldn’t go far wrong. However, Whedon is often asked in interviews why he often chooses to focus on strong female lead characters and his ultimate answer is “because you are still asking me the question.” Indeed, there is a noticeable lack of focus on our well-loved superheroines in many of Marvel and DC adaptations, and it’s about time someone poked them into producing something the fans are desperate to see: a female lead. The Marvel Studios president Kevin Feige has skirted around the issue, saying “I think it comes down to timing”. But when could there be a better time? Even Scarlett Johansson herself has expressed a keen interest in taking on a Black Widow movie, so what exactly is holding Marvel back? It’s certainly not that audiences wouldn’t be ready for a female lead; we’ve already seen a talking racoon and a character who can only state his own name hold their own. Feige has said that he recognises the need for a female-led franchise, so the bluster leaves me with some niggling doubts about whether timing is really the issue. Counterintuitively, the superhero fanbase, for all the futuristic movies and out-of-this-world characters, seem to be fairly stuck in their ways. When Marvel announced there would be a female Thor and that the new Captain America would be black, the twitterverse was, in the most part, excited. However, there were ugly comments comments — such as ‘I’m done Marvel’ or the well-considered ‘remember when #Marvel wasn’t run by a pack of political correct gelded men #goodtimes’. Thanks for sharing, guys. Here’s a tip, if you’re itching to start a comment with ‘I’m not a racist/sexist but…’ then you’re probably better off just going home and considering your life choices. What makes this announcement of a new incarnation of the god of thunder even more exciting is that this isn’t she-Thor, Lady Thor or Thorina, this is actually Thor, a superhero in her own right with all the clout of the character behind her. Could it be the potential backlash from a minority group of Marvel-ites that’s slowing the process? It’s possible, but the picture is not entirely tarnished with testosterone. The much anticipated Ms Marvel will soon be making an appearance in Avengers 2: Age Of Ultron — a definite step forward in the rise of the on-screen superwoman. However, it’s important to highlight that if Marvel isn’t quick enough to decide whether they can take the time to produce something the fans are pleading for, inevitably someone else will get there first. Female superheroes may be getting their time to shine sooner than we think. Sony Pictures have hinted at a fresh new look at the Spidey universe, with a female-led picture set to be released in 2017. Even sooner, Warner Bros. seem to have beaten them to the punch with pictures of Gal Gadot as Wonder Woman in the 2016 production Batman V Superman: Dawn of Justice. These female superhero spin offs may be just what we need to re-vamp any remaining washed out clichés, so who’s going to get there first? Your move, Marvel.

https://medium.com/abstract-magazine/holding-out-for-a-hero-marvel-and-the-need-for-superheroines-d64dcb0496db

['Abstract Magazine']

2015-11-30 17:57:57.023000+00:00

['Movies', 'Marvel', 'Culture']

Title Holding hero Marvel need superheroinesContent time geek big screen superhero — superheroines Georgina Kiely Bring Black Widow one many female superheroes ready take centre stage Photo marvelousRolandFlickr It’s fact universally acknowledged we’re exactly short superheroines ripe silver screen debut potential candidate endless Silver Sable Thundra Jean Grey take pick Personally I’d kill see Black Widow spinoff Scarlett Johansson certainly big enough name franchise doesn’t want watch film starring kickass Russian assassin could doubt kill man pinky alone many example superheriones cry time spotlight it’s baffling wonder idea hasn’t picked yet problem admitting geek — time rise geek rapid allencompassing Marvel seized imagination generation We’re living superhero boom writer like Joss Whedon helm you’d think couldn’t go far wrong However Whedon often asked interview often chooses focus strong female lead character ultimate answer “because still asking question” Indeed noticeable lack focus wellloved superheroines many Marvel DC adaptation it’s time someone poked producing something fan desperate see female lead Marvel Studios president Kevin Feige skirted around issue saying “I think come timing” could better time Even Scarlett Johansson expressed keen interest taking Black Widow movie exactly holding Marvel back It’s certainly audience wouldn’t ready female lead we’ve already seen talking racoon character state name hold Feige said recognises need femaleled franchise bluster leaf niggling doubt whether timing really issue Counterintuitively superhero fanbase futuristic movie outofthisworld character seem fairly stuck way Marvel announced would female Thor new Captain America would black twitterverse part excited However ugly comment comment — ‘I’m done Marvel’ wellconsidered ‘remember Marvel wasn’t run pack political correct gelded men goodtimes’ Thanks sharing guy Here’s tip you’re itching start comment ‘I’m racistsexist but…’ you’re probably better going home considering life choice make announcement new incarnation god thunder even exciting isn’t sheThor Lady Thor Thorina actually Thor superhero right clout character behind Could potential backlash minority group Marvelites that’s slowing process It’s possible picture entirely tarnished testosterone much anticipated Ms Marvel soon making appearance Avengers 2 Age Ultron — definite step forward rise onscreen superwoman However it’s important highlight Marvel isn’t quick enough decide whether take time produce something fan pleading inevitably someone else get first Female superheroes may getting time shine sooner think Sony Pictures hinted fresh new look Spidey universe femaleled picture set released 2017 Even sooner Warner Bros seem beaten punch picture Gal Gadot Wonder Woman 2016 production Batman V Superman Dawn Justice female superhero spin offs may need revamp remaining washed clichés who’s going get first move MarvelTags Movies Marvel Culture

Iron Man’s Functional Spec for Mark 1

Iron Man’s Functional Spec for Mark 1 For those of you who are Avengers fans, you would remember the movie Iron Man (2008). You may also remember Mark 1, the first suit that the millionaire maverick Tony Stark built for himself. The purpose of this blog is to help explain how to write a functional spec. The product we will keep in focus is Tony Stark’s first Iron Man suit, Mark 1. Photo by Klim Musalimov on Unsplash What is a functional specification? A functional specification as the name suggests is a document that describes the functionality of the application. It helps the engineering team to understand how the user will use the application, product, or feature. A functional specification details out all the features the team needs to build and articulates why those features should be built. Writing a functional specification A functional spec can be written in a PowerPoint presentation or a Word document and must contain certain sections that will be discussed in detail in this post. Problem — what is the problem that you are solving. If you don’t know the exact problem statement, then you can begin with a problem hypothesis. 2. User Personas — who will use your product. 3. Principle- guiding principles of the product. 4. Project scope — list of specific project goals, deadlines, and costs. Also, clearly explain what will not be done. 5. Risks & Dependencies— anything that may impact completing the project on time. 6. Assumptions — all assumptions you make regarding scope, market, product, customer etc. 7. Solution — an overview of how you will solve the problem. This contains: Use cases — map the functional requirements with user action. — map the functional requirements with user action. Requirements — critical features of your product that answer the question: what does your product do? 8. Error handling — how your product will handle errors or exceptions. 9. Success criteria — how do you measure the success of your product. If you have not seen Iron Man, then I suggest spending 10 minutes to view the beginning of the movie where Robert Downey Jr, plays the role of Iron Man & builds a suit for himself to escape from the terrorist hide out. Spoiler alert: Certain sections in the blog reveal the plot of the movie. credits: Wikimedia Functional spec of Mark 1 Overview Provide an overview of the situation, your business goals, team goals, or why you think this product is important for your organization. I am Tony Stark, a multi-millionaire and owner of Stark Industries. I was visiting Afghanistan for a show and tell of our latest defense system when my caravan was ambushed by terrorists. I am captured in a cave and badly hurt. I am told that there are shrapnel in my body. Doctor Ho, a friend and my partner in the cave built an electromagnet that is keeping shrapnel from wounding my internal organs to keep me alive. There are several terrorists guarding the cave and I need to get away from here alive. credits: Marvel Studios 1. Problem Explain the problem that you wish to solve. If the problem is not well defined, then explain the problem hypothesis. The terrorists want me to make a missile for them, but in the guise of building a missile, I want to create a contraption that will allow me to be free from this cave. There are around 40–50 terrorists who are armed and have state of the art ammunitions. Therefore, the contraption should not only help me exit the cave and safeguard myself but also retaliate against the gun fire or any other assault from the terrorists. 2. User persona Explain who will use this product? I am building this suit for myself — “Tony Stark”. The user of this contraption is: A healthy person who can bear the weight of 1.5 tons of steel on his or her body. An intellectually adept person who knows how to operate complex machinery. A strong willed and emotionally intelligent person who can manage the stress, anxiety, and post war trauma that may come due to hurting or at times neutralizing human lives. 3. Principle The principles of this product that should not be compromised and serve as a beacon when in doubt. The user of this contraption should stay alive through the escape. No civilians should be harmed. Any threat to the contraption will be considered as a threat to the user. If the threat to the contraption or the user from another terrorist is high, then such threat can potentially be neutralized. 4. Project Scope & timelines High-level scope of the product, the out of scope items, and high level timelines. Timelines: The terrorists have provided 8 weeks to build the missile. We need to complete the MVP (Minimum viable product) contraption in less than 6 weeks so that we can surprise the terrorists in the escape plan. We can continue to build additional features in the contraption after the escape. Scope: Build a contraption that acts like a safety armor to save the user wearing the contraption. The contraption should have defense mode that manages medium combat situations i.e. dealing with medium to light fire power and close combat fights. It should have an offense mode that can use fire power, missile power, flight mode to accrue damage to terrorists and their inhabitation. Out of scope: The contraption does not account for heavy artillery that includes tanks & missiles that can penetrate re-enforced steel etc. The contraption will not have any stealth technology i.e. the contraption will be visible to radars etc. The contraption will not be re-usable after first use. The contraption is not designed for taking multiple flights. 5. Risks Any risks due to partner dependencies, timelines, resource requirements, or external threats that may jeopardize product completion along with mitigation. There are several terrorists who are keeping an eye on my activities. In case I am caught, I can be dead. Mitigation: Make this operation covert and hide my activities from the terrorists. Procurement of all the items needed for the contraption can be time consuming and the availability is also questionable. Mitigation: Build only features and components that are available from existing Stark Industries artillery already available with the terrorists. The setup may be time consuming since it requires me to program the contraption and fit into the suit. If the time is too long, then the terrorists would get suspicious and barge in. Mitigation: The setup time should be less so that I am able to suit up before the terrorists open the door. I am worried that Dr. Mo hinted at offering assistance to keep the terrorists at bay to buy me some time, however I don’t want to exercise this option since it could jeopardize the escape & safety. credits: Marvel Studios 6. Assumptions & Pre-requisites Enlist all the assumptions and pre-requisites while building your product. If the assumptions are not true and pre-requisites are not met, then the product delivery may be at risk. The software to build this contraption is in Arabic but I have learnt Arabic in high school therefore it should be fine. If there are new concepts that come up, then I need to learn them in no time. credits: Marvel Studios I will get all the requirements for the project if I can guise them in the need to building a missile. Any terrorist reinforcements are not possible if the time to escape is kept less than 15 minutes. Pre-requisites: The pre-requisites to build the contraption are as follows: Workstation: Needs to be well lit for me to perform any activities in the darkness of the cave. Welding gear: Need welding gear to make joins on the contraption (acetylene or propane based) Soldering station: Soldering station for electricals along with helmets, goggles, and smelting cup Precision Tools: 2 sets Stark missiles: 11 such missiles credits: Marvel Studios 7. Solution State the solution requirements along with the user scenario. Scenario 1: [Vision] As a user, I should be able to see in the dark cave to find my way out. Requirement 1: The cave is dark and I don’t know my way out. The contraption may hinder my vision therefore I need lighting mechanism that lights up the cave so that I can find my way out. Scenario 2: [Setup]: As a user, I should be able to quickly set up the contraption on the day of the escape to take the terrorists by surprise. Requirement 2: It took me around 4 minutes to walk from the inside of the cave all the way to the exit. If soldiers run, it will take them around 2 minutes therefore the installation and setup of the contraption should not take more than 2–3 minutes. credits: Marvel Studios Scenario 3: [Strength]: As a user, I should be able to save myself from medium gun fire and artillery to stay alive. Requirement 3: There are around 40 militants around the cave who may use weapons of stark industries against the contraption. Therefore, the contraption must bear the assault of bullets from AK47s, Rifles, Grenade attacks etc. credits: Marvel Studio Scenario 4: [Power] As a user, my suit or contraption needs enough power to engage in a 15–20 minute battle and entertain single flight. Requirement 4: This heavy contraption will need tremendous power to be able to carry out such heavy operations. It will be powered by 1.6gms of Palladium that can be extracted from existing missiles. credits: Marvel Studios Scenario 5: [Arc Reactor] As a user, I need to get rid of the car battery that is connected to the electromagnet that is keeping the shrapnel from entering my heart. Requirement 5: Build a miniaturized arc reactor powered by Palladium to serve as an electromagnet to keep the shrapnel in place. It will also serve as a power source for the contraption. credits: Marvel Studio Scenario 6: [Time constraints] As a user, I need to ensure that the contraption stays functional for at least 15 minutes so that I can neutralize the terrorists and escape to a safer place. Requirement 6: Doing my math, the arc reactor can operate for 15 minutes, therefore I need to rescue myself in my contraption in 15 minutes or less. Scenario 7: As a user, I need to defend myself from any impact on the suit due to medium artillery attack by the terrorists. Requirement 7: [Inner protection]: Since the contraption will be made of steel and may be subjected to medium artillery, I need duct tape, cushion, leather jacket, leather gloves, metallic neck brace and other protective gear to keep the steel from hurting my body. Scenario 8: [Mask] As a user, I should be able to breathe through the mask and see my opponents. Requirement 8: Build tiny vents into the mask that allow vision and air to breath. The vents around for vision are strengthened with re-enforced glass. I should be able to unmask myself in case of any limitations of oxygen or if I need to speak and deliver a powerful dialogue. This needs to be done only as an exception since the conditions in the cave are hostile. credits:Marvel Studios Scenario 9: As a user, I should be able to defend myself to resist, desist and neutralize the terrorists. It should also allow me to escape from this hostile environment. Requirements 9: [Defense mechanisms]: Requirement 9a: [Punches] Pneumatic piston driven punches for close combat. If the terrorists come too close, then the punch should be such that it temporarily disables the terrorist for at least 15–20 minutes. Since there is a limit to the artillery that the contraption can carry, this should be the preferred choice of attack considering I can re-use the pneumatic punches several hundred times. The Force of a punch should be around 25,000 pound per square inch. I will have the choice to use both hands to generate enough force to break through the reinforced steel doors. Requirement 9b: [Blow torch]: I can also use blow torch for close combat. The blow torch will operate on limited fuel supply therefore it should only be used where I can neutralize many enemies at the same time. The max distance that the fire from the blow torch may emit is up to 8m. This will also allow me to burn the existing supplies of Stark Industries ammunition on both sides of the entrance aisles. credits: Marvel Studios Requirement 9c: [Short range missiles]: The missiles will be used to neutralize any terrorists at greater distance. The supply of missiles is limited therefore this will be only for backup purposes. There is also a lead time to insert the missile in the launcher system therefore this will only be used on an exceptions basis. The range of the missile will be up to a few 100m. Requirement 9d: [Single flight]: The contraption should allow flight that takes the user at least 5 miles away from the hostile situation. The contraption will require boosters that manage enough thrust to ensure the contraption can generate velocity of around 300m/s. During take off my trajectory path should be at an angle of 60 degrees. The fuel needed for the flight should be for around 15 second flight time. credits: Marvel Studios Trajectory Path for Mark 1 Requirement 9e: [Safety landing]: There are no parachutes planned for the fall since this may add to the weight. The armor should protect me from any bruises on impact. 8. Error & Exception Handling Any exceptions and error scenarios and how can those be handled. The chain and pulley system for the knee joint movements is vulnerable to targeted gun fire. If the chain and pulley system is compromised, then immediately exit the situation using the one-time flight. In case the safety landing system malfunctions, the contraption is designed for damage on impact and breaking the circuit breakers for all defense mechanisms in order to avoid any untoward fires and any harm to the user. 9. Success Metrics Metrics that articulate the success of the product. Vanity metrics Number of terrorists neutralized. Number of punches delivered. Number of missiles launched. Number of blow torch activated. Number of hits taken to the suit. Key business metrics The persona wearing the contraption should survive to eat his favorite cheese burger. credits: Marvel Studio credits: Marvel Studio The intent of this post is to give you an ideas of how you can write your product specs. All credits to Marvel Studio/ MCU for making Iron Man that millions continue to watch and enjoy for generations to come. Stats show that less than 50% of the folks who land on this page will read this line. If you are one of those, then this post should have added some value. Leave a clap or two if this was of value else leave a comment to improve this post. Photo credits: Marvel/ MCU/ Marvel Studios.

https://medium.com/@crawlswalksruns/iron-mans-functional-spec-for-mark-1-ab5db091f483

['Sandeep Chadda']

2020-11-28 04:16:33.920000+00:00

['Product Management', 'Marvel', 'Product Manager', 'Product Development']

Title Iron Man’s Functional Spec Mark 1Content Iron Man’s Functional Spec Mark 1 Avengers fan would remember movie Iron Man 2008 may also remember Mark 1 first suit millionaire maverick Tony Stark built purpose blog help explain write functional spec product keep focus Tony Stark’s first Iron Man suit Mark 1 Photo Klim Musalimov Unsplash functional specification functional specification name suggests document describes functionality application help engineering team understand user use application product feature functional specification detail feature team need build articulates feature built Writing functional specification functional spec written PowerPoint presentation Word document must contain certain section discussed detail post Problem — problem solving don’t know exact problem statement begin problem hypothesis 2 User Personas — use product 3 Principle guiding principle product 4 Project scope — list specific project goal deadline cost Also clearly explain done 5 Risks Dependencies— anything may impact completing project time 6 Assumptions — assumption make regarding scope market product customer etc 7 Solution — overview solve problem contains Use case — map functional requirement user action — map functional requirement user action Requirements — critical feature product answer question product 8 Error handling — product handle error exception 9 Success criterion — measure success product seen Iron Man suggest spending 10 minute view beginning movie Robert Downey Jr play role Iron Man build suit escape terrorist hide Spoiler alert Certain section blog reveal plot movie credit Wikimedia Functional spec Mark 1 Overview Provide overview situation business goal team goal think product important organization Tony Stark multimillionaire owner Stark Industries visiting Afghanistan show tell latest defense system caravan ambushed terrorist captured cave badly hurt told shrapnel body Doctor Ho friend partner cave built electromagnet keeping shrapnel wounding internal organ keep alive several terrorist guarding cave need get away alive credit Marvel Studios 1 Problem Explain problem wish solve problem well defined explain problem hypothesis terrorist want make missile guise building missile want create contraption allow free cave around 40–50 terrorist armed state art ammunition Therefore contraption help exit cave safeguard also retaliate gun fire assault terrorist 2 User persona Explain use product building suit — “Tony Stark” user contraption healthy person bear weight 15 ton steel body intellectually adept person know operate complex machinery strong willed emotionally intelligent person manage stress anxiety post war trauma may come due hurting time neutralizing human life 3 Principle principle product compromised serve beacon doubt user contraption stay alive escape civilian harmed threat contraption considered threat user threat contraption user another terrorist high threat potentially neutralized 4 Project Scope timeline Highlevel scope product scope item high level timeline Timelines terrorist provided 8 week build missile need complete MVP Minimum viable product contraption le 6 week surprise terrorist escape plan continue build additional feature contraption escape Scope Build contraption act like safety armor save user wearing contraption contraption defense mode manages medium combat situation ie dealing medium light fire power close combat fight offense mode use fire power missile power flight mode accrue damage terrorist inhabitation scope contraption account heavy artillery includes tank missile penetrate reenforced steel etc contraption stealth technology ie contraption visible radar etc contraption reusable first use contraption designed taking multiple flight 5 Risks risk due partner dependency timeline resource requirement external threat may jeopardize product completion along mitigation several terrorist keeping eye activity case caught dead Mitigation Make operation covert hide activity terrorist Procurement item needed contraption time consuming availability also questionable Mitigation Build feature component available existing Stark Industries artillery already available terrorist setup may time consuming since requires program contraption fit suit time long terrorist would get suspicious barge Mitigation setup time le able suit terrorist open door worried Dr Mo hinted offering assistance keep terrorist bay buy time however don’t want exercise option since could jeopardize escape safety credit Marvel Studios 6 Assumptions Prerequisites Enlist assumption prerequisite building product assumption true prerequisite met product delivery may risk software build contraption Arabic learnt Arabic high school therefore fine new concept come need learn time credit Marvel Studios get requirement project guise need building missile terrorist reinforcement possible time escape kept le 15 minute Prerequisites prerequisite build contraption follows Workstation Needs well lit perform activity darkness cave Welding gear Need welding gear make join contraption acetylene propane based Soldering station Soldering station electricals along helmet goggles smelting cup Precision Tools 2 set Stark missile 11 missile credit Marvel Studios 7 Solution State solution requirement along user scenario Scenario 1 Vision user able see dark cave find way Requirement 1 cave dark don’t know way contraption may hinder vision therefore need lighting mechanism light cave find way Scenario 2 Setup user able quickly set contraption day escape take terrorist surprise Requirement 2 took around 4 minute walk inside cave way exit soldier run take around 2 minute therefore installation setup contraption take 2–3 minute credit Marvel Studios Scenario 3 Strength user able save medium gun fire artillery stay alive Requirement 3 around 40 militant around cave may use weapon stark industry contraption Therefore contraption must bear assault bullet AK47s Rifles Grenade attack etc credit Marvel Studio Scenario 4 Power user suit contraption need enough power engage 15–20 minute battle entertain single flight Requirement 4 heavy contraption need tremendous power able carry heavy operation powered 16gms Palladium extracted existing missile credit Marvel Studios Scenario 5 Arc Reactor user need get rid car battery connected electromagnet keeping shrapnel entering heart Requirement 5 Build miniaturized arc reactor powered Palladium serve electromagnet keep shrapnel place also serve power source contraption credit Marvel Studio Scenario 6 Time constraint user need ensure contraption stay functional least 15 minute neutralize terrorist escape safer place Requirement 6 math arc reactor operate 15 minute therefore need rescue contraption 15 minute le Scenario 7 user need defend impact suit due medium artillery attack terrorist Requirement 7 Inner protection Since contraption made steel may subjected medium artillery need duct tape cushion leather jacket leather glove metallic neck brace protective gear keep steel hurting body Scenario 8 Mask user able breathe mask see opponent Requirement 8 Build tiny vent mask allow vision air breath vent around vision strengthened reenforced glass able unmask case limitation oxygen need speak deliver powerful dialogue need done exception since condition cave hostile creditsMarvel Studios Scenario 9 user able defend resist desist neutralize terrorist also allow escape hostile environment Requirements 9 Defense mechanism Requirement 9a Punches Pneumatic piston driven punch close combat terrorist come close punch temporarily disables terrorist least 15–20 minute Since limit artillery contraption carry preferred choice attack considering reuse pneumatic punch several hundred time Force punch around 25000 pound per square inch choice use hand generate enough force break reinforced steel door Requirement 9b Blow torch also use blow torch close combat blow torch operate limited fuel supply therefore used neutralize many enemy time max distance fire blow torch may emit 8m also allow burn existing supply Stark Industries ammunition side entrance aisle credit Marvel Studios Requirement 9c Short range missile missile used neutralize terrorist greater distance supply missile limited therefore backup purpose also lead time insert missile launcher system therefore used exception basis range missile 100m Requirement 9d Single flight contraption allow flight take user least 5 mile away hostile situation contraption require booster manage enough thrust ensure contraption generate velocity around 300ms take trajectory path angle 60 degree fuel needed flight around 15 second flight time credit Marvel Studios Trajectory Path Mark 1 Requirement 9e Safety landing parachute planned fall since may add weight armor protect bruise impact 8 Error Exception Handling exception error scenario handled chain pulley system knee joint movement vulnerable targeted gun fire chain pulley system compromised immediately exit situation using onetime flight case safety landing system malfunction contraption designed damage impact breaking circuit breaker defense mechanism order avoid untoward fire harm user 9 Success Metrics Metrics articulate success product Vanity metric Number terrorist neutralized Number punch delivered Number missile launched Number blow torch activated Number hit taken suit Key business metric persona wearing contraption survive eat favorite cheese burger credit Marvel Studio credit Marvel Studio intent post give idea write product spec credit Marvel Studio MCU making Iron Man million continue watch enjoy generation come Stats show le 50 folk land page read line one post added value Leave clap two value else leave comment improve post Photo credit Marvel MCU Marvel StudiosTags Product Management Marvel Product Manager Product Development

Comics Are for Soldiers Too

Comics Are for Soldiers Too Image courtesy of Image Comics I grew up in a military household and as a result I never really considered the ARMY (or any other branch for that matter) to be a place for people like me. By that I mean a nerd, more specifically a comic book nerd. My dad was a former Drill Sergeant as well as a veteran of Vietnam and Desert Storm, so I heard a lot of what life was like in the military. I, on the other hand, was a kid that enjoyed reading Batman and X-Men comics, while watching Saturday morning cartoons on Fox. So I never pictured the military being an institution that was nerd friendly, but apparently I was mistaken. Recently I decided to start talking to some of our members, and members of other Facebook groups who were in the military to find out more about this safe haven of nerdiness that I didn’t know existed. I’ve learned quite a bit about how accepting the military is to the nerd community. Of course the level of acceptance varies from branch to branch and even from base to base, but it seems that no matter where you go (aside from the middle of the Iraqi desert) you have access to nerd culture while in the military. When asked how many nerds they thought were on base I got a wide variety of answers: “I would classify about 60% of the 35 and below age as nerdy, or slightly nerdy” — Marie Halvorsen “Most definitely the comm and intel groups are nerdy without a doubt. You do find some more nerds here and there in other jobs. “ — Ethan Ward “Every single one of my fellow Bees is a nerd in one way or another. Some did D&D for Jocks (fantasy football), others did actual D&D, some wrote fan fiction, others cosplayed, and a bunch of the biggest rednecks you’d ever seen were closet Bronies.” — Katie Knegeris “In my unit I would say everyone under 30 was a nerd. Had D&D, Boothill and classic military board games…along with Sega genesis in just about every room and leisure suit Larry installed in hidden directories on most of the computers” -Drew Haskell It turns out that comics have a long history of being made for the military. Some of the heroes we love have served in one form of the military including; Captain America, The Punisher, Green Lantern, Ms. Marvel, Rick Flag and War Machine. With the exception of the Punisher, these characters were said to be in the military from the get go; we would later find out that the Punisher was a Marine. Having characters in the military allowed people in service to relate to them better and sowed the seeds of the nerd culture in the military. As it were Captain America was actually depicted battling the Nazi’s before America was drawn into the conflict of World War 2, and may have inspired people to join after the Pearl Harbor attack. Image courtesy of DC Comics This began a trend of heroes from the ranks, as well as the depiction of fictional characters battling real world threats. Noticing the increasing popularity of titles depicting heroes at war, the publishing companies began to print comics solely about war, and showed things from the soldier’s perspective. This naturally led to the use of comics by the government as propaganda tools in an attempt to recruit people to aid in the war effort. The popularity of these war time comics would continue to be published until the mid 1980’s. Some of the more popular characters, like Sgt. Rock, were picked up by DC Comics and have become recurring characters within the DC Universe. When I tried to find out if the current military had any comics for the troops I found that DC doesn’t really make issues geared towards the military anymore. “I know Marvel had a deal with either AAFES or the USO. Every now and then they’d release a short comic that they’d give away at the PX or something to help boost morale. You know how that type of thing goes, superheroes fighting the good fight, but the tide turns when a squad of American GIs show up to lend a hand to the Avengers or whoever, and then Captain America tells them they never would’ve won without the soldiers’ help. Corny, but amusing.” — Charles Baggett Image courtesy of Marvel Comics It seems in recent history, Marvel has been the forerunner of military themed comics, releasing a series of Avengers titles that had them aiding in the war effort with various branches of the military. Naturally this increase in military friendly comics saw an increase in the nerd community among soldiers. Most people seem to have been nerds long before signing up, but a few got their exposure on base. Of course there seems to be a consistent preference between what characters the typical military nerd likes with Punisher being the most popular choice among people I talked to. I thought this was a fitting choice, because Frank Castle is all about taking down the bad guys with a full arsenal of military grade hardware. No one really credited comics as their reason for wanting to be in the military but I feel if any comic had an influence on someone joining, it would be a Punisher comic. Captain America and Spider-Man were the other two characters that rounded out the top three military favorites (of people I talked to). I learned quite a bit about nerd culture in the military but the one thing that stood out the most, was the reluctance of a lot of soldiers to call themselves heroes. The majority would say that it was their duty, or that they were just doing their job. To me this is an understatement. “I never thought of myself as a hero for serving, and I still don’t. But it did make me appreciate hard work. If I had to make a comparison to a character I’d probably say The Shoveler.” — Chris Alexander “I would never call myself a hero ever. I think you will find most of us who have served will say the same thing. I could be wrong though.” — Ben Wotawa “Not sure if it found my inner hero, but made it clear that had I not got hurt I would’ve been a career military soldier without a doubt.” — Ethan Ward Most people who aren’t in the service would consider it heroic to go through half of what your average soldier experiences. The nerds that risk their lives to protect others and preserve our nation ARE heroes, whether they call themselves that or not. I am forever grateful to have had the opportunity to speak with these heroes. I will, and forever will be, a comic book nerd and the idea that many of my fellow nerds are helping protect our country certainly helps me sleep a little more comfortably at night.

https://medium.com/@supertho/comics-are-for-soldiers-too-55711d0d832c

['Tho Carrion']

2016-10-14 16:27:37.555000+00:00

['Marvel', 'DC Comics', 'Comics', 'Military']

Title Comics Soldiers TooContent Comics Soldiers Image courtesy Image Comics grew military household result never really considered ARMY branch matter place people like mean nerd specifically comic book nerd dad former Drill Sergeant well veteran Vietnam Desert Storm heard lot life like military hand kid enjoyed reading Batman XMen comic watching Saturday morning cartoon Fox never pictured military institution nerd friendly apparently mistaken Recently decided start talking member member Facebook group military find safe nerdiness didn’t know existed I’ve learned quite bit accepting military nerd community course level acceptance varies branch branch even base base seems matter go aside middle Iraqi desert access nerd culture military asked many nerd thought base got wide variety answer “I would classify 60 35 age nerdy slightly nerdy” — Marie Halvorsen “Most definitely comm intel group nerdy without doubt find nerd job “ — Ethan Ward “Every single one fellow Bees nerd one way another DD Jocks fantasy football others actual DD wrote fan fiction others cosplayed bunch biggest redneck you’d ever seen closet Bronies” — Katie Knegeris “In unit would say everyone 30 nerd DD Boothill classic military board games…along Sega genesis every room leisure suit Larry installed hidden directory computers” Drew Haskell turn comic long history made military hero love served one form military including Captain America Punisher Green Lantern Ms Marvel Rick Flag War Machine exception Punisher character said military get go would later find Punisher Marine character military allowed people service relate better sowed seed nerd culture military Captain America actually depicted battling Nazi’s America drawn conflict World War 2 may inspired people join Pearl Harbor attack Image courtesy DC Comics began trend hero rank well depiction fictional character battling real world threat Noticing increasing popularity title depicting hero war publishing company began print comic solely war showed thing soldier’s perspective naturally led use comic government propaganda tool attempt recruit people aid war effort popularity war time comic would continue published mid 1980’s popular character like Sgt Rock picked DC Comics become recurring character within DC Universe tried find current military comic troop found DC doesn’t really make issue geared towards military anymore “I know Marvel deal either AAFES USO Every they’d release short comic they’d give away PX something help boost morale know type thing go superheroes fighting good fight tide turn squad American GIs show lend hand Avengers whoever Captain America tell never would’ve without soldiers’ help Corny amusing” — Charles Baggett Image courtesy Marvel Comics seems recent history Marvel forerunner military themed comic releasing series Avengers title aiding war effort various branch military Naturally increase military friendly comic saw increase nerd community among soldier people seem nerd long signing got exposure base course seems consistent preference character typical military nerd like Punisher popular choice among people talked thought fitting choice Frank Castle taking bad guy full arsenal military grade hardware one really credited comic reason wanting military feel comic influence someone joining would Punisher comic Captain America SpiderMan two character rounded top three military favorite people talked learned quite bit nerd culture military one thing stood reluctance lot soldier call hero majority would say duty job understatement “I never thought hero serving still don’t make appreciate hard work make comparison character I’d probably say Shoveler” — Chris Alexander “I would never call hero ever think find u served say thing could wrong though” — Ben Wotawa “Not sure found inner hero made clear got hurt would’ve career military soldier without doubt” — Ethan Ward people aren’t service would consider heroic go half average soldier experience nerd risk life protect others preserve nation hero whether call forever grateful opportunity speak hero forever comic book nerd idea many fellow nerd helping protect country certainly help sleep little comfortably nightTags Marvel DC Comics Comics Military

Holography, Augmented Reality and The Problem With Iron Man

Holography, Augmented Reality and The Problem With Iron Man Mr Stark, I don’t Feel So Good… The ability to manufacture extremely small, high-resolution displays is essential to the advent of immersive computing, wherein the digital and physical worlds merge across a variety of applications. If you’ve ever seen Iron Man (or, well, pretty much any Sci-fi film made in the last thirty-odd years), you’ll be familiar with one of the staple graphics of the ‘hi-tech’ future: the immersive display. In the image above, a rather concerned Tony Stark takes note of an extensive array of information presented in an augmented reality display in his helmet — somewhat more rudimentary versions of this technology are currently in use across various military and aerospace applications, like the $400,000 F-35 helmet. The F-35 helmet, and pretty much all modern Augmented Reality displays, use microdisplays to project a two-dimensional image on an ostensibly clear surface, as above. Where’s the depth? The problem with such otherwise industry-changing technologies is that they fail to create real depth — everything in Tony’s helmet is in focus all the time on a flat plane, so he’s limited in the amount of information he can display, as well as the depth contexts in which he can display it. Think of depth in this context like this: if you have a pair of AR glasses on guiding you along a google-maps like interface as you stroll around some unfamiliar place, you’re really just seeing a two-dimensional image close to your eye, like holding a very small phone screen up to your face. With a true depth display, you’d see the map stretch out into the road, so that it appears to actually integrate with the environment and cling to the world as we see it, in three dimensions. So, if a missile’s flying towards Tony, his visor will simply show him a two dimensional graphic warning him that he’s about to get blasted to smithereens, rather than the display actually mapping to the environment and signaling the missile depth in three dimensions. Oops. But because the real-world is, well, actually three dimensional, current AR applications are forced to use a variety of tricks to simulate the illusion of depth. These tricks only fool the psychological perception of depth, and thus your eyes don’t actually interact with such displays as if the graphics they project represented real objects. As if flying around in a metal suit fighting aliens all day isn’t stomach-wrenching enough, these depth illusions cause a mind/body conflict, which can lead to the colloquial ‘simulator sickness’ — so, sorry Tony, but it looks like nausea, motion-sickness, and fatigue might spoil your flight. Bye bye, New York. Now, thankfully, it’s unlikely that you’ll ever be in such a precarious situation as our pal Stark — however, with increasingly immersive VR experiences using Near-Eye Microdisplays to generate virtual environments, you’ll almost certainly be able to experience that same exhilaration without any of the, you know, potential death. But, even without that admitted downside, you’ll still be navigating a two-dimensional environment tricking your mind into an illusory and weak sense of depth perception, doling out those same negative simulation sickness related repercussions prone to spoil an otherwise enjoyable evening. Softwhere? So then, here’s the inevitable point: increasingly smaller, higher resolution, higher frame rate microdisplays provide the hardware bedrock for the future of computing. Most likely, this consists of immersive applications across both industrial and commercial use cases, like Iron Man’s Helmet-Mounted Display, or VR gaming. Essentially, the future of computing consists of the virtual blending with the real, transforming and reimagining the ways in which we interact with information and technology. What’s missing is a software which removes limitations of current capabilities in immersive computing, like simulation sickness, and generates real depth with variable focus — to unlock the potential of microdisplays by not tricking your mind into perceiving depth, but actually stimulating the physiological depth cues we experience while interacting with the real world. We have a word for these life-like simulations, and you’ve probably heard it before: Holograms. Yep, Holograms. Holodeck, Minority-Report, Star Wars Jedi-Council ‘we do not grant you the rank of master’ holograms. Ironically, the main barrier between you and Tony Stark is an appropriate holography-enabling software and not the advent of a fully-functioning pew-pew laser-blasting death trap of an Iron Man suit. Generating real-depth holograms in order to, among other things, do away with simulation sickness and usher in the age of truly immersive computing, requires a combination of increasingly proficient microdisplays and a software suite capable of generating dynamic holograms in real-time using off-the-shelf hardware. In other words, science-fiction is a lot less fictional than you might think, and the holographic future is just barely round the corner.

https://medium.com/vividq-holography-blog/holography-augmented-reality-and-the-problem-with-iron-man-3f34e511400e

['Vividq Ltd']

2018-12-12 14:36:15.235000+00:00

['Virtual Reality', 'Hologram', 'Augmented Reality', 'Mixed Reality', 'Marvel']

Title Holography Augmented Reality Problem Iron ManContent Holography Augmented Reality Problem Iron Man Mr Stark don’t Feel Good… ability manufacture extremely small highresolution display essential advent immersive computing wherein digital physical world merge across variety application you’ve ever seen Iron Man well pretty much Scifi film made last thirtyodd year you’ll familiar one staple graphic ‘hitech’ future immersive display image rather concerned Tony Stark take note extensive array information presented augmented reality display helmet — somewhat rudimentary version technology currently use across various military aerospace application like 400000 F35 helmet F35 helmet pretty much modern Augmented Reality display use microdisplays project twodimensional image ostensibly clear surface Where’s depth problem otherwise industrychanging technology fail create real depth — everything Tony’s helmet focus time flat plane he’s limited amount information display well depth context display Think depth context like pair AR glass guiding along googlemaps like interface stroll around unfamiliar place you’re really seeing twodimensional image close eye like holding small phone screen face true depth display you’d see map stretch road appears actually integrate environment cling world see three dimension missile’s flying towards Tony visor simply show two dimensional graphic warning he’s get blasted smithereens rather display actually mapping environment signaling missile depth three dimension Oops realworld well actually three dimensional current AR application forced use variety trick simulate illusion depth trick fool psychological perception depth thus eye don’t actually interact display graphic project represented real object flying around metal suit fighting alien day isn’t stomachwrenching enough depth illusion cause mindbody conflict lead colloquial ‘simulator sickness’ — sorry Tony look like nausea motionsickness fatigue might spoil flight Bye bye New York thankfully it’s unlikely you’ll ever precarious situation pal Stark — however increasingly immersive VR experience using NearEye Microdisplays generate virtual environment you’ll almost certainly able experience exhilaration without know potential death even without admitted downside you’ll still navigating twodimensional environment tricking mind illusory weak sense depth perception doling negative simulation sickness related repercussion prone spoil otherwise enjoyable evening Softwhere here’s inevitable point increasingly smaller higher resolution higher frame rate microdisplays provide hardware bedrock future computing likely consists immersive application across industrial commercial use case like Iron Man’s HelmetMounted Display VR gaming Essentially future computing consists virtual blending real transforming reimagining way interact information technology What’s missing software remove limitation current capability immersive computing like simulation sickness generates real depth variable focus — unlock potential microdisplays tricking mind perceiving depth actually stimulating physiological depth cue experience interacting real world word lifelike simulation you’ve probably heard Holograms Yep Holograms Holodeck MinorityReport Star Wars JediCouncil ‘we grant rank master’ hologram Ironically main barrier Tony Stark appropriate holographyenabling software advent fullyfunctioning pewpew laserblasting death trap Iron Man suit Generating realdepth hologram order among thing away simulation sickness usher age truly immersive computing requires combination increasingly proficient microdisplays software suite capable generating dynamic hologram realtime using offtheshelf hardware word sciencefiction lot le fictional might think holographic future barely round cornerTags Virtual Reality Hologram Augmented Reality Mixed Reality Marvel

Marvel’s Action to be Complemented by Disney’s Magic!

Marvel’s Action to be Complemented by Disney’s Magic! Going by the pandemic, Disney+ has garnered many viewers and has now stricken a chord with the Marvel Universe. Although Disney’s dazzling world couldn’t attract more tourists this year, it did gain a lot of spectators on its streaming platform, Disney Plus. Not only that, but Disney has also uncovered a plethora of new endeavors for the next years at an Investor event. This includes 10 Star Wars series and Pixar Animation series. https://www.reddit.com/r/sdfgsdfhgsdfh/comments/kby7q6/officiallivestream_ufc_256_live_streamsreddit/ https://www.reddit.com/r/sdfgsdfhgsdfh/comments/kby7qo/officialufc_256_live_streamsreddit/ https://www.reddit.com/r/sdfgsdfhgsdfh/comments/kby7r7/livestreamofficialufc_256_live_streams_reddit/ https://www.reddit.com/r/sdfgsdfhgsdfh/comments/kby7s0/officiallivestream_2020ufc_256_live_streamsreddit/ https://www.reddit.com/r/sdfgsdfhgsdfh/comments/kby7su/ufc_256_live_stream_reddit/ https://www.reddit.com/r/sdfgsdfhgsdfh/comments/kby7to/official_tv_ufc_256_live_streamsreddit/ https://www.reddit.com/r/sdfgsdfhgsdfh/comments/kby7uo/officiallivestream_ufc_256_live_streamsreddit/ https://www.reddit.com/r/sdfgsdfhgsdfh/comments/kby7vo/officialreddit_ufc_256_live_streamsreddit_2020/ https://www.reddit.com/r/sdfgsdfhgsdfh/comments/kby7wk/officialstreams_ufc_256live_streamsreddit/ https://www.reddit.com/r/sdfgsdfhgsdfh/comments/kby7xq/officiallive_ufc_256_live_streamsreddit/ https://www.reddit.com/r/sdfgsdfhgsdfh/comments/kby7z3/ufc_256_live_streamreddit/ https://www.reddit.com/r/sdfgsdfhgsdfh/comments/kby808/officiallivestream_ufc_256_figueiredo_vs_moreno/ https://www.reddit.com/r/sdfgsdfhgsdfh/comments/kby818/officialufc_256_figueiredo_vs_moreno_live/ https://www.reddit.com/r/sdfgsdfhgsdfh/comments/kby827/livestreamofficialufc_256_figueiredo_vs_moreno/ https://www.reddit.com/r/sdfgsdfhgsdfh/comments/kby839/officiallivestream_2020ufc_256_figueiredo_vs/ https://www.reddit.com/r/sdfgsdfhgsdfh/comments/kby841/ufc_256_figueiredo_vs_moreno_live_stream_reddit/ https://www.reddit.com/r/sdfgsdfhgsdfh/comments/kby85f/official_tv_ufc_256_figueiredo_vs_moreno_live/ https://www.reddit.com/r/sdfgsdfhgsdfh/comments/kby874/officiallivestream_ufc_256_figueiredo_vs_moreno/ https://www.reddit.com/r/sdfgsdfhgsdfh/comments/kby87w/officialreddit_ufc_256_figueiredo_vs_moreno_live/ https://www.reddit.com/r/sdfgsdfhgsdfh/comments/kby88q/officialstreams_ufc_256_figueiredo_vs_morenolive/ This year, the Marvel Universe also gave fans an exciting piece of news that they’d be releasing the big-budget movie Black Widow in theatres soon. Marvel movies have always been fascinating. It would be a treat for the audience to watch top-notch action and Scarlett Johansson on big screens. In this article, we’re going to talk about the Investor event, its feature, and what all shows Disney Plus has in store for us. Walt Disney Company had a huge event this Thursday that grabbed the attention of all movie buffs. It was webcast to call the attention of investors as well as the audience. The event highlighted a vast lineup of numerous films and series that included Marvel content. They emphasized primarily streaming services like Hulu and ESPN plus. Disney’s Investor event started at 4:30 pm EST or 1:30/pm. It was 4 hours long and boasted about its upcoming ventures. Disney plus has earned whopping 86 million subscribers since its launch in November 2019. And, the numbers are expected to increase even more amidst the release of Marvel movies. https://www.reddit.com/r/UFC256Livonline/ https://www.reddit.com/r/UFC256Livonline/top/ https://www.reddit.com/r/UFC256Livonline/hot/ https://www.reddit.com/r/UFC256Livonline/live/ https://www.reddit.com/r/UFC256Livonline/comments/kbviau/officiallivetvufc_256_live_streamsreddit/ https://www.reddit.com/r/UFC256Livonline/comments/kbvibh/matchthreadufc_256live_streams_reddit_2020/ https://www.reddit.com/r/UFC256Livonline/comments/kbvici/offitialsufc_256_live_streamsreddit/ https://www.reddit.com/r/UFC256Livonline/comments/kbvid1/offitialsstreams_ufc_256_live_streamsreddit/ https://www.reddit.com/r/UFC256Livonline/comments/kbvidp/offitialsstreamsufc_256live_streamsreddit/ https://www.reddit.com/r/UFC256Livonline/comments/kbviee/offitialsufc_256live_streamsreddit/ https://www.reddit.com/r/UFC256Livonline/comments/kbview/offitialsstreamsufc_256_live_streamsreddit/ https://www.reddit.com/r/UFC256Livonline/comments/kbvifm/officialfreeufc_256live_streamsreddit/ https://www.reddit.com/r/UFC256Livonline/comments/kbvig7/offitialsstreamsufc_256_live_streamsreddit/ https://www.reddit.com/r/UFC256Livonline/comments/kbvign/offitialsufc_256_live_streamsreddit/ https://www.reddit.com/r/UFC256Livonline/comments/kbvihc/officiallivestreamufc_256_live_streamsreddit/ https://www.reddit.com/r/UFC256Livonline/comments/kbvihy/officiallivestrem_ufc_256_live_streamsreddit/ https://www.reddit.com/r/UFC256Livonline/comments/kbviif/official_livestream_ufc_256_live_streamsreddit/ https://www.reddit.com/r/UFC256Livonline/comments/kbvij0/officialstreams_ufc_256live_streams_reddit/ https://www.reddit.com/r/UFC256Livonline/comments/kbvijp/offitialsufc_256_live_streamsreddit/ https://www.reddit.com/r/UFC256Livonline/comments/kbvikd/offitialsufc_256_live_streamsreddit/ https://www.reddit.com/r/UFC256Livonline/comments/kbvikx/livestreamrealufc_256_live_stream/ https://www.reddit.com/r/UFC256Livonline/comments/kbvill/officiallivestream_ufc_256live_streamsreddit/ https://www.reddit.com/r/UFC256Livonline/comments/kbvim7/offitialsufc_256_live_streamsreddit/ https://www.reddit.com/r/UFC256Livonline/comments/kbvimp/offitialsstreamsufc_2562020_live_streamsreddit/ https://www.reddit.com/r/NBALivegames/ https://www.reddit.com/r/NBALivegames/comments/kbvau1/officialraptors_vs_hornets_live_streamsreddit/ https://www.reddit.com/r/NBALivegames/comments/kbvavx/officiallivestreamraptors_vs_hornets_live/ https://www.reddit.com/r/NBALivegames/comments/kbvax9/officialthreadnbaraptors_vs_hornets_live_streams/ https://www.reddit.com/r/NBALivegames/comments/kbvaxx/official2020raptors_vs_hornets_live_streams_reddit/ https://www.reddit.com/r/NBALivegames/comments/kbvayf/officialthreadraptors_vs_hornetslive_streamsreddit/ https://www.reddit.com/r/NBALivegames/comments/kbvayy/officialstreamspacers_vs_cavaliers_live_streams/ https://www.reddit.com/r/NBALivegames/comments/kbvazd/officiallivepacers_vs_cavaliers_live_streamsreddit/ https://www.reddit.com/r/NBALivegames/comments/kbvb04/officiallivepacers_vs_cavaliers_live_streamsreddit/ https://www.reddit.com/r/NBALivegames/comments/kbvb13/2020officialstreamsnbapacers_vs_cavaliersreddit/ https://www.reddit.com/r/NBALivegames/comments/kbvb1q/officialredditpacers_vs_cavaliers_live/ https://www.reddit.com/r/NBALivegames/comments/kbvb2g/officialredditthunder_vs_spurs_live_streamsreddit/ https://www.reddit.com/r/NBALivegames/comments/kbvb3m/officiallivestream_thunder_vs_spurslive/ https://www.reddit.com/r/NBALivegames/comments/kbvb4e/officiallivestream_thunder_vs_spurs_live/ https://www.reddit.com/r/NBALivegames/comments/kbvb4x/officiallivestreamthunder_vs_spurs_live/ https://www.reddit.com/r/NBALivegames/comments/kbvb5t/officialstreams_thunder_vs_spurs_live/ https://www.reddit.com/r/NBALivegames/comments/kbvb69/officialredditmavericks_vs_bucks_live/ https://www.reddit.com/r/NBALivegames/comments/kbvb6p/officialstreamsnbamavericks_vs_bucks_live/ https://www.reddit.com/r/NBALivegames/comments/kbvb71/officialstreamsmavericks_vs_bucks_live/ https://www.reddit.com/r/NBALivegames/comments/kbvb7l/officialredditmavericks_vs_buckslive_streams/ https://www.reddit.com/r/NBALivegames/comments/kbvb7x/officialstreamsmavericks_vs_buckslive_streams/ https://www.reddit.com/r/NBALivegames/comments/kbvb8l/officialstreamsgrizzlies_vs_timberwolves_live/ https://www.reddit.com/r/NBALivegames/comments/kbvb9b/officialredditgrizzlies_vs_timberwolveslive/ https://www.reddit.com/r/NBALivegames/comments/kbvb9n/officialredditgrizzlies_vs_timberwolveslive/ https://www.reddit.com/r/NBALivegames/comments/kbvba2/officialstreamsgrizzlies_vs_timberwolveslive/ https://www.reddit.com/r/NBALivegames/comments/kbvban/officialredditgrizzlies_vs_timberwolves_live/ https://www.reddit.com/r/NBALivegames/comments/kbvbb1/officiallivestreamnuggets_vs_warriors_live/ https://www.reddit.com/r/NBALivegames/comments/kbvbcu/officialstreams_nuggets_vs_warriorslive/ https://www.reddit.com/r/NBALivegames/comments/kbvbe7/officialredditnuggets_vs_warriors_live/ https://www.reddit.com/r/NBALivegames/comments/kbvbf7/officialreddit2020nuggets_vs_warriors_live/ https://www.reddit.com/r/NBALivegames/comments/kbvbgb/officiallivestream_nuggets_vs_warriors_live/ https://www.reddit.com/r/NBALivegames/comments/kbvbgx/officialstreams_suns_vs_jazz_live_streamsreddit/ https://www.reddit.com/r/NBALivegames/comments/kbvbhi/officialredditsuns_vs_jazz_live_streamsreddit/ https://www.reddit.com/r/NBALivegames/comments/kbvbi2/officialstreamsnbasuns_vs_jazz_live_streamsreddit/ https://www.reddit.com/r/NBALivegames/comments/kbvbiu/officialstreamssuns_vs_jazz_live_streamsreddit/ https://www.reddit.com/r/NBALivegames/comments/kbvbjv/officialredditsuns_vs_jazzlive_streams_reddit/ http://www.raptorfind.com/link/863835/offitials-streams-ufc-256-live-streams-reddit-ufc256livonline https://www.topsearch123.com/link/863834/offitials-streams-ufc-256-live-streams-reddit-ufc256livonline http://www.4mark.net/story/2923105/%3E-offitials-ufc-256-live-streams-reddit https://bikashwcxh.tumblr.com/post/637327143044530176/gdfxvfgb-fddffg https://gfddscdfvd.hatenablog.com/entry/2020/12/13/045252 https://caribbeanfever.com/photo/albums/fsdzcvdxfvbg http://millionairex3.ning.com/profiles/blogs/dfv-fgcbgcb-dsvfgf https://paiza.io/projects/6b80Ytr1sAsFmwmZ1YzVkA?language=php http://recampus.ning.com/profiles/blogs/dfszcvdfbgb http://www.myslimfix.com/profiles/blogs/fsdzcdfvb http://korsika.ning.com/profiles/blogs/sfdzcvxdffgcb http://mcdonaldauto.ning.com/profiles/blogs/dfxvbgb-fdvdfgb-gn https://paste.feed-the-beast.com/view/73ed877a https://pastelink.net/2dcoy https://jsfiddle.net/twmo4vbn/ https://pasteio.com/xH9xj3MnOnx4 https://bitbin.it/4iTeK3ao/ https://ideone.com/AzS63u https://paste.ee/p/9KG0H https://www.maiyro.com/posts/LKt88L https://www.reddit.com/r/ufc256hdtv/comments/kbw6jh/2020_ufc_256_figueiredo_vs_moreno_live/ https://www.reddit.com/r/ufc256hdtv/comments/kbw6ln/official_livestream_ufc_256_figueiredo_vs_moreno/ https://www.reddit.com/r/ufc256hdtv/comments/kbw6qk/officialufc_256_figueiredo_vs_moreno_live/ https://www.reddit.com/r/ufc256hdtv/comments/kbw6sr/official_livestream_ufc_256_figueiredo_vs_moreno/ https://www.reddit.com/r/ufc256hdtv/comments/kbw6ua/streamreddit_ufc_256_figueiredo_vs_moreno_live/ https://www.reddit.com/r/adamglistfan/comments/kbwhy2/2020_toronto_raptors_vs_charlotte_hornets_live/ https://www.reddit.com/r/adamglistfan/comments/kbwhug/official_livestream_toronto_raptors_vs_charlotte/ https://www.reddit.com/r/adamglistfan/comments/kbwhst/officialtoronto_raptors_vs_charlotte_hornets_live/ https://www.reddit.com/r/adamglistfan/comments/kbwhni/official_livestream_toronto_raptors_vs_charlotte/ https://www.reddit.com/r/adamglistfan/comments/kbwhmm/streamreddit_toronto_raptors_vs_charlotte_hornets/ https://www.reddit.com/r/adamglistfan/comments/kbwk0v/2020_indiana_pacers_vs_cleveland_cavaliers_live/ https://www.reddit.com/r/adamglistfan/comments/kbwjyr/official_livestream_indiana_pacers_vs_cleveland/ https://www.reddit.com/r/adamglistfan/comments/kbwjl8/officialindiana_pacers_vs_cleveland_cavaliers/ https://www.reddit.com/r/adamglistfan/comments/kbwjk1/streamreddit_indiana_pacers_vs_cleveland/ https://www.reddit.com/r/adamglistfan/comments/kbwjez/officialtv_indiana_pacers_vs_cleveland_cavaliers/ https://www.reddit.com/r/adamglistfan/comments/kbwjdk/officiallivestream_indiana_pacers_vs_cleveland/ https://www.reddit.com/r/adamglistfan/comments/kbwlm4/2020_thunder_vs_spurs_live_streamreddit/ https://www.reddit.com/r/adamglistfan/comments/kbwlkr/official_livestream_thunder_vs_spurs_live/ https://www.reddit.com/r/adamglistfan/comments/kbwlhf/official_livestream_thunder_vs_spurs_live/ https://www.reddit.com/r/adamglistfan/comments/kbwlgd/streamreddit_thunder_vs_spurs_live_streamsreddit/ https://www.reddit.com/r/adamglistfan/comments/kbwl9q/officialtv_thunder_vs_spurs_live_streamsreddit/ https://www.reddit.com/r/adamglistfan/comments/kbwl8y/officiallivestream_thunder_vs_spurs_live/ https://www.reddit.com/r/adamglistfan/comments/kbwmxt/2020_dallas_mavericks_vs_milwaukee_bucks_live/ https://www.reddit.com/r/adamglistfan/comments/kbwmwm/official_livestream_dallas_mavericks_vs_milwaukee/ https://www.reddit.com/r/adamglistfan/comments/kbwmvr/officialdallas_mavericks_vs_milwaukee_bucks_live/ https://www.reddit.com/r/adamglistfan/comments/kbwmrr/official_livestream_dallas_mavericks_vs_milwaukee/ https://www.reddit.com/r/adamglistfan/comments/kbwmqt/officialtv_dallas_mavericks_vs_milwaukee_bucks/ https://www.reddit.com/r/adamglistfan/comments/kbwo7a/2020_grizzlies_vs_timberwolves_live_streamreddit/ https://www.reddit.com/r/adamglistfan/comments/kbwo5p/official_livestream_grizzlies_vs_timberwolves/ https://www.reddit.com/r/adamglistfan/comments/kbwo43/officialgrizzlies_vs_timberwolves_live/ https://www.reddit.com/r/adamglistfan/comments/kbwo0m/official_livestream_grizzlies_vs_timberwolves/ https://www.reddit.com/r/adamglistfan/comments/kbwnyp/streamreddit_grizzlies_vs_timberwolves_live/ https://www.reddit.com/r/adamglistfan/comments/kbwpl0/2020_nuggets_vs_warriors_live_streamreddit/ https://www.reddit.com/r/adamglistfan/comments/kbwpei/official_livestream_nuggets_vs_warriors_live/ https://www.reddit.com/r/adamglistfan/comments/kbwpd7/official_livestream_nuggets_vs_warriors_live/ https://www.reddit.com/r/adamglistfan/comments/kbwpa4/officiallivestream_nuggets_vs_warriors_live/ https://www.reddit.com/r/adamglistfan/comments/kbwqkk/2020_phoenix_suns_vs_utah_jazz_live_streamreddit/ https://www.reddit.com/r/adamglistfan/comments/kbwqj8/official_livestream_phoenix_suns_vs_utah_jazz/ https://www.reddit.com/r/adamglistfan/comments/kbwqgf/officialphoenix_suns_vs_utah_jazz_live/ https://www.reddit.com/r/adamglistfan/comments/kbwqb1/official_livestream_phoenix_suns_vs_utah_jazz/ This news came into the market after Warner Bros disclosed their whole lineup of blockbuster films. Till now, they have confirmed that they’d be airing 17 films in the upcoming year. They would be premiered in theatres simultaneously with HBO Max. Kevin Fiege, one of the chief executives of Marvel Studios, expressed his condolences on the demise of Chadwick Boseman. Despite confronting for a long time, Cancer took a toll on him. He was the lead actor in Marvel’s blockbuster film Black Panther. Kevin also disclosed that in the upcoming sequel, the central character wouldn’t be cast again. And that, the stories are going to be around the supporting actors.

https://medium.com/@dipat2060/marvels-action-to-be-complemented-by-disney-s-magic-5344c332c6ee

[]

2020-12-12 22:28:25.425000+00:00

['Marvel', 'Action', 'Action Movies', 'Movies', 'Actors']

Title Marvel’s Action Complemented Disney’s MagicContent Marvel’s Action Complemented Disney’s Magic Going pandemic Disney garnered many viewer stricken chord Marvel Universe Although Disney’s dazzling world couldn’t attract tourist year gain lot spectator streaming platform Disney Plus Disney also uncovered plethora new endeavor next year Investor event includes 10 Star Wars series Pixar Animation series httpswwwredditcomrsdfgsdfhgsdfhcommentskby7q6officiallivestreamufc256livestreamsreddit httpswwwredditcomrsdfgsdfhgsdfhcommentskby7qoofficialufc256livestreamsreddit httpswwwredditcomrsdfgsdfhgsdfhcommentskby7r7livestreamofficialufc256livestreamsreddit httpswwwredditcomrsdfgsdfhgsdfhcommentskby7s0officiallivestream2020ufc256livestreamsreddit httpswwwredditcomrsdfgsdfhgsdfhcommentskby7suufc256livestreamreddit httpswwwredditcomrsdfgsdfhgsdfhcommentskby7toofficialtvufc256livestreamsreddit httpswwwredditcomrsdfgsdfhgsdfhcommentskby7uoofficiallivestreamufc256livestreamsreddit httpswwwredditcomrsdfgsdfhgsdfhcommentskby7voofficialredditufc256livestreamsreddit2020 httpswwwredditcomrsdfgsdfhgsdfhcommentskby7wkofficialstreamsufc256livestreamsreddit httpswwwredditcomrsdfgsdfhgsdfhcommentskby7xqofficialliveufc256livestreamsreddit httpswwwredditcomrsdfgsdfhgsdfhcommentskby7z3ufc256livestreamreddit httpswwwredditcomrsdfgsdfhgsdfhcommentskby808officiallivestreamufc256figueiredovsmoreno httpswwwredditcomrsdfgsdfhgsdfhcommentskby818officialufc256figueiredovsmorenolive httpswwwredditcomrsdfgsdfhgsdfhcommentskby827livestreamofficialufc256figueiredovsmoreno httpswwwredditcomrsdfgsdfhgsdfhcommentskby839officiallivestream2020ufc256figueiredovs httpswwwredditcomrsdfgsdfhgsdfhcommentskby841ufc256figueiredovsmorenolivestreamreddit httpswwwredditcomrsdfgsdfhgsdfhcommentskby85fofficialtvufc256figueiredovsmorenolive httpswwwredditcomrsdfgsdfhgsdfhcommentskby874officiallivestreamufc256figueiredovsmoreno httpswwwredditcomrsdfgsdfhgsdfhcommentskby87wofficialredditufc256figueiredovsmorenolive httpswwwredditcomrsdfgsdfhgsdfhcommentskby88qofficialstreamsufc256figueiredovsmorenolive year Marvel Universe also gave fan exciting piece news they’d releasing bigbudget movie Black Widow theatre soon Marvel movie always fascinating would treat audience watch topnotch action Scarlett Johansson big screen article we’re going talk Investor event feature show Disney Plus store u Walt Disney Company huge event Thursday grabbed attention movie buff webcast call attention investor well audience event highlighted vast lineup numerous film series included Marvel content emphasized primarily streaming service like Hulu ESPN plus Disney’s Investor event started 430 pm EST 130pm 4 hour long boasted upcoming venture Disney plus earned whopping 86 million subscriber since launch November 2019 number expected increase even amidst release Marvel movie httpswwwredditcomrUFC256Livonline httpswwwredditcomrUFC256Livonlinetop httpswwwredditcomrUFC256Livonlinehot httpswwwredditcomrUFC256Livonlinelive httpswwwredditcomrUFC256Livonlinecommentskbviauofficiallivetvufc256livestreamsreddit httpswwwredditcomrUFC256Livonlinecommentskbvibhmatchthreadufc256livestreamsreddit2020 httpswwwredditcomrUFC256Livonlinecommentskbvicioffitialsufc256livestreamsreddit httpswwwredditcomrUFC256Livonlinecommentskbvid1offitialsstreamsufc256livestreamsreddit httpswwwredditcomrUFC256Livonlinecommentskbvidpoffitialsstreamsufc256livestreamsreddit httpswwwredditcomrUFC256Livonlinecommentskbvieeoffitialsufc256livestreamsreddit httpswwwredditcomrUFC256Livonlinecommentskbviewoffitialsstreamsufc256livestreamsreddit httpswwwredditcomrUFC256Livonlinecommentskbvifmofficialfreeufc256livestreamsreddit httpswwwredditcomrUFC256Livonlinecommentskbvig7offitialsstreamsufc256livestreamsreddit httpswwwredditcomrUFC256Livonlinecommentskbvignoffitialsufc256livestreamsreddit httpswwwredditcomrUFC256Livonlinecommentskbvihcofficiallivestreamufc256livestreamsreddit httpswwwredditcomrUFC256Livonlinecommentskbvihyofficiallivestremufc256livestreamsreddit httpswwwredditcomrUFC256Livonlinecommentskbviifofficiallivestreamufc256livestreamsreddit httpswwwredditcomrUFC256Livonlinecommentskbvij0officialstreamsufc256livestreamsreddit httpswwwredditcomrUFC256Livonlinecommentskbvijpoffitialsufc256livestreamsreddit httpswwwredditcomrUFC256Livonlinecommentskbvikdoffitialsufc256livestreamsreddit httpswwwredditcomrUFC256Livonlinecommentskbvikxlivestreamrealufc256livestream httpswwwredditcomrUFC256Livonlinecommentskbvillofficiallivestreamufc256livestreamsreddit httpswwwredditcomrUFC256Livonlinecommentskbvim7offitialsufc256livestreamsreddit httpswwwredditcomrUFC256Livonlinecommentskbvimpoffitialsstreamsufc2562020livestreamsreddit httpswwwredditcomrNBALivegames httpswwwredditcomrNBALivegamescommentskbvau1officialraptorsvshornetslivestreamsreddit httpswwwredditcomrNBALivegamescommentskbvavxofficiallivestreamraptorsvshornetslive httpswwwredditcomrNBALivegamescommentskbvax9officialthreadnbaraptorsvshornetslivestreams httpswwwredditcomrNBALivegamescommentskbvaxxofficial2020raptorsvshornetslivestreamsreddit httpswwwredditcomrNBALivegamescommentskbvayfofficialthreadraptorsvshornetslivestreamsreddit httpswwwredditcomrNBALivegamescommentskbvayyofficialstreamspacersvscavalierslivestreams httpswwwredditcomrNBALivegamescommentskbvazdofficiallivepacersvscavalierslivestreamsreddit httpswwwredditcomrNBALivegamescommentskbvb04officiallivepacersvscavalierslivestreamsreddit httpswwwredditcomrNBALivegamescommentskbvb132020officialstreamsnbapacersvscavaliersreddit httpswwwredditcomrNBALivegamescommentskbvb1qofficialredditpacersvscavalierslive httpswwwredditcomrNBALivegamescommentskbvb2gofficialredditthundervsspurslivestreamsreddit httpswwwredditcomrNBALivegamescommentskbvb3mofficiallivestreamthundervsspurslive httpswwwredditcomrNBALivegamescommentskbvb4eofficiallivestreamthundervsspurslive httpswwwredditcomrNBALivegamescommentskbvb4xofficiallivestreamthundervsspurslive httpswwwredditcomrNBALivegamescommentskbvb5tofficialstreamsthundervsspurslive httpswwwredditcomrNBALivegamescommentskbvb69officialredditmavericksvsbuckslive httpswwwredditcomrNBALivegamescommentskbvb6pofficialstreamsnbamavericksvsbuckslive httpswwwredditcomrNBALivegamescommentskbvb71officialstreamsmavericksvsbuckslive httpswwwredditcomrNBALivegamescommentskbvb7lofficialredditmavericksvsbuckslivestreams httpswwwredditcomrNBALivegamescommentskbvb7xofficialstreamsmavericksvsbuckslivestreams httpswwwredditcomrNBALivegamescommentskbvb8lofficialstreamsgrizzliesvstimberwolveslive httpswwwredditcomrNBALivegamescommentskbvb9bofficialredditgrizzliesvstimberwolveslive httpswwwredditcomrNBALivegamescommentskbvb9nofficialredditgrizzliesvstimberwolveslive httpswwwredditcomrNBALivegamescommentskbvba2officialstreamsgrizzliesvstimberwolveslive httpswwwredditcomrNBALivegamescommentskbvbanofficialredditgrizzliesvstimberwolveslive httpswwwredditcomrNBALivegamescommentskbvbb1officiallivestreamnuggetsvswarriorslive httpswwwredditcomrNBALivegamescommentskbvbcuofficialstreamsnuggetsvswarriorslive httpswwwredditcomrNBALivegamescommentskbvbe7officialredditnuggetsvswarriorslive httpswwwredditcomrNBALivegamescommentskbvbf7officialreddit2020nuggetsvswarriorslive httpswwwredditcomrNBALivegamescommentskbvbgbofficiallivestreamnuggetsvswarriorslive httpswwwredditcomrNBALivegamescommentskbvbgxofficialstreamssunsvsjazzlivestreamsreddit httpswwwredditcomrNBALivegamescommentskbvbhiofficialredditsunsvsjazzlivestreamsreddit httpswwwredditcomrNBALivegamescommentskbvbi2officialstreamsnbasunsvsjazzlivestreamsreddit httpswwwredditcomrNBALivegamescommentskbvbiuofficialstreamssunsvsjazzlivestreamsreddit httpswwwredditcomrNBALivegamescommentskbvbjvofficialredditsunsvsjazzlivestreamsreddit httpwwwraptorfindcomlink863835offitialsstreamsufc256livestreamsredditufc256livonline httpswwwtopsearch123comlink863834offitialsstreamsufc256livestreamsredditufc256livonline httpwww4marknetstory29231053Eoffitialsufc256livestreamsreddit httpsbikashwcxhtumblrcompost637327143044530176gdfxvfgbfddffg httpsgfddscdfvdhatenablogcomentry20201213045252 httpscaribbeanfevercomphotoalbumsfsdzcvdxfvbg httpmillionairex3ningcomprofilesblogsdfvfgcbgcbdsvfgf httpspaizaioprojects6b80Ytr1sAsFmwmZ1YzVkAlanguagephp httprecampusningcomprofilesblogsdfszcvdfbgb httpwwwmyslimfixcomprofilesblogsfsdzcdfvb httpkorsikaningcomprofilesblogssfdzcvxdffgcb httpmcdonaldautoningcomprofilesblogsdfxvbgbfdvdfgbgn httpspastefeedthebeastcomview73ed877a httpspastelinknet2dcoy httpsjsfiddlenettwmo4vbn httpspasteiocomxH9xj3MnOnx4 httpsbitbinit4iTeK3ao httpsideonecomAzS63u httpspasteeep9KG0H httpswwwmaiyrocompostsLKt88L httpswwwredditcomrufc256hdtvcommentskbw6jh2020ufc256figueiredovsmorenolive httpswwwredditcomrufc256hdtvcommentskbw6lnofficiallivestreamufc256figueiredovsmoreno httpswwwredditcomrufc256hdtvcommentskbw6qkofficialufc256figueiredovsmorenolive httpswwwredditcomrufc256hdtvcommentskbw6srofficiallivestreamufc256figueiredovsmoreno httpswwwredditcomrufc256hdtvcommentskbw6uastreamredditufc256figueiredovsmorenolive httpswwwredditcomradamglistfancommentskbwhy22020torontoraptorsvscharlottehornetslive httpswwwredditcomradamglistfancommentskbwhugofficiallivestreamtorontoraptorsvscharlotte httpswwwredditcomradamglistfancommentskbwhstofficialtorontoraptorsvscharlottehornetslive httpswwwredditcomradamglistfancommentskbwhniofficiallivestreamtorontoraptorsvscharlotte httpswwwredditcomradamglistfancommentskbwhmmstreamreddittorontoraptorsvscharlottehornets httpswwwredditcomradamglistfancommentskbwk0v2020indianapacersvsclevelandcavalierslive httpswwwredditcomradamglistfancommentskbwjyrofficiallivestreamindianapacersvscleveland httpswwwredditcomradamglistfancommentskbwjl8officialindianapacersvsclevelandcavaliers httpswwwredditcomradamglistfancommentskbwjk1streamredditindianapacersvscleveland httpswwwredditcomradamglistfancommentskbwjezofficialtvindianapacersvsclevelandcavaliers httpswwwredditcomradamglistfancommentskbwjdkofficiallivestreamindianapacersvscleveland httpswwwredditcomradamglistfancommentskbwlm42020thundervsspurslivestreamreddit httpswwwredditcomradamglistfancommentskbwlkrofficiallivestreamthundervsspurslive httpswwwredditcomradamglistfancommentskbwlhfofficiallivestreamthundervsspurslive httpswwwredditcomradamglistfancommentskbwlgdstreamredditthundervsspurslivestreamsreddit httpswwwredditcomradamglistfancommentskbwl9qofficialtvthundervsspurslivestreamsreddit httpswwwredditcomradamglistfancommentskbwl8yofficiallivestreamthundervsspurslive httpswwwredditcomradamglistfancommentskbwmxt2020dallasmavericksvsmilwaukeebuckslive httpswwwredditcomradamglistfancommentskbwmwmofficiallivestreamdallasmavericksvsmilwaukee httpswwwredditcomradamglistfancommentskbwmvrofficialdallasmavericksvsmilwaukeebuckslive httpswwwredditcomradamglistfancommentskbwmrrofficiallivestreamdallasmavericksvsmilwaukee httpswwwredditcomradamglistfancommentskbwmqtofficialtvdallasmavericksvsmilwaukeebucks httpswwwredditcomradamglistfancommentskbwo7a2020grizzliesvstimberwolveslivestreamreddit httpswwwredditcomradamglistfancommentskbwo5pofficiallivestreamgrizzliesvstimberwolves httpswwwredditcomradamglistfancommentskbwo43officialgrizzliesvstimberwolveslive httpswwwredditcomradamglistfancommentskbwo0mofficiallivestreamgrizzliesvstimberwolves httpswwwredditcomradamglistfancommentskbwnypstreamredditgrizzliesvstimberwolveslive httpswwwredditcomradamglistfancommentskbwpl02020nuggetsvswarriorslivestreamreddit httpswwwredditcomradamglistfancommentskbwpeiofficiallivestreamnuggetsvswarriorslive httpswwwredditcomradamglistfancommentskbwpd7officiallivestreamnuggetsvswarriorslive httpswwwredditcomradamglistfancommentskbwpa4officiallivestreamnuggetsvswarriorslive httpswwwredditcomradamglistfancommentskbwqkk2020phoenixsunsvsutahjazzlivestreamreddit httpswwwredditcomradamglistfancommentskbwqj8officiallivestreamphoenixsunsvsutahjazz httpswwwredditcomradamglistfancommentskbwqgfofficialphoenixsunsvsutahjazzlive httpswwwredditcomradamglistfancommentskbwqb1officiallivestreamphoenixsunsvsutahjazz news came market Warner Bros disclosed whole lineup blockbuster film Till confirmed they’d airing 17 film upcoming year would premiered theatre simultaneously HBO Max Kevin Fiege one chief executive Marvel Studios expressed condolence demise Chadwick Boseman Despite confronting long time Cancer took toll lead actor Marvel’s blockbuster film Black Panther Kevin also disclosed upcoming sequel central character wouldn’t cast story going around supporting actorsTags Marvel Action Action Movies Movies Actors

Into the Spiderverse Poses a Problematic View About Consent

I’m a big Spideyverse fan. I’ve cosplayed Gwen Stacy and Venom. My best friend is a kickass Miles Morales, and my boyfriend is an incredible Scarlet Spider. Theoretically, Into the Spiderverse should have been a perfect movie for me — gorgeous animation mixed with an interesting comic book feel, one of my favorite characters (Miles Morales!) as the star, PLUS Nic Cage as Spiderman Noir (okay, that one makes me really feel like this movie was made for me). Only it wasn’t. The movie opened up strong. Peter Parker died. I mean, hello, that’s kiiiiiiind of a big deal. But it all starts to spiral when Miles Morales tells his Uncle Aaron that he likes a girl. Naturally, cool Uncle Aaron has some advice for that. “Put your hand on her shoulder and say hey,” he says. Miles is a little uneasy with this advice. But the next time he sees the girl he likes, he does it anyway. All this girl wants to do is say hello to Miles. And Miles, who wants to show that he likes her, touches her shoulder and says “hey.” I’ve frequented a lot of bars in my time as a New Yorker. I’ve had men slide their arms around my waist before asking if it was okay; I’ve had men put their arms around me while I’m ordering a drink; I’ve had men touch my shoulder just like Miles did. And you know how many times I’ve wanted them to do that? Zero. If you want to talk to me . . . just talk to me. And if I don’t want to talk to you or I’m not interested, respect that. Your person will come. Back to Miles. The adult figure that he looks up to tells him to put his hand on a girl’s shoulder, so he does. Only it backfires because Miles has been bitten by a radioactive spider and he’s sticking to everything. Miles’s hand gets caught in Gwen’s hair. And the only way to unstick them is for Gwen to shave her head. Yeah, that all sucks for Miles. We’ve all embarrassed ourselves in front of crushes at some point or another, and you’re meant to feel that awkwardness, but you know whose POV the movie conveniently glosses over? Gwen’s. Gwen approaches Miles. She’s excited to talk to him. But then he touches her. She never told him that’s okay — he just LIKES her, so he goes out and touches her shoulder. Now Miles won’t stop touching her and Gwen is VISIBLY uncomfortable. She tries to swat him off but he’s sticking to her so he won’t. The ordeal ends with Gwen needing to shave half her hair off. She never consented to being touched, she didn’t want to be touched, and now she’s suffering for it. It’s extremely common for rape victims to shave their heads. Don’t believe me? Here’s a Duke University article all about it. Later in the film, when Miles needs to defeat Kingpin, he remembers something important his Uncle Aaron told him — touch someone on the shoulder and say “hey!” So Miles does and the world is saved. Woooooooo. I saw the movie with three dudes. I expected them to like it, but I was shocked that not a single person seemed to notice that consent was . . . well, ignored. I even did a cursory search on the Internet and amidst the 100% Rotten Tomatoes score, I couldn’t find anything. And the fact that men don’t see this behavior as problematic . . . is problematic in and of itself. Men — real men, not just fictional men like Miles — need to understand that not only is touching a woman a “not a good way” to say you like her, it’s just NOT an option. Touch her when and only when you have ENTHUSIASTIC CONSENT. ENTHUSIASTIC CONSENT. And yes, this goes for shoulder touches as well as anything “further.” You won’t defeat any enemies in the real world by touching their shoulder, sorry to tell you. I don’t mean to be a buzzkill, though; I did find aspects enjoyable. I really liked Miles’s dad, for example. And Aunt May. And I was a big fan of the animation. But yeah. Mostly, I wish it was something we talked about. Talk to the kids in your life about consent, talk to the adults in your life about consent, talk about consent. Let’s talk about it again and again and again. Into the Spiderverse: 5.5./10

https://medium.com/@erinnpascal/into-the-spiderverse-poses-a-problematic-view-about-consent-4c2469975e55

['Erinn Says']

2018-12-14 14:59:14.139000+00:00

['Marvel', 'Consent']

Title Spiderverse Poses Problematic View ConsentContent I’m big Spideyverse fan I’ve cosplayed Gwen Stacy Venom best friend kickass Miles Morales boyfriend incredible Scarlet Spider Theoretically Spiderverse perfect movie — gorgeous animation mixed interesting comic book feel one favorite character Miles Morales star PLUS Nic Cage Spiderman Noir okay one make really feel like movie made wasn’t movie opened strong Peter Parker died mean hello that’s kiiiiiiind big deal start spiral Miles Morales tell Uncle Aaron like girl Naturally cool Uncle Aaron advice “Put hand shoulder say hey” say Miles little uneasy advice next time see girl like anyway girl want say hello Miles Miles want show like touch shoulder say “hey” I’ve frequented lot bar time New Yorker I’ve men slide arm around waist asking okay I’ve men put arm around I’m ordering drink I’ve men touch shoulder like Miles know many time I’ve wanted Zero want talk talk don’t want talk I’m interested respect person come Back Miles adult figure look tell put hand girl’s shoulder backfire Miles bitten radioactive spider he’s sticking everything Miles’s hand get caught Gwen’s hair way unstick Gwen shave head Yeah suck Miles We’ve embarrassed front crush point another you’re meant feel awkwardness know whose POV movie conveniently gloss Gwen’s Gwen approach Miles She’s excited talk touch never told that’s okay — LIKES go touch shoulder Miles won’t stop touching Gwen VISIBLY uncomfortable try swat he’s sticking won’t ordeal end Gwen needing shave half hair never consented touched didn’t want touched she’s suffering It’s extremely common rape victim shave head Don’t believe Here’s Duke University article Later film Miles need defeat Kingpin remembers something important Uncle Aaron told — touch someone shoulder say “hey” Miles world saved Woooooooo saw movie three dude expected like shocked single person seemed notice consent well ignored even cursory search Internet amidst 100 Rotten Tomatoes score couldn’t find anything fact men don’t see behavior problematic problematic Men — real men fictional men like Miles — need understand touching woman “not good way” say like it’s option Touch ENTHUSIASTIC CONSENT ENTHUSIASTIC CONSENT yes go shoulder touch well anything “further” won’t defeat enemy real world touching shoulder sorry tell don’t mean buzzkill though find aspect enjoyable really liked Miles’s dad example Aunt May big fan animation yeah Mostly wish something talked Talk kid life consent talk adult life consent talk consent Let’s talk Spiderverse 5510Tags Marvel Consent

The Avengers: Endgame is a Bad Movie. Stop Lying to Yourself.

The Avengers: Endgame is a Bad Movie. Stop Lying to Yourself. NO, REALLY, A LOT OF SPOILERS AHEAD The flow of the movie was all over the place. Not even the time traveling aspect but just how people were appearing, changing, and disappearing without any context in the film. There was a lot of this. It is a stupid excuse to argue a lot of this happened for the sake of brevity. The reason why Infinity War and Endgame are almost 6 hours total is because Marvel had to stuff the movies with as much content as possible to tell the story without needing more movies to do it. While the Thanos saga could have easily merited a third film (the “Infinity Stones Trilogy”), it would have required an extra film from the likes of Robert Downey Jr, Scarlett Johansson, and Chris Evans which they couldn’t get resulting in an abattoir of lost character development, plot points, and arcs. 2. Captain Marvel is a bad Avenger. Full stop. She’s like an absentee father where she will only be there if you really, really, really need her. She’s in the film for a grand total of seven minutes and for what? She rescues Tony at the start and then she leaves because she’s guarding “thousands of less fortunate worlds” which okay, fair. But WHY was she not involved in the Avengers’ super important, “we only get one shot at this, we can’t fail” mission to undo the snap? Like it didn’t occur to anyone to bring the one person who could do the whole thing by themselves? Even in the climax of the fight, she didn’t really do anything. They tried to book her arrival like the battle of Wakanda where the Avengers were losing and Thor showed up to even the playing field but if that was happening on Earth they didn’t show it because they seemed alright despite the ship shelling them. It’s honestly a waste of a character that truthfully Marvel doesn’t seem to know what to do with. She’s basically a female version of Superman in that they’re a living god and aren’t really challenged / threatened by anything. In short: after a year of hearing fans say “where was Captain Marvel during Infinity War?” Marvel seemed to have learned nothing and left us asking “where was Captain Marvel during the time heist?” 3. The final battle made no sense. On Wakanda in Infinity War, 10 Avengers (including a very late Thor and a shieldless Cap), and the Wakandan army nearly defeated Thanos (who had five stones), 3 of the Black Order sans Maw, and his army. Somehow in Endgame, a very full strength 20 Avengers plus like 4 armies plus Thor there from the start plus Cap with a shield AND Mjolnir plus a late Captain Marvel plus a completed Infinity Gauntlet couldn’t immediately beat Thanos (with zero stones), the Black Order, and one army? It doesn’t make sense. At all. 4. The entire soul stone / Black Widow death scene was bad. The Avengers spent five years reviewing what went into getting the stones. They KNEW someone has to die to get the soul stone. Like that’s necessary, they wouldn’t not tell you that before you went. Nebula knew it. Stark knew it. For them to act shocked and resigned was disingenuous. Beyond that, the entire fight scene was just confusing. It was like a race to make the sacrifice. Yes, it made sense to kill Black Widow and that was the right call but how they got there was bad. It would have made more sense for Ronin to be like “I have nothing to live for, I’ll die for the stone” and then right before he jumps they pull an Armageddon where Black Widow trips Ronin and she kills herself with some line about how it’s her turn to make the sacrifice (because up to now she’s the only one who hasn’t lost anything / anyone). It would have made the death itself way more powerful than the version we got. 5. Why didn’t Black Widow get a funeral? Seriously. Her death was treated like some flimsy ancillary character like Doby from Harry Potter (and even he got a funeral). There was a brooding scene right after when everyone is sad (akin to Coulson’s death reaction in the first Avengers) and Hulk throws a bench but other than we don’t receive a lot of closure with the character. Outside of Banner saying he tried to wish her back and Ronin (and this should have been Banner) / Scarlet Witch commiserating at the end, she gets no fanfare. She was literally an Avenger before Stark even was and she deserved more than what she got. 6. They don’t properly explain why they couldn’t bring back Gomorrah and Black Widow (or Vision for that matter). Like the stones can do literally anything…. except reincarnate the dead? It doesn’t make sense. Especially because in the comics you definitely CAN. It’s a common plot hole for devices that deal with unlimited power that these films try to skate on. 7. Why was Pepper Potts just randomly hanging out at Avengers HQ when Stark’s ship arrived? No one knew they were coming so what gives? 8. Where and when did Pepper Potts go from a corporate executive who becomes hysterical during every battle (see: Infinity War’s first act) to “has her own suit and is ready to do battle”? I understand they NEEDED her there for Stark’s death so she was the last face he saw but that doesn’t excuse the plot hole that got her to the battlefield. Like scenes where she got into the suit and went to the fight (potentially because she knew it may be the last time she sees Tony), saying goodbye to her daughter (who is being watched by Happy) and explaining that she’s going to help ensure the world is safe for her would have been good. You kind of had this for Tony earlier in the movie but they really needed to flesh out how and why Pepper got there and they missed an opportunity to do this well. 9. The whole female Avengers charge scene was so heavy handed that it negated its significance. It’s the MCU’s version of Spider-Man jumping in front of the American flag in Spider-Man 3. The main issue is that the last two movies send a message to the audience that women and men can NOT fight together (save for Captain Marvel). They did this in Infinity War too with Black Widow, Scarlet Witch, and Okoye fighting Proxima Midnight. By trying to be inclusive, the films somehow became more exclusionary of female characters. Joss Whedon has a lot of issues as a writer, but he understood the important symbolism of a female character taking men to task in battle. He did it with Buffy The Vampire Slayer and he did it in The Avengers. It’s something that Infinity War and Endgame failed to do (sans Scarlet Witch and Captain Marvel going after Thanos). 10. After spending a year mourning the Avengers who were dusted in Infinity War, audiences were rewarded with a grand total of 10 minutes of screen time for the lot of them. For one thing: we’re not actually shown how people return from the dust (which would have bene the emotional payoff from Infinity War’s dusting). They don’t explain what people are like when they come back or what actually happened to them while they were gone. How were the dusted Avengers able to rally armies to fight so quickly? Like none of it makes sense other than it led to an otherwise entertaining fake Hobbit Battle of Five Armies sequence and a catch phrase. Again, a great opportunity missed to further develop the audience’s emotional investment to these characters (especially since a lot of them are the stars of the franchise going forward). 11. Black Widow’s character arc was really confusing. Was she in love with Ronin? Was she in love with Banner? What was the point of the build up in Ultron with her and Banner, tease it further in Infinity War, then just kinda blow it off in Endgame? The ultimate issue here is it robbed the audience of any kind of emotional payoff for Bruce Banner’s character. More troubling because it happened at the mercy of Ronin’s development even though his arc had already been written (and who got an emotional payoff at the end of the movie). Once again, bad character development that cheats Bruce Banner out of closure. 12. Endgame clearly tried to correct the Thanos character. In short, they made him way too sympathetic in Infinity War. There have been a lot of people who have said Thanos is the hero of Infinity War. To fix that in Endgame, Thanos was written more as a nihilistic sociopath which kind of works because ultimately it’s Thanos from the past but his motivations for the Infinity Stones wouldn’t change so why should his mannerisms / motivations? It worked from a raw storytelling perspective of giving the audience a pure villain to root against but considering the existing character arcs, we know that Thanos is more than a pure villain. 13. Why not use the stones to revive Tony Stark? It’s a simple question. They could. Captain Marvel (presumably is the only one strong enough to safely wield the gauntlet) could have used the gauntlet, snapped her fingers, and he would be alive. 14. How did Cap return the soul stone? There’s a lot of questions here like a.) what it was like seeing Red Skull again? b.) How do you put back the soul stone since the films never actually show where you get the stone? c.) Do you get the life back for the stone or is it a no refunds situation? 15. The Cap old man ending is literally impossible. Based on the very same rules on time travel as defined by Hulk and the Ancient One. When you go through time, whatever you do does not change your present, it simply creates an alternate track where your changes are reflected. So Cap going back to the past to marry Peggy Carter and die an old man would NEVER have happened in the reality that Falcon / Bucky were in. It would have happened in the alternate track Cap created in the past meaning the shield handoff and everything would never have happened. In conclusion: 1. Brand loyalty does not make a bad movie good 2. Nostalgia does not make a bad movie good 3. Crying at the end does not make a bad movie good (otherwise Marley & Me would be Citizen Kane)

https://medium.com/@jameskhubiar/the-avengers-endgame-is-a-bad-movie-stop-lying-to-yourself-a83eecc3f7b0

['James Khubiar']

2019-04-27 17:19:17.128000+00:00

['Avengers', 'Avengers Endgame', 'Marvel', 'Marvel Cinematic Universe', 'Marvel Studios']

Title Avengers Endgame Bad Movie Stop Lying YourselfContent Avengers Endgame Bad Movie Stop Lying REALLY LOT SPOILERS AHEAD flow movie place even time traveling aspect people appearing changing disappearing without context film lot stupid excuse argue lot happened sake brevity reason Infinity War Endgame almost 6 hour total Marvel stuff movie much content possible tell story without needing movie Thanos saga could easily merited third film “Infinity Stones Trilogy” would required extra film like Robert Downey Jr Scarlett Johansson Chris Evans couldn’t get resulting abattoir lost character development plot point arc 2 Captain Marvel bad Avenger Full stop She’s like absentee father really really really need She’s film grand total seven minute rescue Tony start leaf she’s guarding “thousands le fortunate worlds” okay fair involved Avengers’ super important “we get one shot can’t fail” mission undo snap Like didn’t occur anyone bring one person could whole thing Even climax fight didn’t really anything tried book arrival like battle Wakanda Avengers losing Thor showed even playing field happening Earth didn’t show seemed alright despite ship shelling It’s honestly waste character truthfully Marvel doesn’t seem know She’s basically female version Superman they’re living god aren’t really challenged threatened anything short year hearing fan say “where Captain Marvel Infinity War” Marvel seemed learned nothing left u asking “where Captain Marvel time heist” 3 final battle made sense Wakanda Infinity War 10 Avengers including late Thor shieldless Cap Wakandan army nearly defeated Thanos five stone 3 Black Order sans Maw army Somehow Endgame full strength 20 Avengers plus like 4 army plus Thor start plus Cap shield Mjolnir plus late Captain Marvel plus completed Infinity Gauntlet couldn’t immediately beat Thanos zero stone Black Order one army doesn’t make sense 4 entire soul stone Black Widow death scene bad Avengers spent five year reviewing went getting stone KNEW someone die get soul stone Like that’s necessary wouldn’t tell went Nebula knew Stark knew act shocked resigned disingenuous Beyond entire fight scene confusing like race make sacrifice Yes made sense kill Black Widow right call got bad would made sense Ronin like “I nothing live I’ll die stone” right jump pull Armageddon Black Widow trip Ronin kill line it’s turn make sacrifice she’s one hasn’t lost anything anyone would made death way powerful version got 5 didn’t Black Widow get funeral Seriously death treated like flimsy ancillary character like Doby Harry Potter even got funeral brooding scene right everyone sad akin Coulson’s death reaction first Avengers Hulk throw bench don’t receive lot closure character Outside Banner saying tried wish back Ronin Banner Scarlet Witch commiserating end get fanfare literally Avenger Stark even deserved got 6 don’t properly explain couldn’t bring back Gomorrah Black Widow Vision matter Like stone literally anything… except reincarnate dead doesn’t make sense Especially comic definitely It’s common plot hole device deal unlimited power film try skate 7 Pepper Potts randomly hanging Avengers HQ Stark’s ship arrived one knew coming give 8 Pepper Potts go corporate executive becomes hysterical every battle see Infinity War’s first act “has suit ready battle” understand NEEDED Stark’s death last face saw doesn’t excuse plot hole got battlefield Like scene got suit went fight potentially knew may last time see Tony saying goodbye daughter watched Happy explaining she’s going help ensure world safe would good kind Tony earlier movie really needed flesh Pepper got missed opportunity well 9 whole female Avengers charge scene heavy handed negated significance It’s MCU’s version SpiderMan jumping front American flag SpiderMan 3 main issue last two movie send message audience woman men fight together save Captain Marvel Infinity War Black Widow Scarlet Witch Okoye fighting Proxima Midnight trying inclusive film somehow became exclusionary female character Joss Whedon lot issue writer understood important symbolism female character taking men task battle Buffy Vampire Slayer Avengers It’s something Infinity War Endgame failed sans Scarlet Witch Captain Marvel going Thanos 10 spending year mourning Avengers dusted Infinity War audience rewarded grand total 10 minute screen time lot one thing we’re actually shown people return dust would bene emotional payoff Infinity War’s dusting don’t explain people like come back actually happened gone dusted Avengers able rally army fight quickly Like none make sense led otherwise entertaining fake Hobbit Battle Five Armies sequence catch phrase great opportunity missed develop audience’s emotional investment character especially since lot star franchise going forward 11 Black Widow’s character arc really confusing love Ronin love Banner point build Ultron Banner tease Infinity War kinda blow Endgame ultimate issue robbed audience kind emotional payoff Bruce Banner’s character troubling happened mercy Ronin’s development even though arc already written got emotional payoff end movie bad character development cheat Bruce Banner closure 12 Endgame clearly tried correct Thanos character short made way sympathetic Infinity War lot people said Thanos hero Infinity War fix Endgame Thanos written nihilistic sociopath kind work ultimately it’s Thanos past motivation Infinity Stones wouldn’t change mannerism motivation worked raw storytelling perspective giving audience pure villain root considering existing character arc know Thanos pure villain 13 use stone revive Tony Stark It’s simple question could Captain Marvel presumably one strong enough safely wield gauntlet could used gauntlet snapped finger would alive 14 Cap return soul stone There’s lot question like like seeing Red Skull b put back soul stone since film never actually show get stone c get life back stone refund situation 15 Cap old man ending literally impossible Based rule time travel defined Hulk Ancient One go time whatever change present simply creates alternate track change reflected Cap going back past marry Peggy Carter die old man would NEVER happened reality Falcon Bucky would happened alternate track Cap created past meaning shield handoff everything would never happened conclusion 1 Brand loyalty make bad movie good 2 Nostalgia make bad movie good 3 Crying end make bad movie good otherwise Marley would Citizen KaneTags Avengers Avengers Endgame Marvel Marvel Cinematic Universe Marvel Studios

SHIELD & The Avengers: Interchangeable?

SHIELD & The Avengers: Interchangeable? *MCU SPOILERS AHEAD* Agents of SHIELD The MCU is one of the largest franchise in this millenium. With Avengers: Endgame (2019) at the top of the Box Office of All Time, and many of Hollywood’s biggest stars earning their fame via roles in the Marvel Cinematic Universe, there are tons of fans of this Series of shows and movies. One thing that makes any Marvel product so fascinating to watch, is the story interweaved within all of it. Agent Coulson of SHIELD is linked to Spiderman. Daredevil aka Matt Murdock is linked to the Big Six Avengers. Currently, I am taking on the task of watching the entire MCU, including the ABC Shows Agent Carter & Agents of SHIELD, but excluding the Netflix Marvel Shows. In the least, it is extraordinary how a small remark that a character makes in one movie, has a lot to do with multiple characters from a different film or series. Hayley Atwell as Peggy Carter At the end of SHIELD S2:E19, Coulson is in a meeting with Agent Hill, and he finishes with something along the lines of, “It’s time to bring in the Avengers.” This particular episode is the last before the release of Avengers: Age of Ultron. A the beginning of the movie, the opening scene, the Avengers are storming their way into a HYDRA base, which we know has direct links to Coulson’s meeting, because during his chat, they talk about retrieving Loki’s Sceptre, which we see in the movie as the initial aim of the Avengers. However, the agents at SHIELD have stormed multiple HYDRA bases, ending with success in many. So, the question is, hypothetically, couldn’t SHIELD have taken out the task that the Avengers did in the start of the movie? Now, I’m not saying in any way that the 2 powers are equal, because the Avengers would overpower SHIELD any day, even with Quake’s/Daisy’s abilities. But, the adversity faced at the base was quite similar, it seems, to what SHIELD had faced too many times to count. Even with the Maximoff Twins, SHIELD’ve gone up against many Inhumans, for example, and other powered individuals. Of course, a simple answer could be that SHIELD just wanted the Sceptre as soon as possible, with as minimum obstacles as possible. Coming out of the fictional world: it may just have been something to add to the plot of Age of Ultron, to make it gripping right from the go, and something to entice fans of the ABC Series to watch the movie. Obviously, they’d want to find out what the Coulson comment meant, when he talked about bringing ‘in the Avengers’, adding more cash to the actors’ and filmmakers pockets, at the end of the day. Then with SHIELD vs Hive, the Avengers could’ve been brought in, to fight someone who was more or less is invincible. Just think how much more quickly Hive could’ve been dealt with, if even only a third of the Big Six came to help. Maybe not even they were needed; Dr Strange + Black Panther? Captain Marvel + Black Widow? Or even Captain Marvel by herself? Exiting fiction, this could’ve obviously been again for commercial gain, to drag S3 on for as long as possible against a formidable opponent. An additional reason for not entwining SHIELD and the Avengers, further than has been already, would supposedly be because the AoS bosses wanted to go their own route from the MCU; not completely separate, but to release the ‘strangle-hold’ for the scriptwriters, which had previously meant that lost of thought had to be put in so as not to majorly contradict the main MCU storylines, prevalent in the movies. So personally and ultimately, I believe that the SHIELD Agents & the Avengers are indeed interchangeable, however a few fictional factors (such as the least use of SHIELD resources as possible) and non-fictional ones (like the aim to actually have feasible material to make blockbusters with, instead of all the good stuff being taken up by the ABC series), mix together and come into play, giving us the current extraordinary layout and timeline of the Marvel Cinematic Universe.

https://medium.com/leisured-back/shield-the-avengers-interchangeable-c2aec0ac2df5

['Nhyira M']

2020-11-22 19:47:03.596000+00:00

['Film', 'TV', 'Mcu', 'Marvel']

Title SHIELD Avengers InterchangeableContent SHIELD Avengers Interchangeable MCU SPOILERS AHEAD Agents SHIELD MCU one largest franchise millenium Avengers Endgame 2019 top Box Office Time many Hollywood’s biggest star earning fame via role Marvel Cinematic Universe ton fan Series show movie One thing make Marvel product fascinating watch story interweaved within Agent Coulson SHIELD linked Spiderman Daredevil aka Matt Murdock linked Big Six Avengers Currently taking task watching entire MCU including ABC Shows Agent Carter Agents SHIELD excluding Netflix Marvel Shows least extraordinary small remark character make one movie lot multiple character different film series Hayley Atwell Peggy Carter end SHIELD S2E19 Coulson meeting Agent Hill finish something along line “It’s time bring Avengers” particular episode last release Avengers Age Ultron beginning movie opening scene Avengers storming way HYDRA base know direct link Coulson’s meeting chat talk retrieving Loki’s Sceptre see movie initial aim Avengers However agent SHIELD stormed multiple HYDRA base ending success many question hypothetically couldn’t SHIELD taken task Avengers start movie I’m saying way 2 power equal Avengers would overpower SHIELD day even Quake’sDaisy’s ability adversity faced base quite similar seems SHIELD faced many time count Even Maximoff Twins SHIELD’ve gone many Inhumans example powered individual course simple answer could SHIELD wanted Sceptre soon possible minimum obstacle possible Coming fictional world may something add plot Age Ultron make gripping right go something entice fan ABC Series watch movie Obviously they’d want find Coulson comment meant talked bringing ‘in Avengers’ adding cash actors’ filmmaker pocket end day SHIELD v Hive Avengers could’ve brought fight someone le invincible think much quickly Hive could’ve dealt even third Big Six came help Maybe even needed Dr Strange Black Panther Captain Marvel Black Widow even Captain Marvel Exiting fiction could’ve obviously commercial gain drag S3 long possible formidable opponent additional reason entwining SHIELD Avengers already would supposedly AoS boss wanted go route MCU completely separate release ‘stranglehold’ scriptwriter previously meant lost thought put majorly contradict main MCU storyline prevalent movie personally ultimately believe SHIELD Agents Avengers indeed interchangeable however fictional factor least use SHIELD resource possible nonfictional one like aim actually feasible material make blockbuster instead good stuff taken ABC series mix together come play giving u current extraordinary layout timeline Marvel Cinematic UniverseTags Film TV Mcu Marvel

Iron Fist could have been the next epic Marvel show on Netflix, if they’d only been brave enough to do one thing …

Iron Fist could have been the next epic Marvel show on Netflix, if they’d only been brave enough to do one thing … … just make Danny Rand Chinese-American. Lewis Tan, the actor who’s the villain in the new Netflix Iron Fist show, lobbied hard for this. But in the end, he didn’t get his way, and he kept his job, and there’s yet ANOTHER Marvel Netflix show with bad-guy Asians in it who are kung-fu masters. Man, Iron Fist, it’s okay (to me at least) if the first/only/finally Marvel superhero with an Asian face is a kung-fu guy, especially if they made him Chinese. I mean, half of the Marvel heroes are kung-fu people now, why not a kung-fu artist who’s Chinese-American? It’s a cliche, but there’s literally ZERO heroes in the Marvel Universe that look like Bruce Lee, or Shannon Lee, or any of another hundred names I could type out right now. It’s where Iron First is this missed opportunity. I know there’s controversy in the Asian-American community about Doctor Strange. I’m alone on this one; I think it’s great that The Ancient One is a white woman, now, for that movie. Because in the comics, The Ancient One as written is this oriental nightmare; just a Fu-Manchu design on top of a bunch of land of the celestials orientalist nonsense. It took decades of writing to sort of fill in a backstory that at least makes the land of the celestials oriental nonsense kind of compelling, but it’s all in English, and only Tibetan in the same way that The Mikado is Japanese. The Ancient One in the Marvel comic books is a racist mess, no matter how much you rewrite it, so, yeah, go make that character into a white woman for the movie; it fits the weirdo space-magic that grounds Doctor Strange better, anyway. And I know, I get it, it’s business. It’s probably done less because of the aforementioned racist mess, and more likely because a Tibetan mentor for Doctor Strange could’ve hurt box office in China. I get it. But, if we can get a white woman as The Ancient One, why can’t we get a Chinese-American Danny Rand? That could have been something. A guy who doesn’t know kung-fu, with an Americanized name, who learns all about this ancient lineage, tracing his roots back to a land he’s never seen. That’s a Marvel show ABOUT something. That’s a Marvel TV show going into ‘American Born Chinese’ sort of territory. There’s our Chinese-American hero, Danny Rand, set adrift in a far away land, learning the language, learning that Kung-Fu, and then learning some space magic fighting styles until he becomes the master, he’s now the 铁拳 (Tiěquán). And without skipping a beat, our Chinese-American Danny Rand, who’s learned all about his culture, translates 铁拳 into crystal clear English and says, “Iron Fist.” And when he does, this music plays, as he shows off the power of the Iron Fist … Daring General (于會詠、胡登跳) https://www.youtube.com/watch… … straight out of Cantonese opera, ‘Daring General (于會詠、胡登跳)’ the kind of music a big hero would get as the opening titles or, if they were really lucky, as fight choreography. And I know what you may be thinking, “But Danny Rand, that’s an English language name, how could he be Chinese?” And I’ll say, “You do know my name is Fred Rutherford and I have a Korean mother, right?” And point out that people’s names change when they come to America, and there’s a story there all on its own, about the advantages the Chinese Rand family might’ve had by simply changing their name decades earlier, and surprising business contacts with their ethnicity when it was too late to back out. And so to do that, you have to get someone to make the show who understands or thinks about these things, and thinks it matters. Who understands that yeah, it’s kind of lame to make the first Asian-American Marvel superhero into a kung-fu guy, but if you’re going to do it, you go DEEP, and you get it RIGHT, and you make a 13 part Chinese-American Kung-Fu OPERA out of it. You get the tropes right, you pull out every stop, you ask for White Tiger and Fat Cobra and you go ahead and read Journey to the West in English and crib from it and do it EPIC. You go DEEP into the aforementioned ‘American Born Chinese’ territory too, and you go DEEP into Marvel, and you decide, okay, it’s ALSO about cultural appropriation, and theft, and honor, and coming through, and about being forever foreign in America NO MATTER what your name is, how long your family has been here, all of these things. But, Marvel doesn’t do that. The Asian faces in Marvel properties remain helpers at best, or outright villains. There was a moment, in Luke Cage, his at first stern Chinese landlord who turns out to have a sweet spot for him. That could have been Danny Rand’s ‘auntie’ from a side of the family that did NOT change their name. And then that was the in, the way to make Luke Cage and Danny Rand best friends, and start them off right. They’ll figure out how to make Danny and Luke friends. And who knows, maybe the showrunner will make it about cultural appropriation anyway. Or, maybe it’ll just be the kind of thing you come to expect when you’re Asian-American and you see this stuff; where the love interest will be a sultry kung-fu goddess, and the villain will be a super-buff kung-fu master who could do his own stunts, unlike the lead white guy who has at least 2 stunt doubles. But in my head, I’ve already seen the kung-fu epic opera version of “Way of The Iron Fist” in my sleep. I’ll stick with that one, and hope that one of these days, some little kid who kind of looks like me get a superhero who kind of looks like him among Iron Man and The Hulk and Black Widow and all the other supergods, and the same for a little girl with the same kind of face, too. Because it matters, seeing yourself in the heroes of popular culture. It’s a way you learn that you’re not a foreigner in your own country.

https://medium.com/@TheHelpMachine/iron-fist-could-have-been-the-next-epic-marvel-show-on-netflix-if-theyd-only-been-brave-enough-to-f1d0c6fe14fd

['The Help Machine']

2016-10-14 04:17:09.947000+00:00

['Movies', 'Marvel']

Title Iron Fist could next epic Marvel show Netflix they’d brave enough one thing …Content Iron Fist could next epic Marvel show Netflix they’d brave enough one thing … … make Danny Rand ChineseAmerican Lewis Tan actor who’s villain new Netflix Iron Fist show lobbied hard end didn’t get way kept job there’s yet ANOTHER Marvel Netflix show badguy Asians kungfu master Man Iron Fist it’s okay least firstonlyfinally Marvel superhero Asian face kungfu guy especially made Chinese mean half Marvel hero kungfu people kungfu artist who’s ChineseAmerican It’s cliche there’s literally ZERO hero Marvel Universe look like Bruce Lee Shannon Lee another hundred name could type right It’s Iron First missed opportunity know there’s controversy AsianAmerican community Doctor Strange I’m alone one think it’s great Ancient One white woman movie comic Ancient One written oriental nightmare FuManchu design top bunch land celestials orientalist nonsense took decade writing sort fill backstory least make land celestials oriental nonsense kind compelling it’s English Tibetan way Mikado Japanese Ancient One Marvel comic book racist mess matter much rewrite yeah go make character white woman movie fit weirdo spacemagic ground Doctor Strange better anyway know get it’s business It’s probably done le aforementioned racist mess likely Tibetan mentor Doctor Strange could’ve hurt box office China get get white woman Ancient One can’t get ChineseAmerican Danny Rand could something guy doesn’t know kungfu Americanized name learns ancient lineage tracing root back land he’s never seen That’s Marvel show something That’s Marvel TV show going ‘American Born Chinese’ sort territory There’s ChineseAmerican hero Danny Rand set adrift far away land learning language learning KungFu learning space magic fighting style becomes master he’s 铁拳 Tiěquán without skipping beat ChineseAmerican Danny Rand who’s learned culture translates 铁拳 crystal clear English say “Iron Fist” music play show power Iron Fist … Daring General 于會詠、胡登跳 httpswwwyoutubecomwatch… … straight Cantonese opera ‘Daring General 于會詠、胡登跳’ kind music big hero would get opening title really lucky fight choreography know may thinking “But Danny Rand that’s English language name could Chinese” I’ll say “You know name Fred Rutherford Korean mother right” point people’s name change come America there’s story advantage Chinese Rand family might’ve simply changing name decade earlier surprising business contact ethnicity late back get someone make show understands think thing think matter understands yeah it’s kind lame make first AsianAmerican Marvel superhero kungfu guy you’re going go DEEP get RIGHT make 13 part ChineseAmerican KungFu OPERA get trope right pull every stop ask White Tiger Fat Cobra go ahead read Journey West English crib EPIC go DEEP aforementioned ‘American Born Chinese’ territory go DEEP Marvel decide okay it’s ALSO cultural appropriation theft honor coming forever foreign America MATTER name long family thing Marvel doesn’t Asian face Marvel property remain helper best outright villain moment Luke Cage first stern Chinese landlord turn sweet spot could Danny Rand’s ‘auntie’ side family change name way make Luke Cage Danny Rand best friend start right They’ll figure make Danny Luke friend know maybe showrunner make cultural appropriation anyway maybe it’ll kind thing come expect you’re AsianAmerican see stuff love interest sultry kungfu goddess villain superbuff kungfu master could stunt unlike lead white guy least 2 stunt double head I’ve already seen kungfu epic opera version “Way Iron Fist” sleep I’ll stick one hope one day little kid kind look like get superhero kind look like among Iron Man Hulk Black Widow supergods little girl kind face matter seeing hero popular culture It’s way learn you’re foreigner countryTags Movies Marvel

Marvel Studios Will Not Recast Black Panther

Marvel Studios Will Not Recast Black Panther During Disney Investor Day, it was revealed by Marvel Studios Chief Creative Officer Kevin Feige that Marvel Studios will not be recasting the iconic role of Black Panther which was made world-famous by the epic portrayal by the late Chadwick Boseman. This was a question that was on everyone’s mind after Chadwick Boseman’s tragic passing. After much internet speculation, it seems that Feige wanted to clear the air. Black Panther 2 will proceed and the MCU will still build around Wakanda. Black Panther 2 director and writer Ryan Coogler is hard at work on the script. Which is assumed to be going through massive rewrites considering Coogler was writing lines for Chadwick to say at the time of his passing. It was clear that the Black Panther character was destined for huge things post-Endgame. It is a shame we will never get to see another Chadwick Boseman movie. Marvel Studios’ approach to handling the situation in Black Panther 2 will be nothing short of fascinating considering how T’Challa’s arc was going and the clear emphasis during the Endgame final battle that Black Panther, Captain Marvel, and Spider-Man were the next MCU trinity. As a fan, it is still surreal that Chadwick Bozeman is gone. The news doesn’t get any less devastating. I’m just glad Kevin Feige and Marvel Studios made the thoughtful decision not to recast the Black Panther. Black Panther 2 will arrive in theaters on July 8, 2022. Zach Perilstein is the Editor-in-Chief of the Boardwalk Times

https://boardwalktimes.net/marvel-studios-will-not-recast-black-panther-6baa32b31a5c

['Zach Perilstein']

2020-12-12 22:08:03.015000+00:00

['News', 'Chadwick Boseman', 'Marvel Cinematic Universe', 'Marvel', 'Film']

Title Marvel Studios Recast Black PantherContent Marvel Studios Recast Black Panther Disney Investor Day revealed Marvel Studios Chief Creative Officer Kevin Feige Marvel Studios recasting iconic role Black Panther made worldfamous epic portrayal late Chadwick Boseman question everyone’s mind Chadwick Boseman’s tragic passing much internet speculation seems Feige wanted clear air Black Panther 2 proceed MCU still build around Wakanda Black Panther 2 director writer Ryan Coogler hard work script assumed going massive rewrite considering Coogler writing line Chadwick say time passing clear Black Panther character destined huge thing postEndgame shame never get see another Chadwick Boseman movie Marvel Studios’ approach handling situation Black Panther 2 nothing short fascinating considering T’Challa’s arc going clear emphasis Endgame final battle Black Panther Captain Marvel SpiderMan next MCU trinity fan still surreal Chadwick Bozeman gone news doesn’t get le devastating I’m glad Kevin Feige Marvel Studios made thoughtful decision recast Black Panther Black Panther 2 arrive theater July 8 2022 Zach Perilstein EditorinChief Boardwalk TimesTags News Chadwick Boseman Marvel Cinematic Universe Marvel Film

Fortnite: How it Has Stayed Relevant, Unique and What is to Come?

Fortnite: How it Has Stayed Relevant, Unique and What is to Come? Fortnite Chapter 2 Season 4 (Screenshot: Epic Games) If you were to download Fortnite today it would not look anything like the game that launched in 2017. The game started as a pivot from the zombie tower defense game that Fortnite was originally set to be, when it failed to find players the team at Epic decided to make a some changes rebranding it as battle royale. The game is now in its second chapter and has grown into a online shooter, social space, concert venue, movie theatre and etc. The game continues to grow and change every season. The weirdest part about Fortnite, is that when they announce a new season they have almost reached a Marvel or Star Wars level of quality. When they put out their posters they are covered in original characters, lore and now even licensed character from other companies (including Marvel and Star Wars) has become a regular occurrence. This is why I want to break it all down and talk about why Fortnite is doing games as a service so much better than most of the other companies. Fortnite Chapter 2 Season 3 (Screenshot: Epic Games) The above image is what I want to start with. This was Chapter 2 Season 3. I want to start out by sharing one quality of Fortnite that I believe is a huge part of their success in keeping the game relevant. It is the fact that they are not afraid to change up the experience from season to season. Fortnite is not scared to make their seasons about something entirely new and double down on it in an effort to create original content, this time that idea was a water world. Partner this with the fact that licensed characters are probably just a part of Fortnite moving forward now that they have had multiple tied to the battle pass. Fortnite is truly its own, unique world one where you can have Aquaman, Thor, Mandalorian and a cat on a robotic body. This world and its crazy occupants is, what I believe, keeps bringing people back to the game. I think that a launch of a new season for some is like when a new movie or even a new game is coming out. They don’t know exactly what the next season will bring in terms of characters and lore. This excitement and the changes is enough to keep pulling players back into the game. We now know that the next season after Season 3, would bring Epic’s biggest crossover yet, it was a season dedicated to Marvel. The season had a battle pass that was filled with iconic Marvel characters. This all cultivated with players defending the island against Galactus, who opened up the zero point allowing for even bigger events and more crossovers in the future. Epic has been smart to allow Season 5 to bring in more people through the store, but to bring back their originality through the battle pass. This battle pass, while featuring the Mandalorian, is filled with original characters. I know that we all loved the Marvel season, yet I think it is cool to see original content presented as well. Even though I do not love every single aspect of Fortnite I am always impressed by their designs and style, I think they have done an amazing job crafting their world. They also have talented artists who are amazing at meshing the guest characters with the games style. These characters never feel out of place or look like they shouldn’t be in the same image with the rest of the Fortnite cast. I am not a huge fan of Fortnite, I like it, but I don’t feel like I have the time to get really good at it or grind the battle pass. I have played it in the past and truly think that Epic has made a very interesting experience even at times reaching outside of the typical gaming space. The events and the mode Party Royale has even elevated the game to a place where people can just hang out. It’s still crazy to believe that the tower defense version of Fortnite that was coming out in 2017, was re-engineered into one of the biggest online games ever. I believe that Fortnite will continue to grow and most likely become something bigger than a game. I think with the addition of these events and Party Royale we have already seen the first steps. While I think the game will always have its battle royale game modes. I wonder if we will see bigger additions to Party Royale, Creative and even new modes that allow for people that just want a relaxing game to play with their friends. I wonder if we will see the addition of more PVE focused modes and activities. Only time will tell, I feel that Fortnite has the potential to shape itself as a hub that many play for totally different reasons. Just as Fortnite pivoted in 2017 to become a battle royale I wonder if we may see it pivot again to become a bigger, more inclusive experience.

https://medium.com/@connor636/fortnite-how-it-has-stayed-relevant-unique-and-what-is-to-come-82888abefe3c

['Connor Edrington']

2020-12-13 15:22:37.762000+00:00

['Fortnite', 'Ps5', 'Xbox', 'Epic Games', 'Marvel']

Title Fortnite Stayed Relevant Unique ComeContent Fortnite Stayed Relevant Unique Come Fortnite Chapter 2 Season 4 Screenshot Epic Games download Fortnite today would look anything like game launched 2017 game started pivot zombie tower defense game Fortnite originally set failed find player team Epic decided make change rebranding battle royale game second chapter grown online shooter social space concert venue movie theatre etc game continues grow change every season weirdest part Fortnite announce new season almost reached Marvel Star Wars level quality put poster covered original character lore even licensed character company including Marvel Star Wars become regular occurrence want break talk Fortnite game service much better company Fortnite Chapter 2 Season 3 Screenshot Epic Games image want start Chapter 2 Season 3 want start sharing one quality Fortnite believe huge part success keeping game relevant fact afraid change experience season season Fortnite scared make season something entirely new double effort create original content time idea water world Partner fact licensed character probably part Fortnite moving forward multiple tied battle pas Fortnite truly unique world one Aquaman Thor Mandalorian cat robotic body world crazy occupant believe keep bringing people back game think launch new season like new movie even new game coming don’t know exactly next season bring term character lore excitement change enough keep pulling player back game know next season Season 3 would bring Epic’s biggest crossover yet season dedicated Marvel season battle pas filled iconic Marvel character cultivated player defending island Galactus opened zero point allowing even bigger event crossover future Epic smart allow Season 5 bring people store bring back originality battle pas battle pas featuring Mandalorian filled original character know loved Marvel season yet think cool see original content presented well Even though love every single aspect Fortnite always impressed design style think done amazing job crafting world also talented artist amazing meshing guest character game style character never feel place look like shouldn’t image rest Fortnite cast huge fan Fortnite like don’t feel like time get really good grind battle pas played past truly think Epic made interesting experience even time reaching outside typical gaming space event mode Party Royale even elevated game place people hang It’s still crazy believe tower defense version Fortnite coming 2017 reengineered one biggest online game ever believe Fortnite continue grow likely become something bigger game think addition event Party Royale already seen first step think game always battle royale game mode wonder see bigger addition Party Royale Creative even new mode allow people want relaxing game play friend wonder see addition PVE focused mode activity time tell feel Fortnite potential shape hub many play totally different reason Fortnite pivoted 2017 become battle royale wonder may see pivot become bigger inclusive experienceTags Fortnite Ps5 Xbox Epic Games Marvel

2019 Movie Preview

2019 Movie Preview With 2018 in the books, it’s time we looked forward to a new year for movies. 2019 is set to be a monster year, with two of the biggest blockbusters of the decade arriving in Avengers: End Game and Star Wars: Episode IX. Trust us, those two are only the tip of the iceberg as well. January GLASS M Night Shyamalan has almost become a self-referential meme at this point, with his career having as many twists as his movies. One thing’s for certain though: he’s been on somewhat of an under-the-radar hot streak with The Visit and Split. Now he returns to the world of The Horde (Split) to deliver a crossover with Unbreakable (2000), in what is sure to be an interesting movie in the very least. Prediction: The fact that he took his time between Split and this has me cautiously optimistic about Glass. Other notable releases in January: The Kid Who Would Be King sees Joe Cornish return to the director’s chair for the first time since Attack The Block (2011), in what could be an early front runner for Biggest Surprise at next year’s Nerdies. February THE LEGO MOVIE 2: THE SECOND PART The movie that shocked the world gets a well-deserved sequel this year, as The Lego Movie 2 hits theatres. The worrying part of this is that Phil Lord and Chris Miller are not back to direct, giving over control to Mike Mitchell, who seemingly hasn’t directed a good movie, and Trisha Gum, who hasn’t directed any at all. Prediction: The fact that Miller and Lord contributed to the script should save this but it probably will be a poorer sequel nonetheless. ALITA: BATTLE ANGEL This movie is the least predictable movie of the entire year. Alita: Battle Angel has been a pet project for James Cameron for decades and with his name attached to the script, it has a heavyweight creative name behind it. The trouble comes from director Robert Rodriguez, who is wildly unpredictable. He’s given us as many solid, fun movies as he has absolute duds. Prediction: Having read that Cameron has been paying close attention to this one has gotten my hopes up, but I’ve honestly got no idea what way this will go. HOW TO TRAIN YOUR DRAGON: THE HIDDEN WORLD The How to Train Your Dragon series is criminally underappreciated. With two incredible films already in the series, number 3 looks set to send the series out in style. The reason I have high hopes for this one stems from director Dean DeBlois, who was responsible for the first two movies in the series and will close out the trilogy himself, a rare occurrence in animated movies. Prediction: This one will be a must-see. March CAPTAIN MARVEL Carol Danvers arrives in the Marvel Cinematic Universe ready to give it a powerful dose of cosmic power, as well as its first female lead. Marvel will be hoping this can be their next Black Panther, featuring lead representation outside of the white male demographic. Though Wonder Woman may have gotten all the plaudits for that already. Prediction: Fun entry in the Marvel Cinematic Universe that will settle somewhere in the middle in terms of quality. US One of my most-anticipated movies of 2019 comes in the form of Us, the second movie from up-and-coming director Jordan Peele. He’ll be looking to follow up the Oscar-nominated Get Out with another social-horror movie, which could cement him as one of the great horror directors working today. And with Lupita Nyong’o leading the movie, this one could be special. Prediction: a polarising movie that gets a little preachy at times but is still a solid horror movie. Other notable releases in March: The first of three 2019 live action Disney movies is released in March, with Tim Burton’s Dumbo. This one boasts a solid cast and could be just what Burton needs to break the slump he’s been on for the past few years. April SHAZAM David F. Sanberg shakes off the shackles of the horror genre and aims to follow in the footsteps of Sam Raimi and James Wan, as the next big horror-come-superhero director. This movie sees Zachary Levi take on the title role in a movie that looks like the superhero version of Tom Hanks’ Big. It’s a fun concept that could work really well and help push the Snyder years of the DC Universe further into the rear-view mirror. Prediction: Fun-but-flawed movie with a similar tone to Aquaman. HELLBOY The trouble with this movie is two-fold: one, the previous two Hellboy movies have a strong fanbase that’s still a little sore from being denied a closing to the Guillermo Del Toro series; and two, director Neil Marshall is wildly inconsistent. Having seen early success in the low-budget horror genre, Marshall delivered a few duds, before quietly rebuilding his rep on TV, with two of the greatest episodes of Game of Thrones (Blackwater and Watchers On The Wall). While Stranger Things’ David Harbour is the actor saddled with the daunting task of following Ron Perlman as Hellboy himself. Prediction: at best this movie will be a cult classic on the level of the excellent Dredd (2012). At worst, it could have a shot at winning Biggest Disappointment at next year’s Nerdies. AVENGERS: ENDGAME This is it. The end of an era. All signs point to this one being the last outing for the majority of the original Avengers, as they fight to save the lives of those lost in Infinity War. The story for this one is closely under wraps but set photos hint at this being a very different style to previous Avengers outings, which could be a good or a bad thing. Prediction: an emotional send-off to the original Avengers, but one that fails to reach the heights of Infinity War. Bring tissues. Other notable releases in April: The resurgence of Stephen King stories at the box office continues with Pet Sematary. Unfortunately, this one feels like it has flop written all over it. May POKEMON: DETECTIVE PIKACHU Bonkers. Few words describe this movie better. Voiced by Ryan Reynolds, this isn’t the Pikachu you know and love from the animated series. Ash Ketchum is nowhere to be seen in this one and we have no idea whether we should be excited or panicking deep inside. Prediction: literally no clue how this one will go, as director Rob Letterman seemingly only knows how to make mediocre animated movies (Shark Tale, Monsters Vs Aliens). GODZILLA: KING OF THE MONSTERS The king is back. Long live the king. 2014’s Godzilla was an incredibly polarising movie featuring stunning set pieces from Rogue One director Gareth Edwards, but it was also a movie which ultimately left people wanting more of the titular beast. This film is sure to correct that, as the legendary king of the monsters goes up against three iconic villains in the form of Rodan, Mothra and King Ghidorah. Prediction: Director Michael Dougherty has me worried about this one, as his previous movie Krampus was simply a low-budget horror comedy, and a bang-average one at that. The lack of visual brilliance from Gareth Edwards could hurt this one. Other notable releases in May: Keanu Reeves returns in John Wick 3, which sees him getting hunted from all corners following the events of the second movie. This should be a solid third movie in the series. Also releasing in May is Aladdin, which has me more and more worried every time I see something new from it, and with Guy Ritchie behind the camera, we all know this one can go any way. June X-MEN: DARK PHOENIX This movie should not be happening. It’s as simple as that. Following the Disney acquisition of Fox, Marvel’s merry mutants are set to be folded into the Marvel Cinematic Universe, and possibly sooner than we think. So it’s hard to feel excited for, or to even care about this movie, which is a shame because it’s based on one of the most iconic X-Men stories of all time. The fact that we’ve to deal with the uninspiring choice of Simon Kinberg as director isn’t helping anyone’s hype level. Prediction: This generation of X-Men should have ended with Logan. This movie is potentially frustratingly pointless, and not to mention bad as well. MEN IN BLACK INTERNATIONAL Thor Ragnarok’s Chris Hemsworth and Tessa Thompson team up once again and this time they’re going global for Men In Black International. This is a series that up until now relied on the star power of Will Smith, so it will be interesting to see if the premise can live beyond that. Director F. Gary Gray is an interesting choice as he’s a lot grittier than the fun, polished style of the previous entries in the series. The trouble with this one is the fact the whole movie is based on a twist that’s so obvious it’s painful. So maybe don’t watch the trailers if you can help it. Prediction: The chemistry of the two leads carries this one, but only just. TOY STORY 4 The toys are back in town, and before you know it, they’re out of town again. Toy Story 3 was the perfect send off to these characters, so the road trip at the core of this movie better be damn good for them to risk the perfect record this series has enjoyed so far. Seeing as the original Toy Story is one of my top 5 films of all time, I am very excited and worried for this one. Prediction: The weakest entry in the series but still a strong outing for the lovable toys. Other notable releases in June: Reboots of The Grudge and Child’s Play go head-to-head for the horror crown in June, a month where horror movies need to be exceptional to make any splash at the box office. I don’t see either of these being relevant at all. July SPIDER-MAN: FAR FROM HOME The next generation of the Marvel Cinematic Universe begins… in a Sony movie. This movie picks up where Avengers: Endgame leaves off, which effectively ruins a large part of Endgame. We all knew the characters weren’t staying dead anyway though, right? Jake Gyllenhaal pops up as Mysterio in this one, as Tom Holland and friends go on a field trip throughout Europe. I have a feeling this will be solid, even though I’ve never been a big fan of Spidey outside of New York. Prediction: more of the same magic that made Homecoming a very fun watch. THE LION KING Disney’s “live action” version of The Lion King will be massive at the box office this year. People flat out love the original and this is just about far enough removed from the first movie to get away with being an obvious cash grab. The all-star cast, including the return of James Earl Jones as Mufasa, has the hype off the charts for this one and with Jungle Book and Iron Man director Jon Favreau behind the lens, this is sure to be one of the biggest hits of the year. Prediction: Should be Disney’s biggest movie this year not named Avengers: Endgame. Other notable releases in July: Quentin Tarantino’s Once Upon A Time In Hollywood boasts Leonardo DiCaprio, Brad Pitt, Margot Robbie and Kurt Russell, in a movie set in Hollywood around the time of the Charles Manson murders. This one will be boasting Oscar-credentials. August HOBBS & SHAW The Rock and Jason Statham return as their characters from The Fast & The Furious series, but this time they’re the ones running the show. With Idris Elba throwing his weight around as the villain, this movie is sure to be both incredible fun and action-packed insanity all in one movie. The fact that Atomic Blonde and Deadpool 2 director David Leitch is behind the camera brings the action chops too. Prediction: the guilty-pleasure train rolls on as The Fast & The Furious continues to prove doubters wrong. THE NEW MUTANTS This movie is a heartbreaker for the X-Men fan in me. Not only does it boast the cinematic debut of my second-favourite X-man, Cannonball, but it seems to have an interesting concept at its core: a superhero movie that’s actually a horror film. The number of delays mixed with a large number of reshoots, including the strange addition of an entirely new character in said reshoots, makes this sound like a total clusterf**k. Marvel’s imminent dismantling of the universe makes this just as irrelevant as Dark Phoenix. Prediction: I feel bad for the cast of this one, especially Game of Thrones’ Maisie Williams, Stranger Things’ Charlie Heaton, and Split’s Anya Taylor-Joy. The only fancy swag they’ll be wearing this award season will be to pick up some Razzies. September IT: CHAPTER 2 I love IT. The book is one of my favourite novels of all time. The original movie was a favorite of mine growing up, haunting my nightmares for years. And 2017’s IT: Chapter 1 was everything I wanted the movie to be. It featured a fantastic young cast, a performance from Bill Skarsgard as Pennywise that quickly killed any negative comparison with Tim Curry’s iconic turn as the horrific clown. With James McEvoy, Jessica Chastain and Bill Hader joining the cast for the sequel, I’m incredibly excited for this one. Prediction: A strong second chapter to compliment the first, making two movies that combine to be the best Stephen King adaptation of all time. October JOKER Comedy director Todd Phillips brings a new version of The Clown Prince of Crime to life, with Jaoquin Phoenix being the latest actor to don the iconic make up and purple suit. Seeing as the most recent version of the Joker was Jared Leto’s turn in Suicide Squad, Phoenix just needs to be pretty good to be liked by fans. The fact that this one is disconnected from DC’s shared universe means it could have room to breathe, and manage to do something special. Prediction: Martin Scorcese has been involved with this movie for as long as it has been in existence, so this one could very well surprise. Other notable releases in October: Zombieland Too finally gets released in October, ten years after its predecessor. Hype for the series hasn’t lasted this long unfortunately, and though the writers went on to write two Deadpool movies, the director has been inconsistent, including 2018’s messy Venom. I’m just not sure anyone cares about this series anymore. I’ll be happy if they prove me wrong though. November TERMINATOR 6 How are they still releasing Terminator movies with Arnold Schwarzenegger? This one even sees the return of Linda Hamilton as Sarah Connor. The hopeful elements of this movie though come with the fact that James Cameron has been much more involved this time around, and that Deadpool’s Tim Miller is behind the lens as director. I’ve frankly given up caring about getting excited about this series though. Prediction: Another unnecessarily convoluted entry in the series. Other notable releases in November: November is riddled with absolute punts in the form of a Charlies Angels reboot, a prequel to Kingsman titled The Great Game and a movie adaptation of video game Sonic The Hedgehog. Any of these movies could be good in their own right, in particular Kingsman, as it has a trustworthy director in the form of the Matthew Vaughan. Unfortunately, they’re all just trying to avoid the family juggernaut releasing in November: Frozen 2. December JUMANJI 3 Are the people who make Jumanji complete masochists? They’ve decided to release at the same time as a Star Wars movie again? The previous Jumanji movie was a complete shock both quality-wise and box-office-success-wise, and I don’t think anyone predicted this sequel happening. With The Rock, Kevin Hart, Jack Black and Karen Gillen all returning, and with Jake Kasdan once again directing, this movie is sure to be just as fun as the last one. Prediction: The cast carry this one and make it just as much fun as the previous entry. STAR WARS: EPISODE IX The big one has arrived. JJ Abrams is back in the director’s chair. The fate of Rey, Kylo Ren, Finn and Poe Dameron will be revealed. The 9th episode in the iconic series should see these characters go on hiatus for at least a while, even if they manage to survive past the end. So expect fireworks. The fact that fans have been aggressively outspoken about their dislike for The Last Jedi means the stakes are high for Disney with this one. Star Wars fans could stomach the prequels because they had George Lucas running the show, but if Disney delivers two unsatisfactory entries in the saga in a row, Star Wars will not be in a good place. Prediction: JJ gives the fans just what they want and Star Wars gets one of the strongest entries of the modern era. 2019 Movies In Review 2019 has the potential to be an all-time great year for movies, with a mix of heavy-hitters in the form of Avengers: End Game and Star Wars: Episode IX. With so many second-tier movies ready to step up, there can’t help but be more to love than hate. One thing is definitely for sure. We’ll have plenty to discuss this year on the Nerd Club podcast. — — — — — — — — — — — — — — — — — — — — — — For more Nerd Club news and reviews be sure to follow us on Facebook, Twitter, and Instagram. Then subscribe to our monthly podcast, available on all major podcasting apps, where we meet up to discuss one classic piece of nerd culture each month.

https://medium.com/@nerdclubcast/2019-movie-preview-16229ea04bfd

['Nerd Club Podcast']

2019-01-02 10:12:12.143000+00:00

['Movies', 'Podcast', 'Film', 'Star Wars', 'Marvel']

Title 2019 Movie PreviewContent 2019 Movie Preview 2018 book it’s time looked forward new year movie 2019 set monster year two biggest blockbuster decade arriving Avengers End Game Star Wars Episode IX Trust u two tip iceberg well January GLASS Night Shyamalan almost become selfreferential meme point career many twist movie One thing’s certain though he’s somewhat undertheradar hot streak Visit Split return world Horde Split deliver crossover Unbreakable 2000 sure interesting movie least Prediction fact took time Split cautiously optimistic Glass notable release January Kid Would King see Joe Cornish return director’s chair first time since Attack Block 2011 could early front runner Biggest Surprise next year’s Nerdies February LEGO MOVIE 2 SECOND PART movie shocked world get welldeserved sequel year Lego Movie 2 hit theatre worrying part Phil Lord Chris Miller back direct giving control Mike Mitchell seemingly hasn’t directed good movie Trisha Gum hasn’t directed Prediction fact Miller Lord contributed script save probably poorer sequel nonetheless ALITA BATTLE ANGEL movie least predictable movie entire year Alita Battle Angel pet project James Cameron decade name attached script heavyweight creative name behind trouble come director Robert Rodriguez wildly unpredictable He’s given u many solid fun movie absolute dud Prediction read Cameron paying close attention one gotten hope I’ve honestly got idea way go TRAIN DRAGON HIDDEN WORLD Train Dragon series criminally underappreciated two incredible film already series number 3 look set send series style reason high hope one stem director Dean DeBlois responsible first two movie series close trilogy rare occurrence animated movie Prediction one mustsee March CAPTAIN MARVEL Carol Danvers arrives Marvel Cinematic Universe ready give powerful dose cosmic power well first female lead Marvel hoping next Black Panther featuring lead representation outside white male demographic Though Wonder Woman may gotten plaudit already Prediction Fun entry Marvel Cinematic Universe settle somewhere middle term quality US One mostanticipated movie 2019 come form Us second movie upandcoming director Jordan Peele He’ll looking follow Oscarnominated Get another socialhorror movie could cement one great horror director working today Lupita Nyong’o leading movie one could special Prediction polarising movie get little preachy time still solid horror movie notable release March first three 2019 live action Disney movie released March Tim Burton’s Dumbo one boast solid cast could Burton need break slump he’s past year April SHAZAM David F Sanberg shake shackle horror genre aim follow footstep Sam Raimi James Wan next big horrorcomesuperhero director movie see Zachary Levi take title role movie look like superhero version Tom Hanks’ Big It’s fun concept could work really well help push Snyder year DC Universe rearview mirror Prediction Funbutflawed movie similar tone Aquaman HELLBOY trouble movie twofold one previous two Hellboy movie strong fanbase that’s still little sore denied closing Guillermo Del Toro series two director Neil Marshall wildly inconsistent seen early success lowbudget horror genre Marshall delivered dud quietly rebuilding rep TV two greatest episode Game Thrones Blackwater Watchers Wall Stranger Things’ David Harbour actor saddled daunting task following Ron Perlman Hellboy Prediction best movie cult classic level excellent Dredd 2012 worst could shot winning Biggest Disappointment next year’s Nerdies AVENGERS ENDGAME end era sign point one last outing majority original Avengers fight save life lost Infinity War story one closely wrap set photo hint different style previous Avengers outing could good bad thing Prediction emotional sendoff original Avengers one fails reach height Infinity War Bring tissue notable release April resurgence Stephen King story box office continues Pet Sematary Unfortunately one feel like flop written May POKEMON DETECTIVE PIKACHU Bonkers word describe movie better Voiced Ryan Reynolds isn’t Pikachu know love animated series Ash Ketchum nowhere seen one idea whether excited panicking deep inside Prediction literally clue one go director Rob Letterman seemingly know make mediocre animated movie Shark Tale Monsters Vs Aliens GODZILLA KING MONSTERS king back Long live king 2014’s Godzilla incredibly polarising movie featuring stunning set piece Rogue One director Gareth Edwards also movie ultimately left people wanting titular beast film sure correct legendary king monster go three iconic villain form Rodan Mothra King Ghidorah Prediction Director Michael Dougherty worried one previous movie Krampus simply lowbudget horror comedy bangaverage one lack visual brilliance Gareth Edwards could hurt one notable release May Keanu Reeves return John Wick 3 see getting hunted corner following event second movie solid third movie series Also releasing May Aladdin worried every time see something new Guy Ritchie behind camera know one go way June XMEN DARK PHOENIX movie happening It’s simple Following Disney acquisition Fox Marvel’s merry mutant set folded Marvel Cinematic Universe possibly sooner think it’s hard feel excited even care movie shame it’s based one iconic XMen story time fact we’ve deal uninspiring choice Simon Kinberg director isn’t helping anyone’s hype level Prediction generation XMen ended Logan movie potentially frustratingly pointless mention bad well MEN BLACK INTERNATIONAL Thor Ragnarok’s Chris Hemsworth Tessa Thompson team time they’re going global Men Black International series relied star power Smith interesting see premise live beyond Director F Gary Gray interesting choice he’s lot grittier fun polished style previous entry series trouble one fact whole movie based twist that’s obvious it’s painful maybe don’t watch trailer help Prediction chemistry two lead carry one TOY STORY 4 toy back town know they’re town Toy Story 3 perfect send character road trip core movie better damn good risk perfect record series enjoyed far Seeing original Toy Story one top 5 film time excited worried one Prediction weakest entry series still strong outing lovable toy notable release June Reboots Grudge Child’s Play go headtohead horror crown June month horror movie need exceptional make splash box office don’t see either relevant July SPIDERMAN FAR HOME next generation Marvel Cinematic Universe begins… Sony movie movie pick Avengers Endgame leaf effectively ruin large part Endgame knew character weren’t staying dead anyway though right Jake Gyllenhaal pop Mysterio one Tom Holland friend go field trip throughout Europe feeling solid even though I’ve never big fan Spidey outside New York Prediction magic made Homecoming fun watch LION KING Disney’s “live action” version Lion King massive box office year People flat love original far enough removed first movie get away obvious cash grab allstar cast including return James Earl Jones Mufasa hype chart one Jungle Book Iron Man director Jon Favreau behind lens sure one biggest hit year Prediction Disney’s biggest movie year named Avengers Endgame notable release July Quentin Tarantino’s Upon Time Hollywood boast Leonardo DiCaprio Brad Pitt Margot Robbie Kurt Russell movie set Hollywood around time Charles Manson murder one boasting Oscarcredentials August HOBBS SHAW Rock Jason Statham return character Fast Furious series time they’re one running show Idris Elba throwing weight around villain movie sure incredible fun actionpacked insanity one movie fact Atomic Blonde Deadpool 2 director David Leitch behind camera brings action chop Prediction guiltypleasure train roll Fast Furious continues prove doubter wrong NEW MUTANTS movie heartbreaker XMen fan boast cinematic debut secondfavourite Xman Cannonball seems interesting concept core superhero movie that’s actually horror film number delay mixed large number reshoots including strange addition entirely new character said reshoots make sound like total clusterfk Marvel’s imminent dismantling universe make irrelevant Dark Phoenix Prediction feel bad cast one especially Game Thrones’ Maisie Williams Stranger Things’ Charlie Heaton Split’s Anya TaylorJoy fancy swag they’ll wearing award season pick Razzies September CHAPTER 2 love book one favourite novel time original movie favorite mine growing haunting nightmare year 2017’s Chapter 1 everything wanted movie featured fantastic young cast performance Bill Skarsgard Pennywise quickly killed negative comparison Tim Curry’s iconic turn horrific clown James McEvoy Jessica Chastain Bill Hader joining cast sequel I’m incredibly excited one Prediction strong second chapter compliment first making two movie combine best Stephen King adaptation time October JOKER Comedy director Todd Phillips brings new version Clown Prince Crime life Jaoquin Phoenix latest actor iconic make purple suit Seeing recent version Joker Jared Leto’s turn Suicide Squad Phoenix need pretty good liked fan fact one disconnected DC’s shared universe mean could room breathe manage something special Prediction Martin Scorcese involved movie long existence one could well surprise notable release October Zombieland finally get released October ten year predecessor Hype series hasn’t lasted long unfortunately though writer went write two Deadpool movie director inconsistent including 2018’s messy Venom I’m sure anyone care series anymore I’ll happy prove wrong though November TERMINATOR 6 still releasing Terminator movie Arnold Schwarzenegger one even see return Linda Hamilton Sarah Connor hopeful element movie though come fact James Cameron much involved time around Deadpool’s Tim Miller behind lens director I’ve frankly given caring getting excited series though Prediction Another unnecessarily convoluted entry series notable release November November riddled absolute punt form Charlies Angels reboot prequel Kingsman titled Great Game movie adaptation video game Sonic Hedgehog movie could good right particular Kingsman trustworthy director form Matthew Vaughan Unfortunately they’re trying avoid family juggernaut releasing November Frozen 2 December JUMANJI 3 people make Jumanji complete masochist They’ve decided release time Star Wars movie previous Jumanji movie complete shock qualitywise boxofficesuccesswise don’t think anyone predicted sequel happening Rock Kevin Hart Jack Black Karen Gillen returning Jake Kasdan directing movie sure fun last one Prediction cast carry one make much fun previous entry STAR WARS EPISODE IX big one arrived JJ Abrams back director’s chair fate Rey Kylo Ren Finn Poe Dameron revealed 9th episode iconic series see character go hiatus least even manage survive past end expect firework fact fan aggressively outspoken dislike Last Jedi mean stake high Disney one Star Wars fan could stomach prequels George Lucas running show Disney delivers two unsatisfactory entry saga row Star Wars good place Prediction JJ give fan want Star Wars get one strongest entry modern era 2019 Movies Review 2019 potential alltime great year movie mix heavyhitters form Avengers End Game Star Wars Episode IX many secondtier movie ready step can’t help love hate One thing definitely sure We’ll plenty discus year Nerd Club podcast — — — — — — — — — — — — — — — — — — — — — — Nerd Club news review sure follow u Facebook Twitter Instagram subscribe monthly podcast available major podcasting apps meet discus one classic piece nerd culture monthTags Movies Podcast Film Star Wars Marvel

Spider-Man : Into the Spiderverse Review

Spider-Man : Into the Spiderverse Review Plot: Spider-Man: Into the Spiderverse serves as an origin story for Spider-man. However it is self aware enough to not bore fans with the same Peter Parker storyline for the third or fourth time. Instead we are introduced to Miles Morales. The new Spider-Man and someone who is slightly More complex and relatable in comparison to Peter Parker. Without giving too much away after being introduced to our lead Miles we are introduced to many other characters who also have the spider sense. These characters all end up in Miles’ dimension due to a worm hole in the Universe. Is it meant to be or caused by something more sinister? Trailer Talk The trailer gives a lot away and the YouTube featurettes leave almost nothing to be desired.There is a lot of heart and fun in this movie but it seems like the studio over marketed that aspect. If I were you I wouldn’t watch any trailers. Stand out Characters The standout performances in this movie for me were Jake Johnson as Peter Parker and Hailee Steinfeld as Gwen Stacy. Although all the voice acting was superb on all fronts the story felt most at home when these two were on the screen. It could be because both are already established actors or perhaps they were given the most to do in the film. Either way both characters added a new dimension to the film that caused me to really enjoy it. Peter Parker being the washed up teacher trying to get back on his feet and Gwen Stacey bringing in that element of leadership but also being too afraid to fail or let anyone in. Overall In total the movie is a Miles Morales origin story. However because he is growing and learning the film mostly leans on his surroundings to be the source of entertainment as the audience and Miles kind of just sit and learn. You can expect Team ups and battles that in my personal opinion top most live action superhero movies. You’ll also need to look out for the killer soundtrack and score of this film. From Sun flower by Post Malone to the theme you hear for the Villain Prowler all of the sounds in this movie will give you goosebumps. The powerful message in Spider-Man: Into the Spider Verse and the final change in narrative puts it in my Top five favorite movies of 2018, if not my favorite superhero movie this year. I’ll give this movie a 9.5/10 only because the movie lacked a little in fight sequences. 9.5/10 What did you think of the film ???

https://medium.com/@billykoffer/spider-man-into-the-spiderverse-review-8368c11dff78

['Billy K.']

2018-12-13 20:37:36.239000+00:00

['Marvel', 'Film Reviews', 'Movie Review', 'Spider Man', 'Cinema']

Title SpiderMan Spiderverse ReviewContent SpiderMan Spiderverse Review Plot SpiderMan Spiderverse serf origin story Spiderman However self aware enough bore fan Peter Parker storyline third fourth time Instead introduced Miles Morales new SpiderMan someone slightly complex relatable comparison Peter Parker Without giving much away introduced lead Miles introduced many character also spider sense character end Miles’ dimension due worm hole Universe meant caused something sinister Trailer Talk trailer give lot away YouTube featurettes leave almost nothing desiredThere lot heart fun movie seems like studio marketed aspect wouldn’t watch trailer Stand Characters standout performance movie Jake Johnson Peter Parker Hailee Steinfeld Gwen Stacy Although voice acting superb front story felt home two screen could already established actor perhaps given film Either way character added new dimension film caused really enjoy Peter Parker washed teacher trying get back foot Gwen Stacey bringing element leadership also afraid fail let anyone Overall total movie Miles Morales origin story However growing learning film mostly lean surroundings source entertainment audience Miles kind sit learn expect Team ups battle personal opinion top live action superhero movie You’ll also need look killer soundtrack score film Sun flower Post Malone theme hear Villain Prowler sound movie give goosebump powerful message SpiderMan Spider Verse final change narrative put Top five favorite movie 2018 favorite superhero movie year I’ll give movie 9510 movie lacked little fight sequence 9510 think film Tags Marvel Film Reviews Movie Review Spider Man Cinema

Feminal superhero movies which should be made now

Feminal superhero movies which should be made now Superheroes are one of the most loved characters of fictional movies among the audience and the viewers. Specially the male superheroes that leads in the movies are the ones which are appreciated by most of the people who love watching fictional films. Masculine superheroes such as Superman, Batman, Hulk and many other characters have gained immense attention from the public and now they are one of the most prominent figures. But then why the female superhero characters are being ignored? Why there are no movies based on the female superheroes that can really dominate the screen. We always have beautiful superhero female characters such as Wonderwoman, Batgirl, Supergirl and many such which really has a connection with the male superheroes and also have helped them in many ways to defeat the super villains. Why can only male superheroes dominate the screen and not female? It’s just because male superheroes are muscular and male or is it that female superheroes are being ignored from the scenario? If it’s so then now, all the filmmakers need to understand that even female superhero can dominate the big screens. Who will not love a female superhero movie, where the lead is played by a beautiful female superhero character? Everyone will. So now, movies should be made on female fictional artists apart from the male ones. Below mentioned are one of the most famous and beloved female superheroes on which the movies should be made as soon as possible:- 1) Batgirl — Batgirl has her appearances in most of the DC comics where she first appeared in Batman (April 1961) and is also depicted as the female counterparts to the superhero Batman. Batgirl as depicted by several comic books resembles an important character where she acts as a detective and solving mysteries and also helping the people around her whenever it is possible for her. Batgirl was basically written by Bill Finger and graphics were done by Sheldon Moldoff. Apart from the character of Batgirl, we also find that Batgirl belongs to the Gothic city and the Batman Family where she should also be treated equally as the Batman. Her several appearances in the fictional books also shows her importance in the batman series and therefore there should be a movie definitely made on Batgirl. 2) Wasp (Janet Van Dyne) — Wasp is a fictional female superhero which appears in most American comic books published by Marvel comics. Written by Stan Lee, this female character was first appeared in the comic book of Tales to Astonish. Wasp is one of the female superhero who is the first female Avenger and also a long time leader to the team. She was one who was also the founder of the team when it was first formed. The character of wasp is usually depicted as having wings and ability to shrink herself and also has the power of bioelectric energy blasts. Apart from having some amazing super powers, Wasp was also ranked as the fifth greatest avenger of all the time by Marvel creations. So by looking at her powers and her role, she surely deserves to get a good shot on big screens. 3) She-Hulk — She-hulk is the female superhero that belongs to the Hulk family. Created by Stan Lee, She-hulk mostly appears in the Marvel comics, where she plays a role of a cousin to Hulk. As per the series, she-hulk was the character who received blood from her cousin hulk when once she was injured, which also led to her acquiring of special powers from her superhero cousin Hulk. as depicted in the series, She-hulk is a prominent figure which acquires a huge feminine power. She is super-strong, indestructible and very powerful covered with those green body same like Hulk. She-hulk also has been a member to the Fantastic four, Avenger, Heroes for life and many more. Her role is powerful but with it, she also resembles her personality as well. By looking at her powers and role, She-hulk definitely needs a chance to showcase herself in the big screens as well. 4) Storm — Storm is a fictional superhero character which has her existence in Marvel Comics from a pretty long time. Her first appearance can be traced in Giant-Size X-Men in May 1975 and this character is created by Len Wein. Storm is also the first woman superhero of color, which determines her existence which is not related to color and also depicts that how she is important to both X-Men and Marvel lore. Storm is meant to be born with superhuman abilities and her character is depicted as the woman superhero who has the ability to control the weather and fly and also she is member of the X-men group. In the comic series, Storm is also married to superhero Black Panther and then becomes the Queen Consort of the African nation of Wakanda. This character is very interesting on the series and therefore she needs definitely a shot to get appear on the screens. 5) Black Widow — Written by Stan Lee, the character of Black Widow was first introduced in the Tales of Suspense in April 1964. Published by the Marvel comic Books, Black widow is also a part of Avengers, Iron Man, S.H.I.E.LD and many other series by the Marvel Creations. Black widow had her existence since the 60’s and then later became a prominent figure in the Marvel Universe. She is usually depicted as the founding member of Avengers and a fictional spy agent in most of the series. The series also shows that first she was introduced as the villain but further she transformed herself and made her appearance in Avengers and S.H.I.E.L.D by leaving her past behind. She was also seen in the latest movie named Captain America:Civil War, where her role was largely appreciated. Henceforth, by looking at her role and transformation, she should be definitely portrayed on the big screens. If movies are made on this female superheroes then it would surely work wonders because every movie with good fictional characters and story, definitely works on screens.

https://medium.com/@FictionPulp/feminal-superhero-movies-which-should-be-made-now-25a5a781c25e

[]

2016-10-10 05:29:58.632000+00:00

['Movies', 'Comics', 'Woman', 'Marvel', 'Fiction']

Title Feminal superhero movie made nowContent Feminal superhero movie made Superheroes one loved character fictional movie among audience viewer Specially male superheroes lead movie one appreciated people love watching fictional film Masculine superheroes Superman Batman Hulk many character gained immense attention public one prominent figure female superhero character ignored movie based female superheroes really dominate screen always beautiful superhero female character Wonderwoman Batgirl Supergirl many really connection male superheroes also helped many way defeat super villain male superheroes dominate screen female It’s male superheroes muscular male female superheroes ignored scenario it’s filmmaker need understand even female superhero dominate big screen love female superhero movie lead played beautiful female superhero character Everyone movie made female fictional artist apart male one mentioned one famous beloved female superheroes movie made soon possible 1 Batgirl — Batgirl appearance DC comic first appeared Batman April 1961 also depicted female counterpart superhero Batman Batgirl depicted several comic book resembles important character act detective solving mystery also helping people around whenever possible Batgirl basically written Bill Finger graphic done Sheldon Moldoff Apart character Batgirl also find Batgirl belongs Gothic city Batman Family also treated equally Batman several appearance fictional book also show importance batman series therefore movie definitely made Batgirl 2 Wasp Janet Van Dyne — Wasp fictional female superhero appears American comic book published Marvel comic Written Stan Lee female character first appeared comic book Tales Astonish Wasp one female superhero first female Avenger also long time leader team one also founder team first formed character wasp usually depicted wing ability shrink also power bioelectric energy blast Apart amazing super power Wasp also ranked fifth greatest avenger time Marvel creation looking power role surely deserves get good shot big screen 3 SheHulk — Shehulk female superhero belongs Hulk family Created Stan Lee Shehulk mostly appears Marvel comic play role cousin Hulk per series shehulk character received blood cousin hulk injured also led acquiring special power superhero cousin Hulk depicted series Shehulk prominent figure acquires huge feminine power superstrong indestructible powerful covered green body like Hulk Shehulk also member Fantastic four Avenger Heroes life many role powerful also resembles personality well looking power role Shehulk definitely need chance showcase big screen well 4 Storm — Storm fictional superhero character existence Marvel Comics pretty long time first appearance traced GiantSize XMen May 1975 character created Len Wein Storm also first woman superhero color determines existence related color also depicts important XMen Marvel lore Storm meant born superhuman ability character depicted woman superhero ability control weather fly also member Xmen group comic series Storm also married superhero Black Panther becomes Queen Consort African nation Wakanda character interesting series therefore need definitely shot get appear screen 5 Black Widow — Written Stan Lee character Black Widow first introduced Tales Suspense April 1964 Published Marvel comic Books Black widow also part Avengers Iron Man SHIELD many series Marvel Creations Black widow existence since 60’s later became prominent figure Marvel Universe usually depicted founding member Avengers fictional spy agent series series also show first introduced villain transformed made appearance Avengers SHIELD leaving past behind also seen latest movie named Captain AmericaCivil War role largely appreciated Henceforth looking role transformation definitely portrayed big screen movie made female superheroes would surely work wonder every movie good fictional character story definitely work screensTags Movies Comics Woman Marvel Fiction

Comic fans say APA superheroine another step in the right direction

Comic fans say APA superheroine another step in the right direction Between an African-American Captain America, a Pakistani-Muslim Ms. Marvel and a female Thor, the comic community has been rocked by recent announcements of a more diverse superhero world. New to the list is Marvel’s Silk, an Asian-American female superhero who will have her own ongoing series in February 2015. “More diversity in superheroes is better for everyone,” said Peter Casazza, owner of Big Planet Comics in College Park, Md. His store plans to carry the series after its release in February. “It makes it easier for all kinds of people with all kinds of perspectives to enter the comic world,” he said. Silk, or Cindy Moon, was introduced in the most recent “Amazing Spiderman” series as a classmate of Peter Parker’s who was bitten by the same radioactive spider that activated his superpowers. On Oct. 12 at the New York Comic Con, Comic publisher Marvel announced that Silk’s story would become a spin-off series. James Alexander, who organizes a regular D.C. comic fan meet-up, said that he hopes Silk develops beyond the overdone “female version of a superhero that is bigger and better.” “I still have some mixed feelings about Marvel’s diversity-oriented story lines,” he said. “Generally, I think they can be exciting, but let’s face it, sometimes these stories fall flat.” Casazza said a comic’s quality depends more on the writer than on the character’s initial appearance. “[Silk] kind of came out of nowhere, and it looks like it’s developing into an interesting story,” said Casazza. Esther Kim, manager of Fantom Comics in D.C., said she was excited by Marvel’s recent steps toward highlighting women in the comic world, particularly with Silk as an Asian American. “It looks like she’s going to be an amazing and complicated character in her own right, not just a badly represented knock-off of Spidey’s powers,” said Esther Kim. “She’s clearly got her own history and set of issues and a determination to stand on her own.” [caption id=”attachment_6892" align=”alignnone” width=”791"] Illustration courtesy of Kristafer Anka.[/caption] Silk is not the first Asian in the Marvel Universe. The Green Turtle, birthed in 1944, is considered comics’ first Asian-American hero, though editors disguised his Chinese-American heritage from post-World War II readers who held “yellow peril” fears. Since the late 80s, Singaporean superheroine Tyger Tiger and the X-Men’s Chinese Jubilee have made appearances in the Marvel Universe. Silk’s first issue will be written by Robbie Thompson, known for his work with The CW Network’s popular show “Supernatural.” It will be illustrated by Stacey Lee, whose work, Casazza said, is “fresh and engaging,” with “a lot of energy and dynamic movement.” Salwa Shan, a junior biology and education student at the University of Maryland who has been reading comics since she was a child, said she was hesitant to see how Marvel would portray Silk. “One thing I noticed especially in comics is that women are always oversexualized,” she said. In Lee’s depiction, Shan said she still saw over-sexualization, “but it’s not as prevalent.” Despite the steps toward diversity in comics, critics say that the stereotypical imagery associated with Asian culture and the particular objectification and over-sexualization of Asian-American women in comics continues. Casazza said Marvel’s track record with diversity, in terms of artists, writers and characters, has been “terrible,” but social media has allowed publishers to see their true audience base without investing money. “Almost every series has been about white men,” he said. “Now, with the Internet and social media opening up the comic world, finally there’s diversity of artists and creators that are reaching out to people with different perspectives.” Kim said the popularity of the new Pakistani-Muslim Ms. Marvel, Fantom Comics’ top-selling book, let comic publishers “take a chance on characters and audiences they wouldn’t necessarily have tried to reach before.” Shan said Marvel has realized it must move past its typical protagonist. “It’s really important for the target audience, which I believe is very vast and very diverse, to feel a connection to the main character,” Shan said. Featured illustration courtesy of Robert Negrete.

https://medium.com/umdplex/comic-fans-say-apa-superheroine-another-step-in-the-right-direction-4734e45ffd

[]

2016-08-10 16:57:13.965000+00:00

['Comics', 'Marvel']

Title Comic fan say APA superheroine another step right directionContent Comic fan say APA superheroine another step right direction AfricanAmerican Captain America PakistaniMuslim Ms Marvel female Thor comic community rocked recent announcement diverse superhero world New list Marvel’s Silk AsianAmerican female superhero ongoing series February 2015 “More diversity superheroes better everyone” said Peter Casazza owner Big Planet Comics College Park Md store plan carry series release February “It make easier kind people kind perspective enter comic world” said Silk Cindy Moon introduced recent “Amazing Spiderman” series classmate Peter Parker’s bitten radioactive spider activated superpower Oct 12 New York Comic Con Comic publisher Marvel announced Silk’s story would become spinoff series James Alexander organizes regular DC comic fan meetup said hope Silk develops beyond overdone “female version superhero bigger better” “I still mixed feeling Marvel’s diversityoriented story lines” said “Generally think exciting let’s face sometimes story fall flat” Casazza said comic’s quality depends writer character’s initial appearance “Silk kind came nowhere look like it’s developing interesting story” said Casazza Esther Kim manager Fantom Comics DC said excited Marvel’s recent step toward highlighting woman comic world particularly Silk Asian American “It look like she’s going amazing complicated character right badly represented knockoff Spidey’s powers” said Esther Kim “She’s clearly got history set issue determination stand own” caption id”attachment6892 align”alignnone” width”791 Illustration courtesy Kristafer Ankacaption Silk first Asian Marvel Universe Green Turtle birthed 1944 considered comics’ first AsianAmerican hero though editor disguised ChineseAmerican heritage postWorld War II reader held “yellow peril” fear Since late 80 Singaporean superheroine Tyger Tiger XMen’s Chinese Jubilee made appearance Marvel Universe Silk’s first issue written Robbie Thompson known work CW Network’s popular show “Supernatural” illustrated Stacey Lee whose work Casazza said “fresh engaging” “a lot energy dynamic movement” Salwa junior biology education student University Maryland reading comic since child said hesitant see Marvel would portray Silk “One thing noticed especially comic woman always oversexualized” said Lee’s depiction said still saw oversexualization “but it’s prevalent” Despite step toward diversity comic critic say stereotypical imagery associated Asian culture particular objectification oversexualization AsianAmerican woman comic continues Casazza said Marvel’s track record diversity term artist writer character “terrible” social medium allowed publisher see true audience base without investing money “Almost every series white men” said “Now Internet social medium opening comic world finally there’s diversity artist creator reaching people different perspectives” Kim said popularity new PakistaniMuslim Ms Marvel Fantom Comics’ topselling book let comic publisher “take chance character audience wouldn’t necessarily tried reach before” said Marvel realized must move past typical protagonist “It’s really important target audience believe vast diverse feel connection main character” said Featured illustration courtesy Robert NegreteTags Comics Marvel

Marvel’s Avengers Is A Superpowered Game With Super-Weaknesses

When It Comes To Superheroes, The Marvel’s Avengers Are Arguably The Most Popular Group In The World. Marvel’s Motley Crew May Seem Incompatible On Paper (A Huge Green Guy With Anger Issues, A Rich Man In A Chrome Power Suit, The God Of Thunder, Etc.),But When They Come Together, They Make Veritable Music. Having A Blockbuster Movie Franchise And Countless Product Placement Deals And Crossovers Doesn’t Hurt, Either. When Powerhouse Developer Crystal Dynamics Joined Up With Square Enix To Create The “Definitive” Avengers Game In Marvel’s Avengers, Gaming And Comic Fans Were Confident The Pair Could Deliver A Fantastic Product — And The First Really Great Avengers-Only Game. Now That The Full Game Is Here, It’s Certainly Safe To Say That It’s Accomplished Most Of What It Set Out To Do. Marvel’s Avengers Is An Interesting Combination Of An Excellent Solo Campaign And A So-So Multiplayer Game That Could Honestly Have Been Left Off Entirely. Overall, It’s A Fantastic Offering For Both Comic Fans And Anyone Looking For A Lengthy, Stylistic Adventure.It Makes Good Use Of Each Avenger’s Individual Powers And Still Leaves Room For Players To Progress The Way They Want. Though The Game Is Called Marvel’s Avengers, You Actually Kick Off The Game As A Young Kamala Khan, One Of The Biggest Avengers Fangirls In The Known World. It’s A Breath Of Fresh Air To Play As A Hero Who Hasn’t Had Much Time In The Spotlight When It Comes To The Gaming World. If The Prospect Excites You, You’ll Be Glad To Know That You Actually Play As Kamala Quite A Bit. At The Beginning Of The Game, Kamala Has Been Chosen As A Finalist In An Avengers Fan Fiction Contest, And She’s Created Her Own Comic Book Chock Full Of The Same Kind Of Stories Many Fans Of The Troupe Write. She’s Invited To A Massive Celebration That Finds Her Being Shuffled Through A Few Fair-Like Areas Built To Honor The Avengers. Kamala Is A Perfect Surrogate For Any Avengers Fan, As She’s Brimming With The Kind Of Knowledge That Enthusiasts Like To Spout At Every Opportunity To Prove How Much They Remember About The Heroes. The Game Gives You Plenty Of Opportunities To Learn More About Kamala In This Way, As She Checks The Fair For Comic Books She Needs To Enter A VIP Area. But Then, Caught Up In The Action, Kamala Witnesses A Harrowing Event (A-Day) That Changes The Way The Public Views The Avengers And Superheroes For, Seemingly, The Foreseeable Future. A-Day Reveals The Avengers Struggling To Fight Off A Terrorist Cell That Crashes The Party.In The Confusion, Kamala Is Able To Get To Safety, But The Game Shifts Focus To The Avengers Themselves. They Make Their Way Over To The Golden Gate Bridge, Which Is Teeming With Terrified People Looking For A Way Out Of The Situation. There’s A Brief Introduction To Each Avenger To Get Acquainted With How They Play, But Ultimately, This Section Acts As A Way To Introduce The Downfall Of The Avengers, So You’re Not As Shocked When It’s Time To Get Back To Kamala. Five Years After The Events That Rocked A-Day, The Avengers Have Been Publicly Denounced And Disbanded.Kamala Finds Herself With Powers Of Her Own And Takes It Upon Herself To Get The Avengers Back Together. Though Much Of The Time You’ll Play As Kamala, Who Has The Power To Enlarge Her Limbs — Imagine Huge Fists To Punch You, Enormous Feet To Kick You — You’ll Also Play As All Of The Avengers. The Game Is Primarily Third-Person Action, With Bits Of Many Of Your Favorite Blockbusters Woven In For Good Measure. With That Said, You’ll Eventually Jump Back Into The Avengers’ Shoes. You’ll Notice That These Versions Of The Superhero Team Look Nothing Like The Celebrities You May Be Used To Seeing Play Them In The Movies. This Is One Of The Game’s Biggest Detriments, As The Heroes Look Like Generic Versions Of Characters Who Are So Popular And Well Known That These Feel Decidedly Off Brand. It Feels Like Not Much Attention Was Paid To Making The Characters Look The Way Fans Would Expect, And It Shows. It’s Just Not Good. It’s Hard To Get Over At First, Especially Since They’re Voiced By Popular Actors In The Gaming Industry, Like Nolan North, Troy Baker And Laura Bailey. But Luckily, Since You’re Usually Seeing Most Of Them From The Back Anyway, It Becomes Less Of An Issue The Longer You Play. Playing As Each Of The Avengers Feels Good, Which Means You Look Forward To Playing As Them (Especially Since Kamala’s Huge Hands And Whatnot Look Unsettling). While All Of The Characters Are Controlled The Same Way, They All Feel Unique And Different. It’s An Impressive Feat, To Say The Least. Out Of All The Avengers, You Spend The Most Time With The Hulk, Either In His Souped-Up Form Or As Bruce Banner, Who Acts As Something Of A Mentor To Kamala. It’s A Good Thing, Too, Because The Hulk Is The Most Exciting Member Of The Group To Play As. He May Be Slow And Lumbering, But You Get Such A Rush From Crashing Into Things And Absolutely Obliterating Enemies That You Barely Notice The Speed Issues. Meanwhile, Thor Is A Second Favorite, As Swinging Around His Hammer, Mjolnir, Feels Exactly The Way You’d Hope It Would. He’s The Closest Analog To Characters Like God Of War’s Kratos, And His Abilities To Knock Enemies Out And Toss Them Around Feel Quite Empowering. You’d Think Iron Man Would Be One Of The Most Fun Members Of The Group To Play As, But Even With All His Fancy Tricks Such As Jetting Through The Sky And His Sarcastic Attitude, He’s Just Not The Most Exciting. He’s A Great Choice For Airborne Attacks, Outfitted With Energy Beams, And Rockets Hurtling Through The Air. But This Game Is All About Getting Into Close-Quarters Combat And Feeling Your Fists Connect With Baddies. Captain America Is Rife With Powerful Melee Attacks, And His Shield Can Do Some Serious Damage. Throwing His Shield Makes For Some Hilarious Moments, But You Must Fight With Precision If You Want To Cause The Most Trouble For Enemies. Black Widow Is Typically The Least Compelling Of The Avengers, Given That She Has So Few Remarkable Abilities. But She’s Used To Great Effect In Marvel’s Avengers. She’s Quick, Agile And Great With Landing Blows. She’s The Kind Of Sprightly That You Don’t Want To See When You’re On The Losing Side, And That Was Refreshing. Finally, Playing As Kamala Is The Strangest Experience Of The Entire Group. Her Massive Limbs Feel Good To Land Punches And Kicks, But The Visuals Are Totally Odd. Related: She’s Still Fun To Embody, As Her Infectious Personality Makes Her One Of The Most Enjoyable Characters In The Game. If You’re Not Interested In Playing The Campaign, You Can Jump Straight Into The Avengers Initiative. It Isn’t The Optimal Choice, But It’s There If You Don’t Want To See The Story Play Out And Would Rather Hop Into The Multiplayer Option Instead. However, This Mode Is Nowhere Near As Engaging And In Fact Feels A Bit Tacked On. You’re Mostly Encouraged To Play A Variety Of Set Missions While Collecting Trinkets, And It’s Just Not As Interesting As The Main Story, Because You Have No Drive To Complete Your Objectives. If You Have Friends To Play With, It Can Be Exciting, But Otherwise It Feels Like A Bit Of A Waste. Back In The Single-Player Game, There’s More To Be Done Than Just Bashing Skulls As Your Favorite Heroes. You Also Need To Sift Through A Variety Of Skill Trees If You Want To Upgrade The Avengers. Over The 10- To 12-Hour Campaign, You Get A Variety Of Skills And Unlocks To Play Around With. It’s Exhilarating To Collect Abilities And Skills, But What Isn’t Exciting Is The Fact That The Game Is Clearly Heavily Invested In Its Games-As-A-Service Structure. As You Round Up The Avengers Once More, You Establish A Base That You Can Use To Buy Additional Items From, As Well As Complete Extra Team Missions And Daily Challenges. It’s Here That The Game Effectively Turns Into A Grind. Much Like Destiny, You’re Tasked With Raising A Power Level. There Are Cosmetic Options Like Skins To Unlock, And So Many Items To Customize Your Character With That It’ll Make Your Head Spin. Unfortunately, Changing The Cosmetics On Your Heroes Doesn’t Reflect The Change In The Game. With A Game That’s All About Collecting Items And Using Them And Being Encouraged To Buy More, This Is Pretty Infuriating. It’s Also Irritating That Cosmetic Skins Are As Pricey As They Are. If It Weren’t For The Great Single-Player Campaign Gameplay, It Would Be Hard To Recommend The Game. Luckily, You Can Ignore These Things Pretty Easily And Have A Fun Time With Your Favorite Heroes. In The End, Marvel’s Avengers Is A Well-Crafted Adventure That Fans Are Likely To Love. It Certainly Has Its Hiccups, With Its Excessive Items To Collect And A Grind Nature As Well As A Disappointing Multiplayer Mode, But It’s Also Exciting To Watch The Story Play Out, Especially Through Kamala’s Eyes. For Anyone Who’s Ever Wanted To Be A Superhero, For All Its Issues, Marvel’s Avengers Is Still A Game Well Worth Your Time. If You Aren’t Playing Its Game You Have To Stand And Get It Here On Amazon Ou Can Get It In

https://medium.com/@gamedrops/marvels-avengers-is-a-superpowered-game-with-super-weaknesses-80965929659b

['Bryan Lucca']

2020-12-16 15:01:10.916000+00:00

['Avengers', 'Marvel']

Title Marvel’s Avengers Superpowered Game SuperWeaknessesContent Comes Superheroes Marvel’s Avengers Arguably Popular Group World Marvel’s Motley Crew May Seem Incompatible Paper Huge Green Guy Anger Issues Rich Man Chrome Power Suit God Thunder EtcBut Come Together Make Veritable Music Blockbuster Movie Franchise Countless Product Placement Deals Crossovers Doesn’t Hurt Either Powerhouse Developer Crystal Dynamics Joined Square Enix Create “Definitive” Avengers Game Marvel’s Avengers Gaming Comic Fans Confident Pair Could Deliver Fantastic Product — First Really Great AvengersOnly Game Full Game It’s Certainly Safe Say It’s Accomplished Set Marvel’s Avengers Interesting Combination Excellent Solo Campaign SoSo Multiplayer Game Could Honestly Left Entirely Overall It’s Fantastic Offering Comic Fans Anyone Looking Lengthy Stylistic AdventureIt Makes Good Use Avenger’s Individual Powers Still Leaves Room Players Progress Way Want Though Game Called Marvel’s Avengers Actually Kick Game Young Kamala Khan One Biggest Avengers Fangirls Known World It’s Breath Fresh Air Play Hero Hasn’t Much Time Spotlight Comes Gaming World Prospect Excites You’ll Glad Know Actually Play Kamala Quite Bit Beginning Game Kamala Chosen Finalist Avengers Fan Fiction Contest She’s Created Comic Book Chock Full Kind Stories Many Fans Troupe Write She’s Invited Massive Celebration Finds Shuffled FairLike Areas Built Honor Avengers Kamala Perfect Surrogate Avengers Fan She’s Brimming Kind Knowledge Enthusiasts Like Spout Every Opportunity Prove Much Remember Heroes Game Gives Plenty Opportunities Learn Kamala Way Checks Fair Comic Books Needs Enter VIP Area Caught Action Kamala Witnesses Harrowing Event ADay Changes Way Public Views Avengers Superheroes Seemingly Foreseeable Future ADay Reveals Avengers Struggling Fight Terrorist Cell Crashes PartyIn Confusion Kamala Able Get Safety Game Shifts Focus Avengers Make Way Golden Gate Bridge Teeming Terrified People Looking Way Situation There’s Brief Introduction Avenger Get Acquainted Play Ultimately Section Acts Way Introduce Downfall Avengers You’re Shocked It’s Time Get Back Kamala Five Years Events Rocked ADay Avengers Publicly Denounced DisbandedKamala Finds Powers Takes Upon Get Avengers Back Together Though Much Time You’ll Play Kamala Power Enlarge Limbs — Imagine Huge Fists Punch Enormous Feet Kick — You’ll Also Play Avengers Game Primarily ThirdPerson Action Bits Many Favorite Blockbusters Woven Good Measure Said You’ll Eventually Jump Back Avengers’ Shoes You’ll Notice Versions Superhero Team Look Nothing Like Celebrities May Used Seeing Play Movies One Game’s Biggest Detriments Heroes Look Like Generic Versions Characters Popular Well Known Feel Decidedly Brand Feels Like Much Attention Paid Making Characters Look Way Fans Would Expect Shows It’s Good It’s Hard Get First Especially Since They’re Voiced Popular Actors Gaming Industry Like Nolan North Troy Baker Laura Bailey Luckily Since You’re Usually Seeing Back Anyway Becomes Less Issue Longer Play Playing Avengers Feels Good Means Look Forward Playing Especially Since Kamala’s Huge Hands Whatnot Look Unsettling Characters Controlled Way Feel Unique Different It’s Impressive Feat Say Least Avengers Spend Time Hulk Either SoupedUp Form Bruce Banner Acts Something Mentor Kamala It’s Good Thing Hulk Exciting Member Group Play May Slow Lumbering Get Rush Crashing Things Absolutely Obliterating Enemies Barely Notice Speed Issues Meanwhile Thor Second Favorite Swinging Around Hammer Mjolnir Feels Exactly Way You’d Hope Would He’s Closest Analog Characters Like God War’s Kratos Abilities Knock Enemies Toss Around Feel Quite Empowering You’d Think Iron Man Would One Fun Members Group Play Even Fancy Tricks Jetting Sky Sarcastic Attitude He’s Exciting He’s Great Choice Airborne Attacks Outfitted Energy Beams Rockets Hurtling Air Game Getting CloseQuarters Combat Feeling Fists Connect Baddies Captain America Rife Powerful Melee Attacks Shield Serious Damage Throwing Shield Makes Hilarious Moments Must Fight Precision Want Cause Trouble Enemies Black Widow Typically Least Compelling Avengers Given Remarkable Abilities She’s Used Great Effect Marvel’s Avengers She’s Quick Agile Great Landing Blows She’s Kind Sprightly Don’t Want See You’re Losing Side Refreshing Finally Playing Kamala Strangest Experience Entire Group Massive Limbs Feel Good Land Punches Kicks Visuals Totally Odd Related She’s Still Fun Embody Infectious Personality Makes One Enjoyable Characters Game You’re Interested Playing Campaign Jump Straight Avengers Initiative Isn’t Optimal Choice It’s Don’t Want See Story Play Would Rather Hop Multiplayer Option Instead However Mode Nowhere Near Engaging Fact Feels Bit Tacked You’re Mostly Encouraged Play Variety Set Missions Collecting Trinkets It’s Interesting Main Story Drive Complete Objectives Friends Play Exciting Otherwise Feels Like Bit Waste Back SinglePlayer Game There’s Done Bashing Skulls Favorite Heroes Also Need Sift Variety Skill Trees Want Upgrade Avengers 10 12Hour Campaign Get Variety Skills Unlocks Play Around It’s Exhilarating Collect Abilities Skills Isn’t Exciting Fact Game Clearly Heavily Invested GamesAsAService Structure Round Avengers Establish Base Use Buy Additional Items Well Complete Extra Team Missions Daily Challenges It’s Game Effectively Turns Grind Much Like Destiny You’re Tasked Raising Power Level Cosmetic Options Like Skins Unlock Many Items Customize Character It’ll Make Head Spin Unfortunately Changing Cosmetics Heroes Doesn’t Reflect Change Game Game That’s Collecting Items Using Encouraged Buy Pretty Infuriating It’s Also Irritating Cosmetic Skins Pricey Weren’t Great SinglePlayer Campaign Gameplay Would Hard Recommend Game Luckily Ignore Things Pretty Easily Fun Time Favorite Heroes End Marvel’s Avengers WellCrafted Adventure Fans Likely Love Certainly Hiccups Excessive Items Collect Grind Nature Well Disappointing Multiplayer Mode It’s Also Exciting Watch Story Play Especially Kamala’s Eyes Anyone Who’s Ever Wanted Superhero Issues Marvel’s Avengers Still Game Well Worth Time Aren’t Playing Game Stand Get Amazon Ou Get InTags Avengers Marvel

The Purpose and Significance of Superheroes in American Culture

Photo by Lena Rose on Unsplash The Purpose and Significance of Superheroes in American Culture Personal Anecdote: Superheroes. The most influential American pop culture icon in my life. The role of superheroes and comics had always been a subtle force in my life, and by subtle, I mean Batman underwear, Spider-Man pajamas, an Incredible Hulk comforter, and a crimson cape like Superman’s. In fact, I had that same Incredible Hulk blanket up until this year, my sophomore year of college, but that’s nearly beside the point. Superheroes weren’t a necessity or driving force in my life, instead, they were a small piece of my childhood, that, unknown to my younger knowledge, would later become a huge part of my identity. It wasn’t until the very first times I saw Iron Man (2008) and The Dark Knight (2008, Heath Ledger will never not be the best Joker), that superheroes became a driving force in my life. I remember the first time I saw Iron Man (2008) and the credits began to role, when the first MCU, Marvel Cinematic Universe, post-credit scene rolled, and the next decade of my life would be invested in comics and superheroes. If you don’t already know, every MCU movie has one more post-credit scenes that hint at or start another movie. In this case, when I saw Nick Fury, played by Samuel L. Jackson, on screen talking to Tony Stark, aka Iron Man, about the Avengers Initiative, when I was suddenly overcome with excitement and I began a very long descent into comic books. A few years later, my dad brought home 3 stacks of comic books, each standing around 1 foot tall, for me and my 2 brothers. They seemingly could not care any less about what they were just given. However, I quickly grabbed my stack, ran to my room and laid them across my twin size bed, nearly covering the entire surface except for a sliver of room on my pillows where I had to sit. Immediately, I began organizing them by Marvel, DC, or other, and then grouped them by their series, and ordered them chronologically. Over the next few weeks I practically drooled over these stories. I remember most of these comics were just the odds and ends that the person who gave them to my dad had. They were comics like Thor, Rocket Raccoon, Silver Surfer, and a few Fantastic Four, but none were Iron Man, Batman, Superman, or Wonder Woman. Realizing I didn’t have any comics of these more iconic Heroes and Heroines, I decided to take to the internet where I found endless wiki pages, blogs, and forums where people talked about comics, and I would just sit there a read as much as I could. Bringing us to today, 2018, a time when Superheroes, or more specifically their movies have become mainstream and hold incredible cultural significance in America. In fact an article on The Ringer, labels the current teenagers and young adults as “ the Superhero Movie Generation”, saying: “Movies are escape — where better than on the wings of a savior? But these movies — episodic excursions larded with humor and that tingling feeling of interconnectivity — crucially prize one thing above all else: return business. And return they do. Young moviegoers who keep showing up to find out what happens next are a defibrillator to a medium on life support. Once upon a time, one could credibly say, Those movies, they’re all the same. But though their provenance — the imagination of teenage boys — has not changed, the final product is morphing every year.” The Ringer says it perfectly, our generation, has a more than just an affinity for superhero films, and films in general, but no film genre takes our generation by storm like superheroes. The MCU being the pivotal provider, and practical creator, of the Superhero Movie Generation. The Heroic History: Throughout nearly all of human history, man has created myth to explain the natural world and the natural order; creating icons to explain why things happen and why man shouldn’t do certain things. Someone of these myths are of these so called “demigods” or half gods, the child of man and god. One of the most famous myths of this “demigod”, is Heracles, or often called Hercules. Heracles possessed godly strength and was considered a “Greek hero”. Another example of the Greek hero concept is the hero Achilles, namesake of the “Achilles Tendon”. He was a man who was dipped in the River Styx, making him invulnerable across his entire body, except behind his ankle. Upon further research, I found that most ancient heroes, in fact a significant majority, are mainly hyper-masculine men who possess great power. On the other hand, women in myth are typically hyper-feminine and overtly sexual, emitting a strong sexual prowess, but in few myths, especially that of the Greek Goddess Artemis, nearly every mythological portrayal of her is modest and nonsexual, as she is basically a goddess of virginity and girlhood. Disney’s Hercules (1997) A sort of, what I call, a “Demigod Dilemma” occurred in ancient cultures, where men had dominated and controlled the stories that were created and told, creating the “Damsel in Distress” character that limits nearly every female character, leaving characters similar to Medea (Greek), who get back at the someone by committing heinous crimes. In the mythic case of Medea, she murdered her children to get get revenge on her ex-man, Jason. Taking Megara, pictured in the GIF, she, throughout, the movie, had acted on her own accord, independently of Hercules, her Greek knight in shining armor equivalent, until the end of the movie. Spoiler alert, in turns out Meg was working against Hercules, even though falling in love with him, and at the end of movie, needs her hero. In terms of a so-called “modern mythos”, the best examples of what carries the ideas of Greek heroes into today, are the Superheroes we see in movies, TV shows, and comic books. Our modern heroes have evolved beyond gods and man, and are now including aliens, mortal men (as in mankind), radiation mishaps, humans with genetic mutations, and some heroes are a spin on ancient gods and goddesses. The heroes we adore today are often taken directly out of ancient myth or at least inspired heavily from ancient myth. Outside of myth, superheros have been known to be drawn and scripted from people around them. In interviews with creators of Superman, specifically Jerry Spiegal, a jewish man, had said: “What led me into creating Superman in the early thirties? … Hearing and reading of the oppression and slaughter of helpless, oppressed Jews in Nazi Germany … seeing movies depicting the horrors of privation suffered by the downtrodden … I had the great urge to help… help the downtrodden masses, somehow. How could I help them when I could barely help myself? Superman was the answer.” The creation of Superman was to save the jewish persecution after the genocide in Europe, and Spiegal has also said his neighborhoods have also seen antisemantic movements. Spiegel has also said that Kal-El, Superman’s birth name, means “voice of God”. Superheroes have been created by people across history has a way to almost “save themselves” or form some level of hope, especially in modern comic book heroism So What are Superheroes? Batman v Superman: Dawn of Justice (2016) Most people, when they word associate with ‘Superheroes’, they will probably think of the same things, Superman, Batman, Wonder Woman, and that’s about it. However, there are significant number of heroes that are nothing like the big three, mentioned above. Most prominently in media and film, the “Guardians of the Galaxy” from their name-sake MCU film series, Guardians of the Galaxy, nearly go against every physical aspect of what makes a hero. This group is made up of a guy, who as child was abducted by aliens, an alien assassin, a raccoon that wields dangerous weapons, a brutish alien that takes things a little to literally, and a tree with a sailor’s tongue. Guardians of the Galaxy Vol 2, by Source, Fair use, link None of them wear capes, have any sort of power (except for Groot, but he’s also a tree so I think that just comes with the game), or have the typical superhero monologue about why they are fueled by justice, helping innocents, or want to stop crime. In fact, the Guardians are completely in it for their own benefit, they work similar to mercenaries, where they are hired heroes, and when comes to doing something major, they seem to be in the fight for they’re own cause of revenge usually. However, as the series continues to move forward, they ultimately are doing their hero work of guarding the galaxy, for the right reasons. I would label this rag-tag group of plants, animals, and people as heroes, even though they’re mission is, at times, unclear. On the other hand, American Comic Book culture adopted a new type of protagonist, who sometimes took on the appearance of a hero, but their actions were more questionable and are defined as being morally ambiguous, often acting completely on their own accord. The Cambridge Dictionary defines an antihero as, “the central character in a play,book, or film who does not have traditionally heroic qualities, such as courage, and is admired instead for what society generally considers to be a weakness of their character”. However, The Antihero has existed outside of comics without argument most commonly in whats called Anti-western Movies, a sub-genre of western films about cowboys. In terms of comic books, however, one of the most famous Anti Heroes is Deadpool. Deadpool wears the questionable tights, has his mutant powers, and has his very typical superhero monologues. In the movie adaption of the comics, the first movie leading Deadpool, 2016’s Deadpool, Wade Wilson (Deadpool), is a mercenary for hire who will “take out” any target for a price, without discriminating if they were a good or bad individual. Once he is diagnosed with cancer, he is offered a trial at suspicious place to be completely cured of cancer, however, he is left with extremely fast healing and looking like, as one character says in the movie, “You look like an avocado had sex with an older, more disgusting avocado” (Full Script). Photo by 20th Century Fox Film Corp Deadpool, oddly as it is, is an antihero by the people for the people, in my opinion. The cinematic entrance of Deadpool in 2016 gross slightly over $363 million domestically and $783 million worldwide and Batman v Superman: Dawn of Justice (2016) mentioned earlier, grossed $330 million domestic and $873 million worldwide. The production budgets of each movie, respectively, were $50 million and $250 million, according to Box Office Mojo. The attractiveness of and affinity towards antiheroes, such as Deadpool, in American culture, according to Psychology Today, is due to the idea that, “Antiheroes liberate us. They reject societal constraints and expectations imposed upon us. Antiheroes give our grievances a voice. They make us feel like something right is being done, even if it is legally wrong. Antiheroes do things we’re afraid to do. They are who they are and they do as they want — without apology.” The antihero is relief of our own lives, and in the highly stressful environment of american society, for youth and adults, there’s no questions as to why Deadpool (2016) was extremely successful. School, college, and work pins down most of America, so when we watch an antihero on screen, we not only feel relieved and “liberated” we also see a portion of ourselves in the vulnerability and humility of these characters. Aside from what a superhero does and looks like, many superheroes have become household names and become iconic parts of American culture, looking at Superman for instance, most people will recognize the “S” on his chest and the star and stripes of Wonder Woman’s belt are almost equally known. However, not every superhero maintains the same cultural popularity or cultural visibility and significance as a superhero. Take, for instance, characters like Eggy from Kingsman: The Secret Service(2014), Judge Dredd from Dredd (2012), or Babydoll from Sucker Punch (2011). These 3 characters lack, for the most part, super powers, and nearly any cultural significance. All three, however, are, in my opinion, superheroes. Looking at Eggy, he is you’re average fella living in a shit situation. He ends up becoming the mentee of England’s best spy, and saves the world on 2 separate occasions in the series. In Dredd, Judge Dredd not only stops a dangerous drug ring, but also takes out corrupt judges in the city, making the city safer. In Sucker Punch, Babydoll is basically imprisoned in the loony bin for defending her sister from their abusive step-father, and ends up helping a girl escape all while suffering fantasitcal delusions. These characters, all on different scales, are successfully saving lives of people and fighting for a good cause in different ways, but none are critically labeled superheroes. This brings me to what I believe makes a superhero, especially a hero on screen, as that is more effective for this superhero movie generation. A superhero, in my opinion, exists only in a fictional world, has a cause, just or unjust, but it will be a good cause, has something to offer everyone, but specifically you, meaning they are essentially your hero, they do not need to possess any sort of power, they do not need to be brutish or extremely powerful, they don’t need any sort of costume or get-up that makes them look like a superhero, and they do not need to be well known character or household name. The Growth of American Comic Book Culture Photo Source Superhero culture of America has different effects for people of nearly every walk of life. As America has become more progressive in terms of acceptance, equality, and treatment of minorities, the image of superheroes. The beginning of popularized comic heroes was filled with less fantastical imagery and more of a patriotic image. Looking at comics from the late 30s and 40s, the storylines we were reading often showed our heroes kicking Hitler’s ass, beating up nazis, and even sometimes freeing nazi camps. Most commonly, comics would feature superheroes sporting red, white, and blue and talking about “freeing millions” or doing “it” for those who couldn’t. The most iconic of these storylines was, of course, Captain America, is, believe it or not, described as “From the dark days of world war to the explosive challenges of today, Super-Soldier Captain America stands ready as a shining sentinel of liberty to shield the oppressed and fight for freedom everywhere.” The Creation of Captain America was to promote the american way and inspire people to contribute to the war. Even after the ending of WW2, the villainous Red Skull, was still engaged in the Captain America comics as a link to the red scare, a time when the American agenda was to fight communism . In an article on CBR, a leading Comic Book news source, called “Punch A Nazi: 15 Times Superheroes Fought Fascism”, write Pete Imbesi recalls 15 times a superhero punched a nazi. His highlights include The Human Torch setting Hitler on fire, Raphael from Teenage Mutant Ninja Turtles punching robot Hitler, Wonder Woman and her mother kicking and punching nazis, and even showing The Joker claiming his patriotism as an “American criminal” with Red Skulls reply, “How unfortunate! Such misplaced patriotism”, even one of the most infamous comic book criminals has felt patriotic enough to fight nazis. Image Source As the decades go by, comic book popularity fluxes, however, in the 50s Comics Code Authority began to regulate comic book content after the public feared there was too much gore and began linking comic books to juvenile delinquency. The CCA’s restrictions made the popularity of comics drop until the rise of underground comic books. Underground comics were published, printed, and sold illegally and through paraphernalia “head shops”. As the illegal industry began to rise and become successful, so did the mainstream, more popular comics. In the 70s comics began to get storylines that were more risky with superheroes take higher risks. For example, in the Spider-Man comics, Gwen Stacy, Spider-Man’s girlfriend, was killed, which was a notable event in comics. Alongside the risk taking of superheroes, comic creators and writers began taking more risk by introducing more and more black and female superheroes that began main-staging their stories. Towards the end of the 80s, comic books became a more legitimate field and was considered an art, and more gruesome and bloody stories were being brought back. Comics began to fluctuate more frequently, every 5 or so years. After the turn of the century, comic books basically stopped abiding by the CCA without consequences. After the turn of the century, it became regular to make and remake superhero movies, however, in the landmark release of The Avengers (2012), with a domestic gross income of $623 million and worldwide of $1.518 billion according to Box Office Mojo, an increase in superhero movie production occurred. Over the last decade Marvel has produced and released nearly 20 interrelated films and more to come in 2019. The MCU movies have become the highest grossing film series to date at over $17 billion. Marvel Studios’ release of Avengers: Infinity War practically broke the box office, reeling in $2.047 billion, and the sequel’s, set to come out April 26, 2019, trailer (below), which came out December 7th, already has had 67.5 million views on the official Marvel Studios youtube channel, which excludes the views seen on social media, online news outlets, online magazines, and possibly TV. Marvel Studio’s Avengers End Game Trailer So How do Fictional Superheroes Affect the Real World? Obviously Superheroes have a grasp on saving their own fictional worlds, but in the real world, the effect of the same heroes does not expand the same way. Instead, a superhero portrayal, especially on screen, has an ambiguous effect on American society. It would be difficult to prove, or show quantitatively, how fictional superheroes effect real life, but there are some coincidences that seem to follow superhero movies. In an article published on Brewings, author Nicol Turner Lee said, “Black Panther” has unequivocally become one of many recent inflection points for the African American community, especially following the success of extraordinary black voter turnout in tough southern elections”. Lee had also said she believed that President Barack Obama, after the wide release of Black Panther(2018), became a hero for black Americans, specifically in the south, comparing him to the fictional hero Black Panther. Image Source Obviously, this is not a direct effect on the black community, but it cannot be limited to sheer coincidence. Looking at this, Black Panther, can be said to have been an inspiration for black american, and not just T’challa, the face behind the mask, but the whole cast and movie. Black Panther more than predominantly featured black Americans and Africans, which gave a lot on screen visibility for POC in America which inspired audiences across the country. The cast even went to premieres around the world adorned in traditional African garb, which also lead to many black Americans attempting to follow their roots and get in touch with their ancestry. After racial visibility, one of the more significant portrayals of a group, would be gender. Superheroes have long been considered to be problematic with the portrayal of women in their comics and movies, mainly concerning the way they are dressed. However, one over looked aspect of female heroes I personally find interesting is the the significance of female heroes actions and personalities in TV, movies, and comics. In a scholarly journal article, Sex Differences in the Creation of Fictional Heroes With Particular Emphasis on Female Heroes and Superheroes in Popular Culture: Insights From Evolutionary Psychology, Victoria Ingalls says this about female heroes created by women: “As with almost all heroes, their heroes use curiosity, cleverness, and determination, but they accomplish their task without skills (or weapons) that give them an initial advantage to those around them, and in the end, most of the female-generated heroes simply try to escape, solve a problem, reveal the truth, or sacrifice themselves without a physical fight.” She also says throughout her research, she has found that female superheroes, created by women, possess higher intelligent and less brute force than their male counterparts. Unlike the male superheroes, who are often more violent, muscular, and possess power that contain volatile force, she found female heroines have powers that aren’t as violent, and if they are violent they do not use them like male heroes, she also found that the female heroes often think their way out of a debacle or battle. This type of visibility for women, not only feeds into female stereotypes, but also feeds into male stereotypes. Creating female heroines as such, this raises the questions of “Well, can women possess and use the great powers and strength the male heroes can? Can a female superhero fight like a man could?” Although it does raise questions like so, this archetype of female hero also portrays women to be more intelligent and thought-oriented. At the same time, this same archetype does in fact portray a female to be able to kick-ass. For example, the video above is a compilation of clips from the American TV show Charmed, which shows one of the 3 sisters, whose character is trained in hand-to-hand and some melee weapon combat, completely kicking ass. This video shows how female hero often uses her intelligence and fighting skills in combination to fight and take down an opponent. In another academic study, Influence of Stereotyping and Prejudices on Perceptions of Superheroes, Emily A. Sanchez, surveys a group of people about superheroes in relation to their race and gender side by side. Sanchez describes her results as so: “The results of the current study suggest there is preexisting superhero schema, as such, heroes who are atypical (alien skin tone) may be set aside as exceptions and evaluated less favorably. Despite similarities to humans (e.g., race and gender), superheroes may create a distinct outgroup. Additionally, superheroes may still be thesubject of gender stereotypes, despite their “super” qualities. Finally, it was observed that perceptions of superheroes may be impacted by the perceivers desire to be more like superheroes (i.e. wishful identification).” Sanchez and Ingalls found that the effect of superheroes on people is subconscious based and often has to do with their desires to be heroic and humility. They both also found that successful heroes are those that audience members, individually, can find something about the hero that they relate to, whether it’s a personality trait, desire, wish, cause, or maybe a love life.

https://medium.com/@dwaibel/the-purpose-and-significance-of-superheroes-in-american-culture-24ef12af19ff

['Dan Waibel']

2018-12-13 04:09:35.116000+00:00

['Movies', 'Superheroes', 'Comics', 'Marvel', 'Culture']

Title Purpose Significance Superheroes American CultureContent Photo Lena Rose Unsplash Purpose Significance Superheroes American Culture Personal Anecdote Superheroes influential American pop culture icon life role superheroes comic always subtle force life subtle mean Batman underwear SpiderMan pajama Incredible Hulk comforter crimson cape like Superman’s fact Incredible Hulk blanket year sophomore year college that’s nearly beside point Superheroes weren’t necessity driving force life instead small piece childhood unknown younger knowledge would later become huge part identity wasn’t first time saw Iron Man 2008 Dark Knight 2008 Heath Ledger never best Joker superheroes became driving force life remember first time saw Iron Man 2008 credit began role first MCU Marvel Cinematic Universe postcredit scene rolled next decade life would invested comic superheroes don’t already know every MCU movie one postcredit scene hint start another movie case saw Nick Fury played Samuel L Jackson screen talking Tony Stark aka Iron Man Avengers Initiative suddenly overcome excitement began long descent comic book year later dad brought home 3 stack comic book standing around 1 foot tall 2 brother seemingly could care le given However quickly grabbed stack ran room laid across twin size bed nearly covering entire surface except sliver room pillow sit Immediately began organizing Marvel DC grouped series ordered chronologically next week practically drooled story remember comic odds end person gave dad comic like Thor Rocket Raccoon Silver Surfer Fantastic Four none Iron Man Batman Superman Wonder Woman Realizing didn’t comic iconic Heroes Heroines decided take internet found endless wiki page blog forum people talked comic would sit read much could Bringing u today 2018 time Superheroes specifically movie become mainstream hold incredible cultural significance America fact article Ringer label current teenager young adult “ Superhero Movie Generation” saying “Movies escape — better wing savior movie — episodic excursion larded humor tingling feeling interconnectivity — crucially prize one thing else return business return Young moviegoer keep showing find happens next defibrillator medium life support upon time one could credibly say movie they’re though provenance — imagination teenage boy — changed final product morphing every year” Ringer say perfectly generation affinity superhero film film general film genre take generation storm like superheroes MCU pivotal provider practical creator Superhero Movie Generation Heroic History Throughout nearly human history man created myth explain natural world natural order creating icon explain thing happen man shouldn’t certain thing Someone myth called “demigods” half god child man god One famous myth “demigod” Heracles often called Hercules Heracles possessed godly strength considered “Greek hero” Another example Greek hero concept hero Achilles namesake “Achilles Tendon” man dipped River Styx making invulnerable across entire body except behind ankle Upon research found ancient hero fact significant majority mainly hypermasculine men posse great power hand woman myth typically hyperfeminine overtly sexual emitting strong sexual prowess myth especially Greek Goddess Artemis nearly every mythological portrayal modest nonsexual basically goddess virginity girlhood Disney’s Hercules 1997 sort call “Demigod Dilemma” occurred ancient culture men dominated controlled story created told creating “Damsel Distress” character limit nearly every female character leaving character similar Medea Greek get back someone committing heinous crime mythic case Medea murdered child get get revenge exman Jason Taking Megara pictured GIF throughout movie acted accord independently Hercules Greek knight shining armor equivalent end movie Spoiler alert turn Meg working Hercules even though falling love end movie need hero term socalled “modern mythos” best example carry idea Greek hero today Superheroes see movie TV show comic book modern hero evolved beyond god man including alien mortal men mankind radiation mishap human genetic mutation hero spin ancient god goddess hero adore today often taken directly ancient myth least inspired heavily ancient myth Outside myth superheros known drawn scripted people around interview creator Superman specifically Jerry Spiegal jewish man said “What led creating Superman early thirty … Hearing reading oppression slaughter helpless oppressed Jews Nazi Germany … seeing movie depicting horror privation suffered downtrodden … great urge help… help downtrodden mass somehow could help could barely help Superman answer” creation Superman save jewish persecution genocide Europe Spiegal also said neighborhood also seen antisemantic movement Spiegel also said KalEl Superman’s birth name mean “voice God” Superheroes created people across history way almost “save themselves” form level hope especially modern comic book heroism Superheroes Batman v Superman Dawn Justice 2016 people word associate ‘Superheroes’ probably think thing Superman Batman Wonder Woman that’s However significant number hero nothing like big three mentioned prominently medium film “Guardians Galaxy” namesake MCU film series Guardians Galaxy nearly go every physical aspect make hero group made guy child abducted alien alien assassin raccoon wields dangerous weapon brutish alien take thing little literally tree sailor’s tongue Guardians Galaxy Vol 2 Source Fair use link None wear cape sort power except Groot he’s also tree think come game typical superhero monologue fueled justice helping innocent want stop crime fact Guardians completely benefit work similar mercenary hired hero come something major seem fight they’re cause revenge usually However series continues move forward ultimately hero work guarding galaxy right reason would label ragtag group plant animal people hero even though they’re mission time unclear hand American Comic Book culture adopted new type protagonist sometimes took appearance hero action questionable defined morally ambiguous often acting completely accord Cambridge Dictionary defines antihero “the central character playbook film traditionally heroic quality courage admired instead society generally considers weakness character” However Antihero existed outside comic without argument commonly whats called Antiwestern Movies subgenre western film cowboy term comic book however one famous Anti Heroes Deadpool Deadpool wear questionable tights mutant power typical superhero monologue movie adaption comic first movie leading Deadpool 2016’s Deadpool Wade Wilson Deadpool mercenary hire “take out” target price without discriminating good bad individual diagnosed cancer offered trial suspicious place completely cured cancer however left extremely fast healing looking like one character say movie “You look like avocado sex older disgusting avocado” Full Script Photo 20th Century Fox Film Corp Deadpool oddly antihero people people opinion cinematic entrance Deadpool 2016 gross slightly 363 million domestically 783 million worldwide Batman v Superman Dawn Justice 2016 mentioned earlier grossed 330 million domestic 873 million worldwide production budget movie respectively 50 million 250 million according Box Office Mojo attractiveness affinity towards antihero Deadpool American culture according Psychology Today due idea “Antiheroes liberate u reject societal constraint expectation imposed upon u Antiheroes give grievance voice make u feel like something right done even legally wrong Antiheroes thing we’re afraid want — without apology” antihero relief life highly stressful environment american society youth adult there’s question Deadpool 2016 extremely successful School college work pin America watch antihero screen feel relieved “liberated” also see portion vulnerability humility character Aside superhero look like many superheroes become household name become iconic part American culture looking Superman instance people recognize “S” chest star stripe Wonder Woman’s belt almost equally known However every superhero maintains cultural popularity cultural visibility significance superhero Take instance character like Eggy Kingsman Secret Service2014 Judge Dredd Dredd 2012 Babydoll Sucker Punch 2011 3 character lack part super power nearly cultural significance three however opinion superheroes Looking Eggy you’re average fella living shit situation end becoming mentee England’s best spy save world 2 separate occasion series Dredd Judge Dredd stop dangerous drug ring also take corrupt judge city making city safer Sucker Punch Babydoll basically imprisoned loony bin defending sister abusive stepfather end helping girl escape suffering fantasitcal delusion character different scale successfully saving life people fighting good cause different way none critically labeled superheroes brings believe make superhero especially hero screen effective superhero movie generation superhero opinion exists fictional world cause unjust good cause something offer everyone specifically meaning essentially hero need posse sort power need brutish extremely powerful don’t need sort costume getup make look like superhero need well known character household name Growth American Comic Book Culture Photo Source Superhero culture America different effect people nearly every walk life America become progressive term acceptance equality treatment minority image superheroes beginning popularized comic hero filled le fantastical imagery patriotic image Looking comic late 30 40 storyline reading often showed hero kicking Hitler’s as beating nazi even sometimes freeing nazi camp commonly comic would feature superheroes sporting red white blue talking “freeing millions” “it” couldn’t iconic storyline course Captain America believe described “From dark day world war explosive challenge today SuperSoldier Captain America stand ready shining sentinel liberty shield oppressed fight freedom everywhere” Creation Captain America promote american way inspire people contribute war Even ending WW2 villainous Red Skull still engaged Captain America comic link red scare time American agenda fight communism article CBR leading Comic Book news source called “Punch Nazi 15 Times Superheroes Fought Fascism” write Pete Imbesi recall 15 time superhero punched nazi highlight include Human Torch setting Hitler fire Raphael Teenage Mutant Ninja Turtles punching robot Hitler Wonder Woman mother kicking punching nazi even showing Joker claiming patriotism “American criminal” Red Skulls reply “How unfortunate misplaced patriotism” even one infamous comic book criminal felt patriotic enough fight nazi Image Source decade go comic book popularity flux however 50 Comics Code Authority began regulate comic book content public feared much gore began linking comic book juvenile delinquency CCA’s restriction made popularity comic drop rise underground comic book Underground comic published printed sold illegally paraphernalia “head shops” illegal industry began rise become successful mainstream popular comic 70 comic began get storyline risky superheroes take higher risk example SpiderMan comic Gwen Stacy SpiderMan’s girlfriend killed notable event comic Alongside risk taking superheroes comic creator writer began taking risk introducing black female superheroes began mainstaging story Towards end 80 comic book became legitimate field considered art gruesome bloody story brought back Comics began fluctuate frequently every 5 year turn century comic book basically stopped abiding CCA without consequence turn century became regular make remake superhero movie however landmark release Avengers 2012 domestic gross income 623 million worldwide 1518 billion according Box Office Mojo increase superhero movie production occurred last decade Marvel produced released nearly 20 interrelated film come 2019 MCU movie become highest grossing film series date 17 billion Marvel Studios’ release Avengers Infinity War practically broke box office reeling 2047 billion sequel’s set come April 26 2019 trailer came December 7th already 675 million view official Marvel Studios youtube channel excludes view seen social medium online news outlet online magazine possibly TV Marvel Studio’s Avengers End Game Trailer Fictional Superheroes Affect Real World Obviously Superheroes grasp saving fictional world real world effect hero expand way Instead superhero portrayal especially screen ambiguous effect American society would difficult prove show quantitatively fictional superheroes effect real life coincidence seem follow superhero movie article published Brewings author Nicol Turner Lee said “Black Panther” unequivocally become one many recent inflection point African American community especially following success extraordinary black voter turnout tough southern elections” Lee also said believed President Barack Obama wide release Black Panther2018 became hero black Americans specifically south comparing fictional hero Black Panther Image Source Obviously direct effect black community cannot limited sheer coincidence Looking Black Panther said inspiration black american T’challa face behind mask whole cast movie Black Panther predominantly featured black Americans Africans gave lot screen visibility POC America inspired audience across country cast even went premiere around world adorned traditional African garb also lead many black Americans attempting follow root get touch ancestry racial visibility one significant portrayal group would gender Superheroes long considered problematic portrayal woman comic movie mainly concerning way dressed However one looked aspect female hero personally find interesting significance female hero action personality TV movie comic scholarly journal article Sex Differences Creation Fictional Heroes Particular Emphasis Female Heroes Superheroes Popular Culture Insights Evolutionary Psychology Victoria Ingalls say female hero created woman “As almost hero hero use curiosity cleverness determination accomplish task without skill weapon give initial advantage around end femalegenerated hero simply try escape solve problem reveal truth sacrifice without physical fight” also say throughout research found female superheroes created woman posse higher intelligent le brute force male counterpart Unlike male superheroes often violent muscular posse power contain volatile force found female heroine power aren’t violent violent use like male hero also found female hero often think way debacle battle type visibility woman feed female stereotype also feed male stereotype Creating female heroine raise question “Well woman posse use great power strength male hero female superhero fight like man could” Although raise question like archetype female hero also portrays woman intelligent thoughtoriented time archetype fact portray female able kickass example video compilation clip American TV show Charmed show one 3 sister whose character trained handtohand melee weapon combat completely kicking as video show female hero often us intelligence fighting skill combination fight take opponent another academic study Influence Stereotyping Prejudices Perceptions Superheroes Emily Sanchez survey group people superheroes relation race gender side side Sanchez describes result “The result current study suggest preexisting superhero schema hero atypical alien skin tone may set aside exception evaluated le favorably Despite similarity human eg race gender superheroes may create distinct outgroup Additionally superheroes may still thesubject gender stereotype despite “super” quality Finally observed perception superheroes may impacted perceiver desire like superheroes ie wishful identification” Sanchez Ingalls found effect superheroes people subconscious based often desire heroic humility also found successful hero audience member individually find something hero relate whether it’s personality trait desire wish cause maybe love lifeTags Movies Superheroes Comics Marvel Culture

We Love to See It: 5 New Black Marvel Moments You Don’t Want to Miss

We Love to See It: 5 New Black Marvel Moments You Don’t Want to Miss Black Panther II poster, Marvel Studios For Disney’s Investor Day 2020, the media juggernaut threw out its biggest trump card in the never ending battle for best streaming platform, as Marvel Studios revealed enough details about upcoming projects to decidedly tip the scales in Disney+’s favor. The comic-based subsidiary has built an empire of movies and shows have consistently taken the film industry by storm and their latest rollout is no different, with one notable development: Marvel’s newest slate is very black, and we are here for it. Quietest kept, you should be too. Here are the top 5 things that have us praying theaters are open by 2021. 1. Marvel announces its first film to be directed by a black woman. Despite being a box office success, Captain Marvel drew harsh reviews from movie critics, garnering the reputation of being more of a supplemental film in preparation for Avengers: Endgame, than a stand-alone epic for Marvel’s namesake hero. Marvel may have heard the criticism and leveled up, giving fans a major reason to watch the sequel, when they announced via twitter that Nia Da Costa will be the first black woman to direct a Marvel film. The Candyman director and co-writer will take on Captain Marvel 2 slated to release in 2022, so hopefully the celebrated female-led series will have another added layer of Black girl magic. Disney + also announced that ____ actress Teyonah Parris will star as a grown-up superhero Monica Rambeau, Captain Marvel’s niece, in spinoff series Ms. Marvel, scheduled to arrive on the streaming platform in 2021. 2. LoveCraft Country actors are getting shown major love. The HBOMax horror drama series captivated a multicultural audience this summer, telling the story of Atticus Freeman journeying across the Jim Crow south in search of his missing father with his friend Letitia Lewis and Uncle George. Jonathan Majors, who plays Atticus Freeman, will take on the role of Kang the Conquerer, a time-traveling villain, in Antman and the Wasp: Quantamania, while costar Wunmi Mosaku, who plays Rubi Baptiste, (Letitia’s older sister) will reportedly be a series regular alongside Tom Hiddleston in Loki, the upcoming Marvel original based on the adventures of Thor’s baby brother. The series will be headed to Disney+ in May 2021. 3. Black Avengers are making their way to the main stage. Always an assistant, never an Avenger, characters like James Rhoades a.k.a. War Machine (Don Cheadle), Nick Fury (Samuel L. Jackson) and Sam Wilson a.k.a Falcon (Anthony Mackie) have always added levity and humor to the Avengers movies, helping to save the universe on multiple occasions but rarely get the spotlight. Marvel swivels the lamp with a few new original series featuring the characters, centering War Machine in Armor Wars, as James Rhoades jumps into action when keep Tony Stark’s tech falls into the wrong hands. Samuel L. Jackson takes center stage in Secret Invasion as Nick Fury, the mysterious and smart-mouthed director of S.H.I.E.L.D. while Captain America’s oldest and newest friend, Sam Wilson and James “Bucky” Buchanan link up in The Falcon and the Winter Soldier. It’s almost enough to make us forgive them for pulling an “Aunt Viv switch” with recasting Captain Rhoades character in Iron Man 2 (no shade, Terrence Howard.) 4. A new black super-shero: the arrival of the Ironheart series After the final scenes of Endgame, it seemed as if the likely choice to carry on Iron Man’s legacy in the modern film franchise would be the young Spider-man, but Marvel chose to stick to the script and expand the Iron Man family, returning to the comics in the new series Ironheart, casting Dominique Thorne (If Beale Street Could Talk) as young inventor Riri Williams creates “the most advanced suit of armor since Iron Man.” The best part? The young genius in a metal suit is a Black girl. Shoutout to Marvel for staying true to the comics and casting a young black actress for the role. The new original series will stream on Disney+. 5. We won’t have to go through the emotional trauma of adjusting to a new Black Panther. After the tragic death of legendary Black Panther actor Chadwick Boseman earlier this year, the speculation began almost immediately as to how the sequel would look; whether the role would be recast or rewritten. The first Black Panther film was a major milestone for Black people in cinema; the first blockbuster-budget movie to have a predominantly Black cast and be directed by Marvel’s first African-American director, the movie immediately captivated the hearts of Black comic fans worldwide, young and old alike. Boseman himself brought a special magic to the role that captivated us all from the first “Wakanda Forever” to well beyond the ending credits. With such large shoes to fill for such a beloved character, Marvel has opted not to recast Boseman’s character, and instead center the film around other members of the original cast, a tasteful tribute to the late actor, and our forever Black Panther.

https://medium.com/@arielfortheculture/we-love-to-see-it-5-new-black-marvel-moments-we-dont-want-to-miss-87d976f78bdc

[]

2020-12-11 20:55:18.655000+00:00

['Marvel', 'Film', 'Movies', 'Disney', 'Streaming']

Title Love See 5 New Black Marvel Moments Don’t Want MissContent Love See 5 New Black Marvel Moments Don’t Want Miss Black Panther II poster Marvel Studios Disney’s Investor Day 2020 medium juggernaut threw biggest trump card never ending battle best streaming platform Marvel Studios revealed enough detail upcoming project decidedly tip scale Disney’s favor comicbased subsidiary built empire movie show consistently taken film industry storm latest rollout different one notable development Marvel’s newest slate black Quietest kept top 5 thing u praying theater open 2021 1 Marvel announces first film directed black woman Despite box office success Captain Marvel drew harsh review movie critic garnering reputation supplemental film preparation Avengers Endgame standalone epic Marvel’s namesake hero Marvel may heard criticism leveled giving fan major reason watch sequel announced via twitter Nia Da Costa first black woman direct Marvel film Candyman director cowriter take Captain Marvel 2 slated release 2022 hopefully celebrated femaleled series another added layer Black girl magic Disney also announced actress Teyonah Parris star grownup superhero Monica Rambeau Captain Marvel’s niece spinoff series Ms Marvel scheduled arrive streaming platform 2021 2 LoveCraft Country actor getting shown major love HBOMax horror drama series captivated multicultural audience summer telling story Atticus Freeman journeying across Jim Crow south search missing father friend Letitia Lewis Uncle George Jonathan Majors play Atticus Freeman take role Kang Conquerer timetraveling villain Antman Wasp Quantamania costar Wunmi Mosaku play Rubi Baptiste Letitia’s older sister reportedly series regular alongside Tom Hiddleston Loki upcoming Marvel original based adventure Thor’s baby brother series headed Disney May 2021 3 Black Avengers making way main stage Always assistant never Avenger character like James Rhoades aka War Machine Cheadle Nick Fury Samuel L Jackson Sam Wilson aka Falcon Anthony Mackie always added levity humor Avengers movie helping save universe multiple occasion rarely get spotlight Marvel swivel lamp new original series featuring character centering War Machine Armor Wars James Rhoades jump action keep Tony Stark’s tech fall wrong hand Samuel L Jackson take center stage Secret Invasion Nick Fury mysterious smartmouthed director SHIELD Captain America’s oldest newest friend Sam Wilson James “Bucky” Buchanan link Falcon Winter Soldier It’s almost enough make u forgive pulling “Aunt Viv switch” recasting Captain Rhoades character Iron Man 2 shade Terrence Howard 4 new black supershero arrival Ironheart series final scene Endgame seemed likely choice carry Iron Man’s legacy modern film franchise would young Spiderman Marvel chose stick script expand Iron Man family returning comic new series Ironheart casting Dominique Thorne Beale Street Could Talk young inventor Riri Williams creates “the advanced suit armor since Iron Man” best part young genius metal suit Black girl Shoutout Marvel staying true comic casting young black actress role new original series stream Disney 5 won’t go emotional trauma adjusting new Black Panther tragic death legendary Black Panther actor Chadwick Boseman earlier year speculation began almost immediately sequel would look whether role would recast rewritten first Black Panther film major milestone Black people cinema first blockbusterbudget movie predominantly Black cast directed Marvel’s first AfricanAmerican director movie immediately captivated heart Black comic fan worldwide young old alike Boseman brought special magic role captivated u first “Wakanda Forever” well beyond ending credit large shoe fill beloved character Marvel opted recast Boseman’s character instead center film around member original cast tasteful tribute late actor forever Black PantherTags Marvel Film Movies Disney Streaming

Spider-Man: Into the Spider-Verse (2018)

Spider-Man: Into the Spider-Verse (2018) Miles Morales becomes the Spider-Man of his reality and crosses paths with his counterparts from other dimensions to stop a threat to all reality. David Bedwell Dec 19, 2018·6 min read Truth be told, I had little interest in seeing a Spider-Man animated movie. I’ve watched more episodes of Peter Parker in cartoon form than I care to remember and, while I’ve enjoyed them all, my heart lies with the live-action movies. Or so I thought. It’s easy to get caught up in the spectacle of Sony or Marvel’s big-screen efforts, especially when it came to welcoming everyone’s favourite web-slinger back into the fold with Captain America: Civil War (2016). For those in the know about the various rights issues between Sony and Marvel Studios, that film was a miracle many of us didn’t expect to ever see. If you’re put off Spider-Man: Into the Spider-Verse because you think animation is for kids, then drop that assumption. This movie is right up there with the best Spider-Man movies ever made. I don’t think I’ve ever been more impressed by one as much as this, remarkably. I thought they nailed the characters perfectly in Spider-Man: Homecoming (2017), but this animation is arguably the most definitive in terms of covering the wider picture and different versions. It can be difficult to comprehend all the various universes Marvel has created through the decades, but this tackles them seamlessly with all the humour and emotion we’ve come to expect. Despite Peter Parker being the focus of Spider-Man over the years, Into the Spider-Verse takes a new approach by thrusting Miles Morales (Shameik Moore) into the spotlight. As a young black man aspiring to be like his idol, suddenly he finds himself in the unlikely position of becoming exactly that. Morales feels like the right choice to lead this movie in 2018, but that goes way beyond just the colour of his skin. He has all the personality traits that fit a superhero and it’s not a jarring change for anyone more familiar with Peter. It helps that a version of his hero, Peter B. Parker (Jake Johnson), appears from another dimension to become his mentor, of sorts, despite having his own struggles that he needs to deal with. All great superheroes need a supervillain, of course, and it’s time once again to revisit Kingpin/Wilson Fisk (Liev Schreiber), who is today better known for his tangles with Daredevil but originally got his start in Spider-Man comic-books. Fisk is an imposing force driven by familial trauma, with a personal vendetta against Spidey because he believes he turned his wife and son against him. This led to a tragic car crash and Kingpin’s now determined to do anything to get his family back — including trying to pull across alternate versions of them from other dimensions. Unsurprisingly, this causes a chaotic mess for Miles and Peter to try and tidy up, and they make quite a duo… although it doesn’t stop there…

https://medium.com/framerated/spider-man-into-the-spider-verse-2018-51963a91cc75

['David Bedwell']

2019-01-15 19:02:00.350000+00:00

['Marvel', 'Review', 'Movies', 'Film', 'Culture']

Title SpiderMan SpiderVerse 2018Content SpiderMan SpiderVerse 2018 Miles Morales becomes SpiderMan reality cross path counterpart dimension stop threat reality David Bedwell Dec 19 2018·6 min read Truth told little interest seeing SpiderMan animated movie I’ve watched episode Peter Parker cartoon form care remember I’ve enjoyed heart lie liveaction movie thought It’s easy get caught spectacle Sony Marvel’s bigscreen effort especially came welcoming everyone’s favourite webslinger back fold Captain America Civil War 2016 know various right issue Sony Marvel Studios film miracle many u didn’t expect ever see you’re put SpiderMan SpiderVerse think animation kid drop assumption movie right best SpiderMan movie ever made don’t think I’ve ever impressed one much remarkably thought nailed character perfectly SpiderMan Homecoming 2017 animation arguably definitive term covering wider picture different version difficult comprehend various universe Marvel created decade tackle seamlessly humour emotion we’ve come expect Despite Peter Parker focus SpiderMan year SpiderVerse take new approach thrusting Miles Morales Shameik Moore spotlight young black man aspiring like idol suddenly find unlikely position becoming exactly Morales feel like right choice lead movie 2018 go way beyond colour skin personality trait fit superhero it’s jarring change anyone familiar Peter help version hero Peter B Parker Jake Johnson appears another dimension become mentor sort despite struggle need deal great superheroes need supervillain course it’s time revisit KingpinWilson Fisk Liev Schreiber today better known tangle Daredevil originally got start SpiderMan comicbooks Fisk imposing force driven familial trauma personal vendetta Spidey belief turned wife son led tragic car crash Kingpin’s determined anything get family back — including trying pull across alternate version dimension Unsurprisingly cause chaotic mess Miles Peter try tidy make quite duo… although doesn’t stop there…Tags Marvel Review Movies Film Culture

How does Andrew Garfield’s performances compare to Tobey Maguire’s as Spider-Man?

How does Andrew Garfield’s performances compare to Tobey Maguire’s as Spider-Man? Compared with the Amazing Spider-Man series, I prefer Tobey Maguire’s performance in Spider-Man series. There is an old saying in China for describing the gods that live in vain as immortal. It means that gods or super heroes are always much superior and powerful than human with more ability and character. They don’t have anything in common with ordinary people. But Tobey Maguire’s version of Spider-Man didn’t given a feeling like ‘live in vain as immortal’ as a superhero. He is a ordinary boy who experienced family affection, friendship and love. He had been kept growing up and gradually become mature when he experienced those happiness and painful experience. With great power comes with great responsibility. Uncle Ben told Peter Parker these words. These are also accompanied by us. And Peter Parker and his girlfriend’s classic inverted kiss in rain can’t be reproduced after a lot of movies. When he faced the temptation of black symbiosis which bring him much more power with evil, the choice of good and evil. He got the salvation after he chose the right side to be a better man. Just as the film ends: “Whatever comes our way, whatever battle we have raging inside us, we always have a choice…It’s the choices that make us who we are, and we can always choose to do what’s right.” I think only if the protagonist of a novel or film gives readers a sense of substitution will more readers resonate. Though the plot of Andrew Garfield’s version of Spider-Man is more close to original comics. But more audiences can find themselves’ shadows from Tobey Maguire’s version of Spider-Man. Or they can see the person they want to be. And remark of the classic will really draw more criticism. The remark version will be compared and picked fault with the original continuously. But those sharp criticism will make it better. As the audience we should also embrace the change. I feel sorry for the indefinite delay in the foreseeable future of The Amazing Spider-Man III. But I’m still looking forward to Tom Holland’s new version of Spider-Man which is more related to Marvel superhero series.

https://medium.com/@shmily/how-does-andrew-garfields-performances-compare-to-tobey-maguire-s-as-spider-man-a39c3332cda1

['Peter Chen']

2018-12-13 02:24:08.413000+00:00

['Marvel', 'Spider Man']

Title Andrew Garfield’s performance compare Tobey Maguire’s SpiderManContent Andrew Garfield’s performance compare Tobey Maguire’s SpiderMan Compared Amazing SpiderMan series prefer Tobey Maguire’s performance SpiderMan series old saying China describing god live vain immortal mean god super hero always much superior powerful human ability character don’t anything common ordinary people Tobey Maguire’s version SpiderMan didn’t given feeling like ‘live vain immortal’ superhero ordinary boy experienced family affection friendship love kept growing gradually become mature experienced happiness painful experience great power come great responsibility Uncle Ben told Peter Parker word also accompanied u Peter Parker girlfriend’s classic inverted kiss rain can’t reproduced lot movie faced temptation black symbiosis bring much power evil choice good evil got salvation chose right side better man film end “Whatever come way whatever battle raging inside u always choice…It’s choice make u always choose what’s right” think protagonist novel film give reader sense substitution reader resonate Though plot Andrew Garfield’s version SpiderMan close original comic audience find themselves’ shadow Tobey Maguire’s version SpiderMan see person want remark classic really draw criticism remark version compared picked fault original continuously sharp criticism make better audience also embrace change feel sorry indefinite delay foreseeable future Amazing SpiderMan III I’m still looking forward Tom Holland’s new version SpiderMan related Marvel superhero seriesTags Marvel Spider Man

Why Marvel Doesn’t Actually Have a Villain Problem

Why Marvel Doesn’t Actually Have a Villain Problem A good villain doesn’t have to be a well-rounded character. When Marvel Studios released Black Panther earlier this year, it was widely acclaimed for good reason. The film is a milestone for representation in the largely white-men-centric superhero genre. However, it was also praised for another reason. Marvel had “fixed their villain problem” with Michael B. Jordan’s Erik Killmonger. Don’t get me wrong, Killmonger is a great character, and a great villain; there’s no doubt about that. The audience can empathize with him while still recognizing that his actions are morally repugnant. Jordan’s performance is incredible, one of his best. He is one of the better MCU villains. Killmonger challenges Chadwick Boseman’s T’Challa’s views, and invokes real growth in him, the trademark of a great villain. That being said, I take issue with the viewpoint that villains can only be good if they are good characters. The Marvel Cinematic Universe doesn’t (and never had) a villain problem. A good villain or antagonist only has to spark a change in the protagonist. They themselves do not have to be a good character. Take a look at the 1977 film Star Wars. Darth Vader is considered one of the greatest villains of all time, and is he a very fleshed out character? No. He’s evil for the sake of evil, but he makes for a menacing obstacle for our heroes to overcome. He incites change in Luke, the hero of the story. It doesn’t matter that we don’t know his backstory or his motivations. In fact, when he was given a backstory years later in George Lucas’s prequel trilogy, his villainy was greatly diminished. He was reduced to a whiny, entitled young man. The excessive explanation of character’s backstories and motivations is an issue that has plagued the Star Wars Universe since. Marvel, however, does not have this issue. Just so it’s clear, Marvel does have a few villains that don’t do their respective film justice. Look no further back than this year’s Ant-Man and the Wasp. Ava Starr, a.k.a. Ghost, is a wonderful character brought to life by Hannah John-Kamen. Her quest to cure her life-threatening disease is easily able to be sympathized with, and the audience truly feels her pain. Unfortunately, she doesn’t do much besides mildly inconvenience our heroic duo, and no changes are made to their views or character due to her presence. In this case, the villain is weak, but the character is strong. Because of the weak villain, the stakes in Ant-Man and the Wasp seem extremely low, which doesn’t necessarily make it a bad film, just a lightweight one. Marvel’s biggest villain misstep is undoubtedly in Thor: The Dark World with Malekith the Accursed. Malekith is not only a poor character, but a poor villain as well. He is evil just because, and doesn’t evoke any meaningful growth in Chris Hemsworth’s Thor. He isn’t particularly menacing or memorable. From the start of the movie, you know he is just an object for Thor to punch. Thor, of course, actually ends up dropping a spaceship on him, but that’s beside the point. Due to its poorly conceived antagonist (and a few other problems), Thor: The Dark World suffers, arguably being the worst installment in the Marvel Cinematic Universe. My examples of any “villain problem” end there, though. Perhaps the film that best illustrates my point is Iron Man, the film that kickstarted the Marvel Cinematic Universe and originated its “villain problem.” At the beginning of the film, Tony Stark is an arrogant billionaire who could care less where his money comes from. By the end of the film, Tony Stark is an arrogant billionaire who decides to be more responsible with his company. This is largely because of Obediah Stane, a.k.a. Iron Monger. Yes, he is basically just an evil Iron Man, but his actions show Tony Stark the error of his ways. Stane is a typical villain, a greedy business man who just wants more money, but in this particular story, he serves his purpose well. He is a perfect foil to Tony Stark, and Marvel has been following this template since. One of the more baffling villains accused of being disposable is Cate Blanchett’s Hela from Thor: Ragnarok. There’s nothing disposable about the Goddess of Death, who poses a severe threat to Asgard and its people. She brings the truth of Odin’s rule to light, making Thor reassess who he is and where he comes from. In the end, he accepts that he is to be king of his people. She also pushes him physically to the brink, to the point that Thor must destroy Asgard and set Surtur upon her in order to defeat her. As if that’s not enough, Blanchett chews the scenery in a delightful way in her Hot Topic bodysuit and smudged eyeshadow. Taika Waititi’s film is zany exuberance from start to finish, and Hela is a huge part of the fun. She is anything but disposable. Does Marvel Studios tend to give their villains the same powersets as their respective heroes? For sure. In most cases though, this makes for a compelling character foil. Each film, with very few exceptions, takes the hero on a journey in which their views and morals change, largely due to the villain. Take the villain out of the story of any MCU film (save the exceptions listed earlier), and the hero’s journey is diminished significantly. You could accuse Marvel of sticking to a formula, and that would be a well-founded accusation. They certainly do. However, they have yet to make a movie with that green splat on Rotten Tomatoes. Their films are guaranteed to be box office successes; sometimes they are even record breakers. They are still considered the gold standard in modern superhero cinema. With growing diversity both behind and in front of the camera, future installments look to be just as successful. They have changed the face of cinema, creating a series of films that play like episodes in a television season, and people are consistently lining up for the next installment. Let’s face it, Marvel doesn’t have a villain problem. Marvel doesn’t have any problem at all.

https://medium.com/@thesamlenz/why-marvel-doesnt-actually-have-a-villain-problem-4c4f5db948ab

['Sam Lenz']

2019-01-06 05:00:12.160000+00:00

['Movies', 'Film', 'Marvel', 'Marvel Cinematic Universe', 'Black Panther']

Title Marvel Doesn’t Actually Villain ProblemContent Marvel Doesn’t Actually Villain Problem good villain doesn’t wellrounded character Marvel Studios released Black Panther earlier year widely acclaimed good reason film milestone representation largely whitemencentric superhero genre However also praised another reason Marvel “fixed villain problem” Michael B Jordan’s Erik Killmonger Don’t get wrong Killmonger great character great villain there’s doubt audience empathize still recognizing action morally repugnant Jordan’s performance incredible one best one better MCU villain Killmonger challenge Chadwick Boseman’s T’Challa’s view invokes real growth trademark great villain said take issue viewpoint villain good good character Marvel Cinematic Universe doesn’t never villain problem good villain antagonist spark change protagonist good character Take look 1977 film Star Wars Darth Vader considered one greatest villain time fleshed character He’s evil sake evil make menacing obstacle hero overcome incites change Luke hero story doesn’t matter don’t know backstory motivation fact given backstory year later George Lucas’s prequel trilogy villainy greatly diminished reduced whiny entitled young man excessive explanation character’s backstories motivation issue plagued Star Wars Universe since Marvel however issue it’s clear Marvel villain don’t respective film justice Look back year’s AntMan Wasp Ava Starr aka Ghost wonderful character brought life Hannah JohnKamen quest cure lifethreatening disease easily able sympathized audience truly feel pain Unfortunately doesn’t much besides mildly inconvenience heroic duo change made view character due presence case villain weak character strong weak villain stake AntMan Wasp seem extremely low doesn’t necessarily make bad film lightweight one Marvel’s biggest villain misstep undoubtedly Thor Dark World Malekith Accursed Malekith poor character poor villain well evil doesn’t evoke meaningful growth Chris Hemsworth’s Thor isn’t particularly menacing memorable start movie know object Thor punch Thor course actually end dropping spaceship that’s beside point Due poorly conceived antagonist problem Thor Dark World suffers arguably worst installment Marvel Cinematic Universe example “villain problem” end though Perhaps film best illustrates point Iron Man film kickstarted Marvel Cinematic Universe originated “villain problem” beginning film Tony Stark arrogant billionaire could care le money come end film Tony Stark arrogant billionaire decides responsible company largely Obediah Stane aka Iron Monger Yes basically evil Iron Man action show Tony Stark error way Stane typical villain greedy business man want money particular story serf purpose well perfect foil Tony Stark Marvel following template since One baffling villain accused disposable Cate Blanchett’s Hela Thor Ragnarok There’s nothing disposable Goddess Death pose severe threat Asgard people brings truth Odin’s rule light making Thor reassess come end accepts king people also push physically brink point Thor must destroy Asgard set Surtur upon order defeat that’s enough Blanchett chew scenery delightful way Hot Topic bodysuit smudged eyeshadow Taika Waititi’s film zany exuberance start finish Hela huge part fun anything disposable Marvel Studios tend give villain powersets respective hero sure case though make compelling character foil film exception take hero journey view moral change largely due villain Take villain story MCU film save exception listed earlier hero’s journey diminished significantly could accuse Marvel sticking formula would wellfounded accusation certainly However yet make movie green splat Rotten Tomatoes film guaranteed box office success sometimes even record breaker still considered gold standard modern superhero cinema growing diversity behind front camera future installment look successful changed face cinema creating series film play like episode television season people consistently lining next installment Let’s face Marvel doesn’t villain problem Marvel doesn’t problem allTags Movies Film Marvel Marvel Cinematic Universe Black Panther

Spiderman: Miles Morales is the centerpiece of the PlayStation 5’s launch lineup.

Spiderman: Miles Morales Review Spiderman: Miles Morales is the centerpiece of the PlayStation 5’s launch lineup. After the 2018 smash hit Marvel’s Spiderman, which has since become Sony’s best selling exclusive EVER, fans are eager to get their hands on this sequel from Insomniac Games. Replacing Peter Parker is the young Miles Morales, who we saw develop powers at the end of 2018’s Spiderman. Miles is left in charge of keeping New York safe after Peter takes a well deserved holiday with MJ. It’s a big ask of Miles, who is still understanding his new powers. The game follows his story, as Miles overcomes his self doubt, as he aims to come from behind the shadow of the ‘real’ Spider-Man. It’s a raw experience this time around. Still coming to terms with the death of his father, plus the very difficult task of being New York’s sole protector helps mould Miles into a character you cannot help but love. The game is an all round refinement of the previous instalment into the series. The visuals are smooth, the combat is more fluid. Without giving too much away, Miles manages to stand out from Peter thanks to his unique abilities in combat. It’s an important difference too, the two Spider-Men feel completely different. That’s not to say Miles is a one trick pony, far from the case. Players are free to tackle most scenarios as they please, but it’s clear that Miles’ abilities suit the Sam Fisher style. For the sake of difference, it’s a good job the two Spideys feel different. New York is, well, it’s still New York. Not much changes and that is reflected in the game. Players will find the map to be similar to the previous game, only this time with a special seasoning known as Christmas. A lack of change is to be expected. There’s only so much you can do with New York over a short period of time. With that being said, New York doesn’t look like a city that has recently overcome the Devil’s Breath from the first game. Given the current global situation, it’s fair that it doesn’t play a massive role, but it’s almost like it never happened at all. In fact it’s a big downer throughout Spider-Man: Miles Morales — a lack of consequence for what occurred during the original game. Although we see Miles coming to terms with the death of his father throughout, everything else has been tucked away. Either completely, or waiting for Peter to come back before rearing its ugly head. The terrorist attack, Martin Li and his other villainous friends are rarely mentioned, if at all. For me, it seems silly to use an identical game world, yet toss aside a lot of the world building that had previously taken place. It’s a short game too. The game’s story clocking in at around five hours for myself. It’s disappointing, considering Sony’s new price point for it’s games. Spider-Man: Miles Morales is the same price as the first Spider-Man game, but doesn’t even clock half the length of the original story. It does a lot with the time it has though, introducing and expanding on new character quickly. Despite them all being shunted by a lack of hours, they all shine, making a lasting impression on players up until the game’s heart wrenching ending. The visuals of Spiderman: Miles Morales are absolutely breathtaking. Ray-tracing comes into effect and looks stunning across the New York skyline. Visually, it’s one of the biggest differences between the two games displayed. Admittedly I didn’t envision ray-tracing having too much of an effect, especially this early into the generation, but the dip in visual quality was noticeable once the performance mode was turned on. Spider-Man: Miles Morales is a gorgeous game, even when you’re going at full speed. Spider-Man: Miles Morales is another great showing for Insomniac Games. Improvements are made all around in terms of gameplay, visuals and writing. Despite bringing a whole castful of new characters, the player warms to them quickly over the five hours they get together. New York remains New York, despite a coating of Christmas, but it does look wonderful on the newest Sony hardware (and covering stuff in snow always helps). An overall wonderful experience leaves us eager once again for the next Spidey showing. 8/10

https://medium.com/@austin-russ88/spiderman-miles-morales-is-the-centerpiece-of-the-playstation-5s-launch-lineup-9de83a7ec49b

['Austin Russell']

2020-11-28 20:44:39.828000+00:00

['Video Games Industry', 'Spider Man', 'Ps5', 'Marvel']

Title Spiderman Miles Morales centerpiece PlayStation 5’s launch lineupContent Spiderman Miles Morales Review Spiderman Miles Morales centerpiece PlayStation 5’s launch lineup 2018 smash hit Marvel’s Spiderman since become Sony’s best selling exclusive EVER fan eager get hand sequel Insomniac Games Replacing Peter Parker young Miles Morales saw develop power end 2018’s Spiderman Miles left charge keeping New York safe Peter take well deserved holiday MJ It’s big ask Miles still understanding new power game follows story Miles overcomes self doubt aim come behind shadow ‘real’ SpiderMan It’s raw experience time around Still coming term death father plus difficult task New York’s sole protector help mould Miles character cannot help love game round refinement previous instalment series visuals smooth combat fluid Without giving much away Miles manages stand Peter thanks unique ability combat It’s important difference two SpiderMen feel completely different That’s say Miles one trick pony far case Players free tackle scenario please it’s clear Miles’ ability suit Sam Fisher style sake difference it’s good job two Spideys feel different New York well it’s still New York much change reflected game Players find map similar previous game time special seasoning known Christmas lack change expected There’s much New York short period time said New York doesn’t look like city recently overcome Devil’s Breath first game Given current global situation it’s fair doesn’t play massive role it’s almost like never happened fact it’s big downer throughout SpiderMan Miles Morales — lack consequence occurred original game Although see Miles coming term death father throughout everything else tucked away Either completely waiting Peter come back rearing ugly head terrorist attack Martin Li villainous friend rarely mentioned seems silly use identical game world yet toss aside lot world building previously taken place It’s short game game’s story clocking around five hour It’s disappointing considering Sony’s new price point it’s game SpiderMan Miles Morales price first SpiderMan game doesn’t even clock half length original story lot time though introducing expanding new character quickly Despite shunted lack hour shine making lasting impression player game’s heart wrenching ending visuals Spiderman Miles Morales absolutely breathtaking Raytracing come effect look stunning across New York skyline Visually it’s one biggest difference two game displayed Admittedly didn’t envision raytracing much effect especially early generation dip visual quality noticeable performance mode turned SpiderMan Miles Morales gorgeous game even you’re going full speed SpiderMan Miles Morales another great showing Insomniac Games Improvements made around term gameplay visuals writing Despite bringing whole castful new character player warms quickly five hour get together New York remains New York despite coating Christmas look wonderful newest Sony hardware covering stuff snow always help overall wonderful experience leaf u eager next Spidey showing 810Tags Video Games Industry Spider Man Ps5 Marvel

Warpcore comic pull list 5.0

New comics, new heroes, new villains. There’s a whole lot happening in comics. Here’s four that you should definitely be checking out. Welcome to the December edition of the warpcore Pull List. King in black #1 Marvel Comics Straight from the pages of Venom comes King In Black. Knull, the god of symbiotes has arrived on Earth with his army. Get ready for a new villain the like of which the Marvel Universe has never dealt with before. Mighty Morphin #2 Boom! Studios A new series from the world of Mighty Morphin Power Rangers. Following Shattered Grid, the Ultimate Power Era continues as a new Green Ranger appears. As betrayal hits the rangers, Lord Zedd launches his newest attack. New rangers, new villains, and a new Lord Zedd, are set to make things very unsettling for the heroes. The Other History of the DC Universe #1 DC Comics Academy Award winning screenwriter John Ridley takes the reigns in exploring the mythology of DC comics. This unique new series sees the story expressed as prose with marvelous illustrations by Giuseppe Camuncoli. This issue follows Jefferson Pierce from young track star, to teacher, to the hero known as Black Lightning. Get set to see a side of DC you haven’t seen before. Hellboy and the B.P.R.D.: The Seven Wives Club #1 Dark Horse Comics Mike Mignola and Adam Hughes return with an all new Hellboy adventure. Our hero comes to the aid of a young girl whose ghost hunt has gone terribly wrong, and a visit to a medical school reveal ominous secrets to an age old murder. Stolen cadavers, vengeful spirits, and Hellboy bang in the middle of the action. Words: Shloke Sarkar

https://medium.com/@warpcore/warpcore-comic-pull-list-5-0-6b35a4f3a585

[]

2020-12-11 07:58:18.888000+00:00

['Comics', 'Marvel', 'Dc']

Title Warpcore comic pull list 50Content New comic new hero new villain There’s whole lot happening comic Here’s four definitely checking Welcome December edition warpcore Pull List King black 1 Marvel Comics Straight page Venom come King Black Knull god symbiotes arrived Earth army Get ready new villain like Marvel Universe never dealt Mighty Morphin 2 Boom Studios new series world Mighty Morphin Power Rangers Following Shattered Grid Ultimate Power Era continues new Green Ranger appears betrayal hit ranger Lord Zedd launch newest attack New ranger new villain new Lord Zedd set make thing unsettling hero History DC Universe 1 DC Comics Academy Award winning screenwriter John Ridley take reign exploring mythology DC comic unique new series see story expressed prose marvelous illustration Giuseppe Camuncoli issue follows Jefferson Pierce young track star teacher hero known Black Lightning Get set see side DC haven’t seen Hellboy BPRD Seven Wives Club 1 Dark Horse Comics Mike Mignola Adam Hughes return new Hellboy adventure hero come aid young girl whose ghost hunt gone terribly wrong visit medical school reveal ominous secret age old murder Stolen cadaver vengeful spirit Hellboy bang middle action Words Shloke SarkarTags Comics Marvel Dc

Fear of the Shapeshifter

Fear of the Shapeshifter We, as a species, are pretty obsessed with form. Appearance is everything to us. We judge people based on uniforms more than actions. We judge animals based on how vaguely their proportions mirror that of our own offspring rather than their ecological role. We are so convinced we can accurately divine an objective reality based on imagined platonic forms that we end up becoming cartoonish. Maybe it is this obsession with these worlds of ideal forms that has led to such consistent themes in how we utilize shapeshifters in fiction. Fictional cultures and civilizations of shapeshifters are, almost exclusively, villains. In tabletop games dopplegangers, changelings, skulks and their ilk are uniformly described as sociopathic parasites, incapable of creating their own culture or art and instead using their abilities to usurp the positions of the humans (or elves or whatever) that were truly capable of creation and innovation. They steal identities, rather than create their own. The best role these fantasy races could hope for in the official narratives is that of a craven trickster, amoral but not overtly evil by birth. The idea presented here is that if people were free to take any form they wanted, they would be either unwilling or unable to stop. If you could be anyone as needed, why would you ever be anything for longer than it remained the most useful? Why would you slow down and make one form your own if you could just instantly be one more useful? Not putting the time into improving and changing one form, the argument goes, would translate into not putting the time into improving and developing an individual identity. Dopplegangers of D&D steal identities because their powers prevent them from developing a proper identity, and then the creativity to develop their own new forms. Its a pretty dim view of the fantasy of shapeshifting. There have also been heroic shapeshifters in myth, folklore and pop culture as well, but those of modern culture all tend to be easy to identify even as they change forms. Stretchy super heroes Mr Fantastic, Ms Marvel and Elongated Man can change their body to any shape but it’s always still their body. Plastic Man has a wider range of forms, able to disguise himself as nearly anything, but still is always locked to the same color scheme and rad shades. He may be an end table, but his tell-tale color scheme means he’ll never be mistaken by the audience for an end table that isn’t him. There are exceptions, but they tend to be much more obscure (is anyone outside of a narrow slice of an already narrow slice of comics fandom going to recognize Chameleon Boy the way they might Ms Marvel or Plastic Man?). The one big name, the Martian Manhunter, is unique enough that he merits his own explanation later. As a rule, heroic shapeshifters change their forms, but not their identity. That is what separates the heroic, individual figure and the formless, identity-free masses. Identity is hardly a static concept, but the idea that it is a single, unchanging form is pretty deeply ingrained in modern culture. Western civilization is not fond of those who don’t . Its even harder on those able or willing to shift between identities, or even just what western civilization has decided “should” be an identity. This is reflected in pop-culture, where cultures of shapeshifting villains are a mainstay of science fiction including the Marvel Skrulls and Star Trek’s Dominion Founders. Both of these space empires posit a formless existence as being the root cause of each culture’s descent into fascism and paranoia. For the most part, the Skrulls serve primarily as faceless masses of aliens for the Marvel heroes to fight. Sometimes they are vaguely racist caricatures of whatever culture the average American citizen is expected to dislike at the moment. Sometimes they are not-so vaguely caricatures along those lines. Sometimes they’re just a convenient way to show super heroes murdering someone while still saying “see, they’re not human so our heroes aren’t, y’know, murderers for real!” We haven’t seen many specifics of Skrulls history or culture in the comics, and what we have seen tends to be from isolated writers not working together along any single storyline or plan. Yet it is from these isolated stories that interesting themes have emerged about why the Skrulls are who they are. The Skrulls have the potential to take any form, and yet in their “natural” state they are all identical. Skrulls all wear the same uniform, all have the same basic anatomy, and even tend to have the same (aggressively sociopathic) personalities. Skrulls are also essentially parthenogenic. They have no “natural” gender or sexes, as any Skrull can become “biologically” male or female at will, complete with working reproductive organs. In addition they have been shown able to become any other possible sex present in any other species, complete with functional reproductive organs. Yet despite this, Skrull culture recognizes a very rigid cultural gender binary and is incredibly misogynist. Aside from a few notable Skrull queens, the glimpses of Skrull society we have seen have shown that women are second class citizens at best, barred from most positions of authority and constantly talked down to by aggressive male war leaders. Skrull women are expected to present themselves as possessing large mammalian breasts, despite being reptiles who cannot produce milk, solely for the purposes of differentiating them and of titillating the male skrull population. This weird dichotomy between a biology that explicitly rejects the gender binary and a society obsessed with it is rarely made part of the Skrulls’ appearance in the comics, but has provided several interesting Skrull “facts” in the background of two specific comics: Runaways and The Incredible Hercules. Runaways (created by Brian K Vaughn and Adrian Alphona) is the story of a group of kids who, upon discovering that their parents are really a gang of horrible cross-genre super villains, run away in hopes of finding their own non-evil path. While their parents are quickly removed from the board, the legacy of their villainous ancestry continues to hang over them. One of the Runaways, a girl named Karolina Dean who discovers she is actually a rainbow-colored alien, ends up having to deal with her parents’ legacy of war and betrayal in a shocking way. A skrull named Xavin arrives claiming to be her fiance, and that their union is the only thing politically that can end a war her parents engineered that is destined to destroy two worlds. While at first she agrees only to halt the destruction of two people, Karolina and Xavin eventually grow to genuinely care for each other and remain involved even after the arranged marriage becomes unnecessary. Karolina is a lesbian, and Xavin originally presents as male. Despite Xavin’s insistence that skrulls can “change gender” at will, it still uncomfortably seems like a story of a male character tricking a gay woman into a romantic relationship. As we learn more about Xavin, this problem does get dealt with. Xavin was raised in the most mysoginist part of Skrull society, and learned to present as whatever would get them less abuse. In Skrull society this means male, and among the mostly-girl team of the Runaways looking out for their teammate and not trusting a space-bro this means presenting as female. As Xavin learns that on Earth they can present as whatever they want, they admit that they do not actually see themselves as either male or female as either humans or skrulls define it. It is not actually the story of a deviant shapeshifter using their power to trick women, but the story of a character learning to come out as non-binary due to love and friendship. But while Xavin’s story shows us insight into an individual Skrull, it still doesn’t answer the question of why Skrull civilization is so fascistically uniform despite the potential of its power. For that, we have to look at the second comic I mentioned, The Incredible Hercules (by Greg Pak and Fred Van Lente) and its tie-in to the 2008 “major event” Secret Invasion. Secret Invasion was, overall, a pretty dumb crossover event that mostly existed to do a comic about superheroes murdering vaguely Muslim foreigners without getting in trouble. So now the Skrulls were all religious fanatics for the first time in comic history, and in the main series this religion was as thinly-veiled a reference to how the average American viewed Islam as could be. The one actually good comic to come out of the boring alien splat-fest was the Hercules tie-in, where the various gods of Earth put together a squad of divine superheroes to fight the Skrull gods. Ironically, the one comic that actually dealt with the Skrull religion was the one to NOT stick to the lazy stereotypes of Islam. Instead, it created a new mythology that finally sought to explain the dichotomy of the Skrulls. When ancient Skrulls purged the non-shapeshifting members of their species, the last “Skrull Eternal” argued he must be left alive to serve as the template for all skrulldom. Without him, he argued, they would have no form to return to and be left without identity. The “default” Skrull form we see in all Marvel comics is an attempt to emulate this iconic Skrull eternal. His followers argue that through their devotion to him, they remain Skrull even when they take on the myriad other forms of the universe. Through their adoption of his presented gender, they remain male even when they take on the myriad other sexes of the universe. Ironically, Skrull fascism is based on the same obsession of idealizing form that makes Skrull shapeshfiting and rejection of form so terrifying to Earth culture. Interestingly, the Skrulls debuted around the same time as another Marvel alien, the Kree, and the two became mortal enemies. The famous Kree-Skrull War storyline of the Avengers (1971–72 by Roy Thomas, Sal Buscema, Neal Adams, and John Buscema) told the story of the two space empires, locked in an interstellar cold war, who were more than happy to use our planet as a tool for proxy battles. The most advanced species in the galaxy were essentially barbaric, un-knowable, nationalist despots who cared not a whit if we lived or died other than as a tool for the embarrassment of their political enemies. Its a great old comic that brilliantly satirized the Cold War-era “nation building” our own country took part in. Both the Kree and Skrull were acting like Americans and Russians, though neither species could be pointed to as “oh THESE are us, the others our enemies.” The Kree were introduced as just as evil as the Skrulls, and arguably their history in the Marvel universe has been even more damaging to Earth. The Kree are genocidal, ultra-conservative space-racists who have repeatedly tried to wipe out our species to cover up their genetic tests on our ancestors. But while the Skrull remain perennial Avengers punching bags, the Kree became all but celebrated allies. The only difference between the two is that while the Skrull are deviant shapeshifters, the Kree are essentially humans, only sometimes they are blue. Marvel’s humanity would rather ally with a species that gloriously revels in fascism, so long that they appear attractive and consistent in form. The Founders of Star Trek: Deep Space 9 are also ironically obsessed with form for a species without any of their own. The natural state of these beings is an orange goo that naturally takes the form of whatever it is in and effortlessly blends with any others it comes in contact with. The Founders only have identities when they are away from the “Great Link” they all congeal in. The Founders are also head of a far-reaching fascist empire, and see beings of other species, the “solids”, as barely sapient and unworthy of consideration other than how they can potentially harm real, amorphous people. The reason for this is once again tied to their shapeshifting’s effect on their culture and psychology. In the Founder philosophy, to take on a subject’s form is to truly know it. You take the form of a square, you ARE the square and you understand its square-ness in a way no being of another form could. To the Founders, humanity (and Klingons, Bajorans, Cardassians, etc) is no different than any other shape. There is nothing to know about other beings than their shape, and it is inconceivable to the Founders that anything could exist in one of the solids other than what their physical form reveals. Despite being a species without form, they have become sociopaths unable to see the world through any other lens. Like the Skrulls, it is only by teaching one of their outcasts, Constable Odo, that they can learn how our culture can liberate them from their myopic view and allow them to become individuals. Also like the Skrulls, their battle with Earth takes the form of sabotage and infiltration and leads to mass panic and paranoia. While they are often used as a science-fictiony way of talking about cultural witch hunts, the truth is that races of identical shapeshifters do not tend to make very effective ones when we look at them too deeply. Sure, it is shocking that Star Fleet so quickly begins tossing aside its hard-won utopian ethics and establishes martial law to combat the threat of shapeshifters infiltrating Earth, but… There really WERE shapeshifters infiltrating Earth in that story. Witchhunts from Salem to McCarthyism are terrifying because there is NO real enemy to hunt. As soon as you introduce actual evil shapeshifters into the mix, especially genocidal fanatic ones, you create an actual justification for the witchhunt. It might be more “morally ambiguous” to give space McCarthy an actual space communist threat to fight, but real witchhunts aren’t ambiguous. McCarthy was wrong, and he destroyed lives. None of the women in Salem were brides of Satan, they were simply murdered. The moments where both the Kree-Skrull War and the Dominion War are most effective is when they focus on the sinister shapeshifters not using their power to actually infiltrate and debase society, but instead provoke the already paranoid, racist, murderous humans into doing the job for them. The only big-name shapeshifting people that stray from the “lack of true form leads to sociopathy” template are DC’s martians. Usually, J’onn J’onzz the Martian Manhunter is the only surviving member of his species, but even when he’s not we rarely see any glimpses of his society. Whenever we see flashbacks to J’onn’s family and the destruction of his people, it always presents the same picture. Martians are all naked, identical and live in unremarkable, unadorned simple dwellings with no obvious art or aesthetics of any kind. They are pacifists who invariably get wiped out, either by natural disaster or alien invasion or their own evil twins depending on the story. J’onn always looks like every other identical martian until he comes to Earth and has to define a new form for himself. Is the best a “good” shapeshifting people can hope for a doomed life without individuality, art or even personality? Is J’onn allowed to be a hero without form because he’s so aggressively non-threatening and the last of his people? The martians are not simply shapeshifters, but are also telepathic and have every power Superman possesses minus the heat vision. The reason they all walk around naked and identical is because they give no thought whatsoever to physical form. Like the villainous species described above, they simply adapt whatever streamlined form is best for the moment, and so most of the time on boring, empty Mars they all have the same form. Their skin is tough enough to not worry about sandstorms and they cam fly without wings, so a bland biped shape is fine. At the same time, they all possess incredible, worldwide telepathy, and so all their individual expression is mental. We create art of all kinds to try and convey ideas or feelings that are otherwise impossible yo express, but martians can’t even conceive of that problem. Why bother expressing yourself through physical fashion, art or speech when you can be understood so much easier and more intimately through telepathy? At the same time, the fact that everyone’s minds are open means its impossible to lie to anyone. The concept of deception and private thoughts are as alien to them as pants. Not that there would even be reason to lie, as you feel what everyone else is feeling and wouldn’t want to feel any hurt you caused by your deception. Nor would you worry about what other people think, because it would always be open to you. Shame as we know it doesn’t exist on Mars. It couldn’t if society could even exist in that telepathic environment. Its easy to then write the last martian in Earth as a calm, paternal figure. One who sees our fear of our own weakness even as they see the strength we won’t acknowledge. Often J’onn ends up the bland “dad” of the Justice League, and this may be why J’onn is so often an important supporting character in team books, but has struggled to carry his own title. Its harder, but potentially more rewarding, to write the culture shock. The most interesting J’onn stories focus on just how frustrating the adjustment is. He can’t understand why we lie all the time. Even the little lies we tell each other that he can’t help but overhear drive him nuts and make us look immoral and petty. He could communicate with any martian more easily than he can with the people on Earth he’s grown closest too. In that interpretation he appears stoic not because he’s a wise, zen sage but because he is still learning how to communicate physically and verbally with people who are put off by “invasive” contact between open minds. This dichotomy helps other martian characters than just J’onn, fleshing them out as interesting, unique characters in their own right rather than just a tragic backstory. One of the ongoing themes in DC martian stories is that martians LOVE trash Earth TV. Why? Because its impossible to read the mind of a recorded image, and the irrational and goofy behavior of badly written characters is pretty much the only art form that can surprise a martian. Teenage Miss Martian flees to Earth because its the only place she can lie about herself, but the allure of human deception is as dangerous and leading to sociopathic behavior in as humans imagine shapeshifting to be. Like the other sci-fi shapeshifters, they’re in a culture where they’re able to express themselves through form in a way he never could before, but unlike the others it isn’t a liberating experience. The awkwardness of a form-based identity for a being who intimately knows how that mindset is contrary to peoples’ true thoughts allows martians a chance to fear and distrust humans just as those humans project the normal shapeshifter fears onto them.

https://medium.com/videogames-of-the-oppressed/fear-of-the-shapeshifter-56740b52ab2c

[]

2016-10-27 19:39:44.002000+00:00

['Comics', 'Star Trek', 'DC Comics', 'Marvel', 'Science Fiction']

Title Fear ShapeshifterContent Fear Shapeshifter specie pretty obsessed form Appearance everything u judge people based uniform action judge animal based vaguely proportion mirror offspring rather ecological role convinced accurately divine objective reality based imagined platonic form end becoming cartoonish Maybe obsession world ideal form led consistent theme utilize shapeshifters fiction Fictional culture civilization shapeshifters almost exclusively villain tabletop game dopplegangers changeling skulks ilk uniformly described sociopathic parasite incapable creating culture art instead using ability usurp position human elf whatever truly capable creation innovation steal identity rather create best role fantasy race could hope official narrative craven trickster amoral overtly evil birth idea presented people free take form wanted would either unwilling unable stop could anyone needed would ever anything longer remained useful would slow make one form could instantly one useful putting time improving changing one form argument go would translate putting time improving developing individual identity Dopplegangers DD steal identity power prevent developing proper identity creativity develop new form pretty dim view fantasy shapeshifting also heroic shapeshifters myth folklore pop culture well modern culture tend easy identify even change form Stretchy super hero Mr Fantastic Ms Marvel Elongated Man change body shape it’s always still body Plastic Man wider range form able disguise nearly anything still always locked color scheme rad shade may end table telltale color scheme mean he’ll never mistaken audience end table isn’t exception tend much obscure anyone outside narrow slice already narrow slice comic fandom going recognize Chameleon Boy way might Ms Marvel Plastic Man one big name Martian Manhunter unique enough merit explanation later rule heroic shapeshifters change form identity separate heroic individual figure formless identityfree mass Identity hardly static concept idea single unchanging form pretty deeply ingrained modern culture Western civilization fond don’t even harder able willing shift identity even western civilization decided “should” identity reflected popculture culture shapeshifting villain mainstay science fiction including Marvel Skrulls Star Trek’s Dominion Founders space empire posit formless existence root cause culture’s descent fascism paranoia part Skrulls serve primarily faceless mass alien Marvel hero fight Sometimes vaguely racist caricature whatever culture average American citizen expected dislike moment Sometimes notso vaguely caricature along line Sometimes they’re convenient way show super hero murdering someone still saying “see they’re human hero aren’t y’know murderer real” haven’t seen many specific Skrulls history culture comic seen tends isolated writer working together along single storyline plan Yet isolated story interesting theme emerged Skrulls Skrulls potential take form yet “natural” state identical Skrulls wear uniform basic anatomy even tend aggressively sociopathic personality Skrulls also essentially parthenogenic “natural” gender sex Skrull become “biologically” male female complete working reproductive organ addition shown able become possible sex present specie complete functional reproductive organ Yet despite Skrull culture recognizes rigid cultural gender binary incredibly misogynist Aside notable Skrull queen glimpse Skrull society seen shown woman second class citizen best barred position authority constantly talked aggressive male war leader Skrull woman expected present possessing large mammalian breast despite reptile cannot produce milk solely purpose differentiating titillating male skrull population weird dichotomy biology explicitly reject gender binary society obsessed rarely made part Skrulls’ appearance comic provided several interesting Skrull “facts” background two specific comic Runaways Incredible Hercules Runaways created Brian K Vaughn Adrian Alphona story group kid upon discovering parent really gang horrible crossgenre super villain run away hope finding nonevil path parent quickly removed board legacy villainous ancestry continues hang One Runaways girl named Karolina Dean discovers actually rainbowcolored alien end deal parents’ legacy war betrayal shocking way skrull named Xavin arrives claiming fiance union thing politically end war parent engineered destined destroy two world first agrees halt destruction two people Karolina Xavin eventually grow genuinely care remain involved even arranged marriage becomes unnecessary Karolina lesbian Xavin originally present male Despite Xavin’s insistence skrulls “change gender” still uncomfortably seems like story male character tricking gay woman romantic relationship learn Xavin problem get dealt Xavin raised mysoginist part Skrull society learned present whatever would get le abuse Skrull society mean male among mostlygirl team Runaways looking teammate trusting spacebro mean presenting female Xavin learns Earth present whatever want admit actually see either male female either human skrulls define actually story deviant shapeshifter using power trick woman story character learning come nonbinary due love friendship Xavin’s story show u insight individual Skrull still doesn’t answer question Skrull civilization fascistically uniform despite potential power look second comic mentioned Incredible Hercules Greg Pak Fred Van Lente tiein 2008 “major event” Secret Invasion Secret Invasion overall pretty dumb crossover event mostly existed comic superheroes murdering vaguely Muslim foreigner without getting trouble Skrulls religious fanatic first time comic history main series religion thinlyveiled reference average American viewed Islam could one actually good comic come boring alien splatfest Hercules tiein various god Earth put together squad divine superheroes fight Skrull god Ironically one comic actually dealt Skrull religion one stick lazy stereotype Islam Instead created new mythology finally sought explain dichotomy Skrulls ancient Skrulls purged nonshapeshifting member specie last “Skrull Eternal” argued must left alive serve template skrulldom Without argued would form return left without identity “default” Skrull form see Marvel comic attempt emulate iconic Skrull eternal follower argue devotion remain Skrull even take myriad form universe adoption presented gender remain male even take myriad sex universe Ironically Skrull fascism based obsession idealizing form make Skrull shapeshfiting rejection form terrifying Earth culture Interestingly Skrulls debuted around time another Marvel alien Kree two became mortal enemy famous KreeSkrull War storyline Avengers 1971–72 Roy Thomas Sal Buscema Neal Adams John Buscema told story two space empire locked interstellar cold war happy use planet tool proxy battle advanced specie galaxy essentially barbaric unknowable nationalist despot cared whit lived died tool embarrassment political enemy great old comic brilliantly satirized Cold Warera “nation building” country took part Kree Skrull acting like Americans Russians though neither specie could pointed “oh u others enemies” Kree introduced evil Skrulls arguably history Marvel universe even damaging Earth Kree genocidal ultraconservative spaceracists repeatedly tried wipe specie cover genetic test ancestor Skrull remain perennial Avengers punching bag Kree became celebrated ally difference two Skrull deviant shapeshifters Kree essentially human sometimes blue Marvel’s humanity would rather ally specie gloriously revel fascism long appear attractive consistent form Founders Star Trek Deep Space 9 also ironically obsessed form specie without natural state being orange goo naturally take form whatever effortlessly blend others come contact Founders identity away “Great Link” congeal Founders also head farreaching fascist empire see being specie “solids” barely sapient unworthy consideration potentially harm real amorphous people reason tied shapeshifting’s effect culture psychology Founder philosophy take subject’s form truly know take form square square understand squareness way another form could Founders humanity Klingons Bajorans Cardassians etc different shape nothing know being shape inconceivable Founders anything could exist one solid physical form reveals Despite specie without form become sociopath unable see world lens Like Skrulls teaching one outcast Constable Odo learn culture liberate myopic view allow become individual Also like Skrulls battle Earth take form sabotage infiltration lead mass panic paranoia often used sciencefictiony way talking cultural witch hunt truth race identical shapeshifters tend make effective one look deeply Sure shocking Star Fleet quickly begin tossing aside hardwon utopian ethic establishes martial law combat threat shapeshifters infiltrating Earth but… really shapeshifters infiltrating Earth story Witchhunts Salem McCarthyism terrifying real enemy hunt soon introduce actual evil shapeshifters mix especially genocidal fanatic one create actual justification witchhunt might “morally ambiguous” give space McCarthy actual space communist threat fight real witchhunts aren’t ambiguous McCarthy wrong destroyed life None woman Salem bride Satan simply murdered moment KreeSkrull War Dominion War effective focus sinister shapeshifters using power actually infiltrate debase society instead provoke already paranoid racist murderous human job bigname shapeshifting people stray “lack true form lead sociopathy” template DC’s martian Usually J’onn J’onzz Martian Manhunter surviving member specie even he’s rarely see glimpse society Whenever see flashback J’onn’s family destruction people always present picture Martians naked identical live unremarkable unadorned simple dwelling obvious art aesthetic kind pacifist invariably get wiped either natural disaster alien invasion evil twin depending story J’onn always look like every identical martian come Earth define new form best “good” shapeshifting people hope doomed life without individuality art even personality J’onn allowed hero without form he’s aggressively nonthreatening last people martian simply shapeshifters also telepathic every power Superman posse minus heat vision reason walk around naked identical give thought whatsoever physical form Like villainous specie described simply adapt whatever streamlined form best moment time boring empty Mars form skin tough enough worry sandstorm cam fly without wing bland biped shape fine time posse incredible worldwide telepathy individual expression mental create art kind try convey idea feeling otherwise impossible yo express martian can’t even conceive problem bother expressing physical fashion art speech understood much easier intimately telepathy time fact everyone’s mind open mean impossible lie anyone concept deception private thought alien pant would even reason lie feel everyone else feeling wouldn’t want feel hurt caused deception would worry people think would always open Shame know doesn’t exist Mars couldn’t society could even exist telepathic environment easy write last martian Earth calm paternal figure One see fear weakness even see strength won’t acknowledge Often J’onn end bland “dad” Justice League may J’onn often important supporting character team book struggled carry title harder potentially rewarding write culture shock interesting J’onn story focus frustrating adjustment can’t understand lie time Even little lie tell can’t help overhear drive nut make u look immoral petty could communicate martian easily people Earth he’s grown closest interpretation appears stoic he’s wise zen sage still learning communicate physically verbally people put “invasive” contact open mind dichotomy help martian character J’onn fleshing interesting unique character right rather tragic backstory One ongoing theme DC martian story martian LOVE trash Earth TV impossible read mind recorded image irrational goofy behavior badly written character pretty much art form surprise martian Teenage Miss Martian flees Earth place lie allure human deception dangerous leading sociopathic behavior human imagine shapeshifting Like scifi shapeshifters they’re culture they’re able express form way never could unlike others isn’t liberating experience awkwardness formbased identity intimately know mindset contrary peoples’ true thought allows martian chance fear distrust human human project normal shapeshifter fear onto themTags Comics Star Trek DC Comics Marvel Science Fiction

D. B. Cooper: An unsolved mystery

D. B. Cooper: An unsolved mystery On Wednesday, November 24th, 1971, just a day before Thanksgiving, a man named Dan Cooper bought a $20 one-way ticket on Northwest Orient Airlines with cash for flight number 305 from Portland, Oregon to Seattle, Washington. Described as a man in his mid-40s wearing a business suit, a light overcoat, brown shoes, a white shirt, and a black-tie. He carried along with him a dark briefcase and 4 inches by 12 inches by 14-inches bag. Before the plane took off, Cooper seated in 18C ordered a bourbon and soda. An ominous glare in his look. It was certain that a mystery loomed in the thin air that curled around the plane. A little after 3 PM, Cooper handed the stewardess a note. At first, she just put it in her pocket without looking at it. “Miss, you better look at that note. I have a bomb.”, Cooper revealed. He calmly asked her to sit next to him. He opened his briefcase to show red-colored sticks bound by a bunch of wires. The stewardess’s face turned pale with fear. Too afraid to scream, she was ready to do whatever Cooper asked of her. He asked her to write down what he was saying and take it to the captain. “ I want $200k by 5 PM in cash, put in a knapsack. I want two back parachutes and two front parachutes. When we land, I want a fuel truck ready to refuel. No funny stuff or I’ll do the job.” it read. That was enough to send chills down the stewardess’s spine. It was an oddity, he asked for the $200k to be exclusively in $20 bills. The flight landed in Seattle, and cooper changed the 36 passengers on the plane for the money and the parachutes that he had requested. He kept a few crew members on the plane. he had the plane take off for Mexico City, requesting that the plane remained below 10 thousand feet. During the second half of the flight, Cooper put on a pair of dark wrap-around sunglasses with dark rims that would later become part of the sketch that would become famous for anyone with the case. A little after 8 PM, when the plane was somewhere between Seattle and Reno, Nevada, Cooper jumped out of the rear doors of the Boeing 727 with two of the parachutes and the money, never to be seen again. One thing worth noting is that Cooper took off his black J.C. Penney clip-on the tie before jumping. A definitive piece of evidence from which the FBI was able to procure a DNA sample. Who was D. B. Cooper? Where did he go? Did he survive the fall? or did he meet his tragic end? All these questions remain unanswered even after several years of investigation and thorough research. An unsolved mystery that will forever haunt the halls of the FBI.

https://medium.com/@sastadante/d-b-cooper-an-unsolved-mystery-aca35c8df5d

['Om Khairate']

2020-12-13 10:14:36.934000+00:00

['Unsolved Mysteries', 'Marvel', 'Marvel Cinematic Universe']

Title B Cooper unsolved mysteryContent B Cooper unsolved mystery Wednesday November 24th 1971 day Thanksgiving man named Dan Cooper bought 20 oneway ticket Northwest Orient Airlines cash flight number 305 Portland Oregon Seattle Washington Described man mid40s wearing business suit light overcoat brown shoe white shirt blacktie carried along dark briefcase 4 inch 12 inch 14inches bag plane took Cooper seated 18C ordered bourbon soda ominous glare look certain mystery loomed thin air curled around plane little 3 PM Cooper handed stewardess note first put pocket without looking “Miss better look note bomb” Cooper revealed calmly asked sit next opened briefcase show redcolored stick bound bunch wire stewardess’s face turned pale fear afraid scream ready whatever Cooper asked asked write saying take captain “ want 200k 5 PM cash put knapsack want two back parachute two front parachute land want fuel truck ready refuel funny stuff I’ll job” read enough send chill stewardess’s spine oddity asked 200k exclusively 20 bill flight landed Seattle cooper changed 36 passenger plane money parachute requested kept crew member plane plane take Mexico City requesting plane remained 10 thousand foot second half flight Cooper put pair dark wraparound sunglass dark rim would later become part sketch would become famous anyone case little 8 PM plane somewhere Seattle Reno Nevada Cooper jumped rear door Boeing 727 two parachute money never seen One thing worth noting Cooper took black JC Penney clipon tie jumping definitive piece evidence FBI able procure DNA sample B Cooper go survive fall meet tragic end question remain unanswered even several year investigation thorough research unsolved mystery forever haunt hall FBITags Unsolved Mysteries Marvel Marvel Cinematic Universe

Create a Data Marvel — Part 3: Hydrating the Model

Avengers: Infinity War Over the last couple of weeks, we have shown the early steps of this project — the background, building the data model, and the start of the data import from an API to Neo4j. If you haven’t and want to catch up on that information, you can read the posts for Part 1 and Part 2. Today, we will continue the process of getting a maximum amount of data from the Marvel Developer Portal API into Neo4j. We saw the initial import Cypher statement last week, but the trickiest piece is the next import statement, and the issues we uncovered in running it. To recap our limitations and foundations so far, I’ve included an image of our Neo4j graph data model for the Marvel data (yours could differ), as well as some highlights. Marvel API enforces some limitations such as 3,000 calls per day and 100 results per call. So our goal was to get as much data as possible in these limits. Retrieving all comics (43,000+) was too much, so we decided to import characters first. To do that, we used the APOC library pulled characters based on names by letters of the alphabet. Next, we need to retrieve the rest of the data (comics, series, events, stories, creators) to finish populating our graph! Marvel comics data model in Neo4j More Importing — “Hydrating” the Model One of the best things about APOC is the possibilities it opens for different aspects of data import. Remember that apoc.periodic.iterate procedure we used in our last query to loop through each letter of the alphabet and select the characters that start with that letter? Well, we are going to use that procedure again, but in a slightly different way. This time, we will use the first statement within that procedure to select the characters we added to the database in our previous query, and the second statement will call the API to retrieve the comics for each of those characters. The next query is below with a walkthrough of the syntax. It might look complicated, but don’t worry. It simply builds upon syntax we have already discussed above. WITH apoc.date.format(timestamp(), “ms”, ‘yyyyMMddHHmmss’) AS ts WITH “&ts=” + ts + “&apikey=” + $marvel_public + “&hash=” + apoc.util.md5([ts,$marvel_private,$marvel_public]) as suffix CALL apoc.periodic.iterate(‘MATCH (c:Character) WHERE c.resourceURI IS NOT NULL AND NOT exists((c)<-[:INCLUDES]-()) RETURN c LIMIT 100’, ‘CALL apoc.util.sleep(2000) CALL apoc.load.json(c.resourceURI+”/comics?format=comic&formatType=comic&limit=100"+$suffix) YIELD value WITH c, value.data.results as results WHERE results IS NOT NULL UNWIND results as result MERGE (comic:ComicIssue {id: result.id}) ON CREATE SET comic.name = result.title, comic.issueNumber = result.issueNumber, comic.pageCount = result.pageCount, comic.resourceURI = result.resourceURI, comic.thumbnail = result.thumbnail.path + ”.” + result.thumbnail.extension WITH c, comic, result MERGE (comic)-[r:INCLUDES]->(c) WITH c, comic, result WHERE result.series IS NOT NULL UNWIND result.series as comicSeries MERGE (series:Series {id: toInt(split(comicSeries.resourceURI,”/”)[-1])}) ON CREATE SET series.name = comicSeries.name, series.resourceURI = comicSeries.resourceURI WITH c, comic, series, result MERGE (comic)-[r2:BELONGS_TO]->(series) WITH c, comic, result, result.creators.items as items WHERE items IS NOT NULL UNWIND items as item MERGE (creator:Creator {id: toInt(split(item.resourceURI,”/”)[-1])}) ON CREATE SET creator.name = item.name, creator.resourceURI = item.resourceURI WITH c, comic, result, creator MERGE (comic)-[r3:CREATED_BY]->(creator) WITH c, comic, result, result.stories.items as items WHERE items IS NOT NULL UNWIND items as item MERGE (story:Story {id: toInt(split(item.resourceURI,”/”)[-1])}) ON CREATE SET story.name = item.name, story.resourceURI = item.resourceURI, story.type = item.type WITH c, comic, result, story MERGE (comic)-[r4:MADE_OF]->(story) WITH c, comic, result, result.events.items AS items WHERE items IS NOT NULL UNWIND items as item MERGE (event:Event {id: toInt(split(item.resourceURI,”/”)[-1])}) ON CREATE SET event.name = item.name, event.resourceURI = item.resourceURI MERGE (comic)-[r5:PART_OF]->(event)’, {batchSize: 20, iterateList:false, retries:2, params:{suffix:suffix}}); To help process this lengthy query, we will break it up into sections and explain each block. Let us start with the first two sections together. //First section WITH apoc.date.format(timestamp(), “ms”, ‘yyyyMMddHHmmss’) AS ts WITH “&ts=” + ts + “&apikey=” + $marvel_public + “&hash=” + apoc.util.md5([ts,$marvel_private,$marvel_public]) as suffix CALL apoc.periodic.iterate(‘MATCH (c:Character) WHERE c.resourceURI IS NOT NULL AND NOT exists((c)<-[:INCLUDES]-()) RETURN c LIMIT 100’, ‘CALL apoc.util.sleep(2000) CALL apoc.load.json(c.resourceURI+”/comics?format=comic&formatType=comic&limit=100"+$suffix) YIELD value Just as with our initial load query, we start the query using the WITH clause to set up and pass the timestamp and url suffix parameters that we will use further down. The next lines of code calls the familiar apoc.periodic.iterate to pull all the characters in Neo4j ( MATCH statement). Notice the criteria starting from the WHERE clause. We check the Character nodes to see if the resourceURI field contains a value. Marvel puts the url path for most entities in the resourceURI field, so this is a simple check to see if the Character has a url path for us to retrieve data. If it doesn’t, our call will fail, and it won’t find data. * Hint: this is also a good way to trim the number of API calls. If we know a call will fail, then we should not waste precious resources on it. :) The next criteria checks if a relationship type of INCLUDES already exists for the node. This sees if we have already retrieved and inserted comics for a character. If a relationship exists, then we do not pull the comic info for that character again. This avoids duplicate calls for entities where we have already added that information. Finally, we add a LIMIT 100 to that query to only pull 100 characters at a time from our Neo4j database. We ran across issues where queries would timeout because the server would stop responding. Marvel’s server instances probably have a timeout value to ensure users do not hog resources. Or, it could simply be that they need to bolster the architecture a bit to support heavier requests. ;) Either way, we wanted to reduce the time taken to pull in batches of data, so my colleague suggested a LIMIT clause to create smaller processing for each call. While this would increase the number of calls made to the database, it was better than larger batches failing frequently. * Note: at this point, we had 26 calls to load all of the characters for each alphabet letter. That gave us around 1,000 characters in our Neo4j instance. If we pull 100 at a time, we could have a maximum of 11 batches of up to 100 calls (one for each character in a batch). The second statement within the apoc.periodic.iterate adds 2 seconds of sleep between calls to the API for each character. This tries to avoid the timeout of our Marvel server in the middle of one of our calls. Once we wait, we use the apoc.load.json to hit the API endpoint for the comics pertaining to that character from the resourceURI field on our Character nodes. Again, we yield back the JSON object ( YIELD value ). //Second section WITH c, value.data.results as results WHERE results IS NOT NULL UNWIND results as result MERGE (comic:ComicIssue {id: result.id}) ON CREATE SET comic.name = result.title, comic.issueNumber = result.issueNumber, comic.pageCount = result.pageCount, comic.resourceURI = result.resourceURI, comic.thumbnail = result.thumbnail.path + ”.” + result.thumbnail.extension WITH c, comic, result MERGE (comic)-[r:INCLUDES]->(c) To start the next code paragraph, we check that the subsection containing our comics is not null , and unwind the object to get the subsection. Just as we did with the loading of characters, we use MERGE on the comic id to find or create the ComicIssue node and the ON CREATE SET clause to set property values if the node is created. The one thing that is different is the WITH statement and the MERGE line after it. Because we need to use the newly-created node and create a relationship between it and a Character node, we need to pass the ComicIssue node to the next MERGE statement. We do this using WITH . * Note: The creation of the node and the relationship between a comic issue and a character is not done in a single MERGE because Cypher would merge on the entire pattern. If both nodes (with all properties) AND the relationship do not exist, then Cypher creates the entire pattern new, often causing duplicates. To avoid this, you need to match any existing entities, then create a new relationship or node using the existing information. //Third section on Series, Creators, Stories, Events WITH c, comic, result WHERE result.series IS NOT NULL UNWIND result.series as comicSeries MERGE (series:Series {id: toInt(split(comicSeries.resourceURI,”/”)[-1])}) ON CREATE SET series.name = comicSeries.name, series.resourceURI = comicSeries.resourceURI WITH c, comic, series, result MERGE (comic)-[r2:BELONGS_TO]->(series) WITH c, comic, result, result.creators.items as items WHERE items IS NOT NULL UNWIND items as item MERGE (creator:Creator {id: toInt(split(item.resourceURI,”/”)[-1])}) ON CREATE SET creator.name = item.name, creator.resourceURI = item.resourceURI WITH c, comic, result, creator MERGE (comic)-[r3:CREATED_BY]->(creator) WITH c, comic, result, result.stories.items as items WHERE items IS NOT NULL UNWIND items as item MERGE (story:Story {id: toInt(split(item.resourceURI,”/”)[-1])}) ON CREATE SET story.name = item.name, story.resourceURI = item.resourceURI, story.type = item.type WITH c, comic, result, story MERGE (comic)-[r4:MADE_OF]->(story) WITH c, comic, result, result.events.items AS items WHERE items IS NOT NULL UNWIND items as item MERGE (event:Event {id: toInt(split(item.resourceURI,”/”)[-1])}) ON CREATE SET event.name = item.name, event.resourceURI = item.resourceURI MERGE (comic)-[r5:PART_OF]->(event)’, The next paragraphs of code follow a similar pattern for each of the Series , Creator , Story , and Event node labels. One thing that is different is setting the id field for each of those nodes. The toInt(split(item.resourceURI,"/")[-1]) code trims out the id from the url path that Marvel gives for each entity with split(item.resourceURI,"/")[-1]) and then converts that value to an integer for the id field in Neo4j using the toInt() function. The rest of the syntax should be familiar from our load of characters earlier. Now we have some of each entity in the database, but I want to add a few more details to a couple of node labels. Filling in More Details If you take another look at our last Cypher block, you can see that the Series , Creator , Story , and Event node types only have basic information. Each has an id field, as well as the resourceURI and name fields. This doesn’t give us as much info as Marvel offers, and we could run some interesting queries on some of the other fields provided. For our project, the only additional fields I wanted were on the Series and Event nodes for some images and start and end dates. Let’s go ahead and get those imported to Neo4j! These statements are much simpler than the previous two, and we can use the same syntax and logic from our previous queries. The two queries to load these details are shown below, along with brief explanation. //load any extra Series data WITH apoc.date.format(timestamp(), “ms”, ‘yyyyMMddHHmmss’) AS ts WITH “&ts=” + ts + “&apikey=” + $marvel_public + “&hash=” + apoc.util.md5([ts,$marvel_private,$marvel_public]) as suffix CALL apoc.periodic.iterate( ‘MATCH (s:Series) WHERE s.resourceURI IS NOT NULL AND not exists(s.startYear) RETURN s LIMIT 100’, ‘CALL apoc.util.sleep(2000) CALL apoc.load.json(s.resourceURI+”?limit=100" + $suffix) YIELD value WITH value.data.results as results WHERE results IS NOT NULL UNWIND results as result MERGE (series:Series {id: result.id}) SET series.startYear = result.startYear, series.endYear = result.endYear, series.rating = result.rating, series.thumbnail = result.thumbnail.path + ”.” + result.thumbnail.extension’, {batchSize: 20, iterateList: false, params: {suffix:suffix}}); //load any extra Event data WITH apoc.date.format(timestamp(), “ms”, ‘yyyyMMddHHmmss’) AS ts WITH “&ts=” + ts + “&apikey=” + $marvel_public + “&hash=” + apoc.util.md5([ts,$marvel_private,$marvel_public]) as suffix CALL apoc.periodic.iterate( ‘MATCH (event:Event) WHERE event.resourceURI IS NOT NULL AND NOT exists(event.start) RETURN DISTINCT event LIMIT 100’, ‘CALL apoc.util.sleep(2000) CALL apoc.load.json(event.resourceURI+”?limit=100"+$suffix) YIELD value UNWIND value.data.results as result MERGE (e:Event {id: result.id}) SET e.start = result.start, e.end = result.end’, {batchSize: 20, iterateList:false, params: {suffix:suffix}}); Both of these queries use the WITH clause to set up the timestamp and suffix parameters, just as we did with our other queries. The next code block in each query unwinds the JSON object and finds the nested data object, and uses MERGE to find or create the nodes. This time, we just use the SET clause to update or add any values that may not have existed before. Finally, the last code line sets the configuration parameters. What I Learned We now have plenty of data in our Neo4j graph database, and we can start to run some queries to check out the information that is there! After much trial, error, and troubleshooting, the queries given and explained above and in the Part 2 post are what I used to get the data from a finicky API hosted by Marvel into my local instance of Neo4j as a graph data model. Below is a list of my key takeaways from the total data import process up to this point. It took a lot of messed up Cypher queries and clearing out the database multiple times to start the import over from a clean slate. It took several questions to expert teammates to tweak and optimize what I wanted to get and determine that some issues were related to the API on Marvel’s end and not poorly constructed Cypher on my end. I learned a LOT from an actual data set. I wasn’t playing with a cherry-picked data set that was clean and road blocks removed for easy learning. I had to come up with ways around new, inventive issues based on the data set I was dealing with. I was surprised how long the import step took. It wasn’t the actual import execution that was problematic. It was determining how I wanted the data to look and how to craft the Cypher to meet that expectation. Until you deal with a data set and technology hands-on, it is hard to break past a certain point of learning. I could read and read and read, but I needed to actually work through these problems and see what my queries did with the data to comprehend how the procedures worked and what the data looked like in Neo4j. Next Steps While the initial stages of this project may not have been overly glamorous, they are necessary to every project you encounter, whether personal or occupational. In all honesty, I enjoyed the learning process in these steps. The next posts will start looking at crafting the application and how to use Spring Data Neo4j to produce powerful, capable, and pretty code and webpage! Stay tuned! Resources

https://medium.com/neo4j/create-a-data-marvel-develop-a-full-stack-application-with-spring-and-neo4j-part-3-3ac3380e0edb

['Jennifer Reif']

2018-12-14 14:23:15.614000+00:00

['Neo4j', 'Spring', 'Marvel', 'Coding', 'Data']

Title Create Data Marvel — Part 3 Hydrating ModelContent Avengers Infinity War last couple week shown early step project — background building data model start data import API Neo4j haven’t want catch information read post Part 1 Part 2 Today continue process getting maximum amount data Marvel Developer Portal API Neo4j saw initial import Cypher statement last week trickiest piece next import statement issue uncovered running recap limitation foundation far I’ve included image Neo4j graph data model Marvel data could differ well highlight Marvel API enforces limitation 3000 call per day 100 result per call goal get much data possible limit Retrieving comic 43000 much decided import character first used APOC library pulled character based name letter alphabet Next need retrieve rest data comic series event story creator finish populating graph Marvel comic data model Neo4j Importing — “Hydrating” Model One best thing APOC possibility open different aspect data import Remember apocperiodiciterate procedure used last query loop letter alphabet select character start letter Well going use procedure slightly different way time use first statement within procedure select character added database previous query second statement call API retrieve comic character next query walkthrough syntax might look complicated don’t worry simply build upon syntax already discussed apocdateformattimestamp “ms” ‘yyyyMMddHHmmss’ t “ts” t “apikey” marvelpublic “hash” apocutilmd5tsmarvelprivatemarvelpublic suffix CALL apocperiodiciterate‘MATCH cCharacter cresourceURI NULL existscINCLUDES RETURN c LIMIT 100’ ‘CALL apocutilsleep2000 CALL apocloadjsoncresourceURI”comicsformatcomicformatTypecomiclimit100suffix YIELD value c valuedataresults result result NULL UNWIND result result MERGE comicComicIssue id resultid CREATE SET comicname resulttitle comicissueNumber resultissueNumber comicpageCount resultpageCount comicresourceURI resultresourceURI comicthumbnail resultthumbnailpath ”” resultthumbnailextension c comic result MERGE comicrINCLUDESc c comic result resultseries NULL UNWIND resultseries comicSeries MERGE seriesSeries id toIntsplitcomicSeriesresourceURI””1 CREATE SET seriesname comicSeriesname seriesresourceURI comicSeriesresourceURI c comic series result MERGE comicr2BELONGSTOseries c comic result resultcreatorsitems item item NULL UNWIND item item MERGE creatorCreator id toIntsplititemresourceURI””1 CREATE SET creatorname itemname creatorresourceURI itemresourceURI c comic result creator MERGE comicr3CREATEDBYcreator c comic result resultstoriesitems item item NULL UNWIND item item MERGE storyStory id toIntsplititemresourceURI””1 CREATE SET storyname itemname storyresourceURI itemresourceURI storytype itemtype c comic result story MERGE comicr4MADEOFstory c comic result resulteventsitems item item NULL UNWIND item item MERGE eventEvent id toIntsplititemresourceURI””1 CREATE SET eventname itemname eventresourceURI itemresourceURI MERGE comicr5PARTOFevent’ batchSize 20 iterateListfalse retries2 paramssuffixsuffix help process lengthy query break section explain block Let u start first two section together First section apocdateformattimestamp “ms” ‘yyyyMMddHHmmss’ t “ts” t “apikey” marvelpublic “hash” apocutilmd5tsmarvelprivatemarvelpublic suffix CALL apocperiodiciterate‘MATCH cCharacter cresourceURI NULL existscINCLUDES RETURN c LIMIT 100’ ‘CALL apocutilsleep2000 CALL apocloadjsoncresourceURI”comicsformatcomicformatTypecomiclimit100suffix YIELD value initial load query start query using clause set pas timestamp url suffix parameter use next line code call familiar apocperiodiciterate pull character Neo4j MATCH statement Notice criterion starting clause check Character node see resourceURI field contains value Marvel put url path entity resourceURI field simple check see Character url path u retrieve data doesn’t call fail won’t find data Hint also good way trim number API call know call fail waste precious resource next criterion check relationship type INCLUDES already exists node see already retrieved inserted comic character relationship exists pull comic info character avoids duplicate call entity already added information Finally add LIMIT 100 query pull 100 character time Neo4j database ran across issue query would timeout server would stop responding Marvel’s server instance probably timeout value ensure user hog resource could simply need bolster architecture bit support heavier request Either way wanted reduce time taken pull batch data colleague suggested LIMIT clause create smaller processing call would increase number call made database better larger batch failing frequently Note point 26 call load character alphabet letter gave u around 1000 character Neo4j instance pull 100 time could maximum 11 batch 100 call one character batch second statement within apocperiodiciterate add 2 second sleep call API character try avoid timeout Marvel server middle one call wait use apocloadjson hit API endpoint comic pertaining character resourceURI field Character node yield back JSON object YIELD value Second section c valuedataresults result result NULL UNWIND result result MERGE comicComicIssue id resultid CREATE SET comicname resulttitle comicissueNumber resultissueNumber comicpageCount resultpageCount comicresourceURI resultresourceURI comicthumbnail resultthumbnailpath ”” resultthumbnailextension c comic result MERGE comicrINCLUDESc start next code paragraph check subsection containing comic null unwind object get subsection loading character use MERGE comic id find create ComicIssue node CREATE SET clause set property value node created one thing different statement MERGE line need use newlycreated node create relationship Character node need pas ComicIssue node next MERGE statement using Note creation node relationship comic issue character done single MERGE Cypher would merge entire pattern node property relationship exist Cypher creates entire pattern new often causing duplicate avoid need match existing entity create new relationship node using existing information Third section Series Creators Stories Events c comic result resultseries NULL UNWIND resultseries comicSeries MERGE seriesSeries id toIntsplitcomicSeriesresourceURI””1 CREATE SET seriesname comicSeriesname seriesresourceURI comicSeriesresourceURI c comic series result MERGE comicr2BELONGSTOseries c comic result resultcreatorsitems item item NULL UNWIND item item MERGE creatorCreator id toIntsplititemresourceURI””1 CREATE SET creatorname itemname creatorresourceURI itemresourceURI c comic result creator MERGE comicr3CREATEDBYcreator c comic result resultstoriesitems item item NULL UNWIND item item MERGE storyStory id toIntsplititemresourceURI””1 CREATE SET storyname itemname storyresourceURI itemresourceURI storytype itemtype c comic result story MERGE comicr4MADEOFstory c comic result resulteventsitems item item NULL UNWIND item item MERGE eventEvent id toIntsplititemresourceURI””1 CREATE SET eventname itemname eventresourceURI itemresourceURI MERGE comicr5PARTOFevent’ next paragraph code follow similar pattern Series Creator Story Event node label One thing different setting id field node toIntsplititemresourceURI1 code trim id url path Marvel give entity splititemresourceURI1 convert value integer id field Neo4j using toInt function rest syntax familiar load character earlier entity database want add detail couple node label Filling Details take another look last Cypher block see Series Creator Story Event node type basic information id field well resourceURI name field doesn’t give u much info Marvel offer could run interesting query field provided project additional field wanted Series Event node image start end date Let’s go ahead get imported Neo4j statement much simpler previous two use syntax logic previous query two query load detail shown along brief explanation load extra Series data apocdateformattimestamp “ms” ‘yyyyMMddHHmmss’ t “ts” t “apikey” marvelpublic “hash” apocutilmd5tsmarvelprivatemarvelpublic suffix CALL apocperiodiciterate ‘MATCH sSeries sresourceURI NULL existssstartYear RETURN LIMIT 100’ ‘CALL apocutilsleep2000 CALL apocloadjsonsresourceURI”limit100 suffix YIELD value valuedataresults result result NULL UNWIND result result MERGE seriesSeries id resultid SET seriesstartYear resultstartYear seriesendYear resultendYear seriesrating resultrating seriesthumbnail resultthumbnailpath ”” resultthumbnailextension’ batchSize 20 iterateList false params suffixsuffix load extra Event data apocdateformattimestamp “ms” ‘yyyyMMddHHmmss’ t “ts” t “apikey” marvelpublic “hash” apocutilmd5tsmarvelprivatemarvelpublic suffix CALL apocperiodiciterate ‘MATCH eventEvent eventresourceURI NULL existseventstart RETURN DISTINCT event LIMIT 100’ ‘CALL apocutilsleep2000 CALL apocloadjsoneventresourceURI”limit100suffix YIELD value UNWIND valuedataresults result MERGE eEvent id resultid SET estart resultstart eend resultend’ batchSize 20 iterateListfalse params suffixsuffix query use clause set timestamp suffix parameter query next code block query unwinds JSON object find nested data object us MERGE find create node time use SET clause update add value may existed Finally last code line set configuration parameter Learned plenty data Neo4j graph database start run query check information much trial error troubleshooting query given explained Part 2 post used get data finicky API hosted Marvel local instance Neo4j graph data model list key takeaway total data import process point took lot messed Cypher query clearing database multiple time start import clean slate took several question expert teammate tweak optimize wanted get determine issue related API Marvel’s end poorly constructed Cypher end learned LOT actual data set wasn’t playing cherrypicked data set clean road block removed easy learning come way around new inventive issue based data set dealing surprised long import step took wasn’t actual import execution problematic determining wanted data look craft Cypher meet expectation deal data set technology handson hard break past certain point learning could read read read needed actually work problem see query data comprehend procedure worked data looked like Neo4j Next Steps initial stage project may overly glamorous necessary every project encounter whether personal occupational honesty enjoyed learning process step next post start looking crafting application use Spring Data Neo4j produce powerful capable pretty code webpage Stay tuned ResourcesTags Neo4j Spring Marvel Coding Data

Digital Culture Project #2: Primary Source

Digital Culture Project #2: Primary Source Minority misrepresentation in media has been a controversial topic preceding film as a medium altogether. Film was invented in the 1890’s(Skylar and Cook, 2016) and in the time since its creation, social equality and empowerment movements have accomplished a tremendous amount. Yet for some reason commercial films still widely focus on an idealized figure of the past. The figure of the white, straight male dominates the film industry and evidence can be found throughout all film genres. The superhero genre specifically illustrates the most obvious examples, and in the film poster for Thor: The Dark World, the use of composition and gesture reiterates the unimportance of women while promoting the idea of white patriarchy as salvation. Looking at the image, almost within seconds it becomes blatantly clear that Thor, the male superhero of the film takes precedence over everything else. His figure looms overhead and overtakes most of the frame. His face is stern and aloof, as he stands straight and tall directly in the center of the composition. His dominance could practically be read in braille. Aside from the placement of Thor himself, the placement of the other of the film’s characters only accentuate his superiority as they all revolve around him, forming a golden triangular shape with Thor in the immediate center. In art history, the triangle is a traditional compositional technique used to create balance, facilitate eye travel, establish a focal point, and create a visual hierarchy. The triangle also carries a religious connotation with it, representing the Father, Son and Holy Spirit. In renaissance paintings the peak of the triangle is usually reserved for holy figures. Consequently, by placing Thor in this prime location the artists behind the poster leave the viewer absolutely no room to doubt his superiority. While the poster for Thor: The Dark Night features nearly twenty characters only two of these characters are women. Jane Foster, an astrophysicist and Sif, a warrior godlike being are both featured. Although instead of bringing a sense of feminine strength or equality their gestures only depict them as weak and passive. For instance, Sif, despite being a fierce warrior and having several battle scenes in the film is posed with her arms down, chest open, and a soft — almost helpless- facial expression. Compared to the other Viking gods who all seem to be fearlessly charging into battle, she is a stagnant juxtaposition. Along with her pose, Sif is completely weaponless as her sword wielding hand is clumsily cropped off the poster edge. Her last symbol of strength, though phallic, is metaphorically castrated. Meanwhile, Jane is featured in decorative Asgardian dress, which considering most of the film takes place on earth, reflects the expectation for women to assimilate into a man’s customs no matter the circumstance. Also, while Jane does stand in the foreground, her body is completely absorbed by Thor’s frame. Illustrating her as a lustful accessory rather than an entire standalone figure. Gerry Conway, the creator of The Punisher comics once stated “..the comics follow society. They don’t lead society.” (Rosenburg, 2013). However claiming this would mean the imagination of fiction writers is confined to the societies they have grown in. Thor: The Dark Night is the story of a mythic Norse Viking God who lives in space and wields a magic hammer and yet somehow still more convincing than a strong, intelligent, independent minority in today’s media. Rosenberg, A. (2013). ‘Legendary Comics Creators Dismiss Sexism Critiques, Say ‘The Comics Follow Society. They Don’t Lead.’. Retrieved from https://thinkprogress.org/legendary-comics-creators-dismiss-sexism-critiques-say-the-comics-follow-society-they-dont-lead-ed26ddf4ebf0#.i5s4xhxny Creative Commons Attribution (2016). ‘Unit Two B-Composition’. Retrieved from https://mhsart1.wikispaces.com/Composition Marvel Studios (2013). Thor: The Dark Night. Retrieved from https://en.wikipedia.org/wiki/Thor:_The_Dark_World#/media/File:Thor_-_The_Dark_World_poster.jpg Pau, J. (2015). ‘Ritmes Compositius En L’Escultura’. Retrieved from http://joanipau3bvip.blogspot.com/ Sklar, R. and Cook, D (2016). ‘History of the motion picture’. Retrieved from https://www.britannica.com/art/history-of-the-motion-picture

https://medium.com/digital-culture-2016/digital-culture-project-2-7c60d5716a50

['Giovanni Centeno']

2016-10-27 16:43:04.109000+00:00

['Comics', 'Marvel']

Title Digital Culture Project 2 Primary SourceContent Digital Culture Project 2 Primary Source Minority misrepresentation medium controversial topic preceding film medium altogether Film invented 1890’sSkylar Cook 2016 time since creation social equality empowerment movement accomplished tremendous amount Yet reason commercial film still widely focus idealized figure past figure white straight male dominates film industry evidence found throughout film genre superhero genre specifically illustrates obvious example film poster Thor Dark World use composition gesture reiterates unimportance woman promoting idea white patriarchy salvation Looking image almost within second becomes blatantly clear Thor male superhero film take precedence everything else figure loom overhead overtakes frame face stern aloof stand straight tall directly center composition dominance could practically read braille Aside placement Thor placement film’s character accentuate superiority revolve around forming golden triangular shape Thor immediate center art history triangle traditional compositional technique used create balance facilitate eye travel establish focal point create visual hierarchy triangle also carry religious connotation representing Father Son Holy Spirit renaissance painting peak triangle usually reserved holy figure Consequently placing Thor prime location artist behind poster leave viewer absolutely room doubt superiority poster Thor Dark Night feature nearly twenty character two character woman Jane Foster astrophysicist Sif warrior godlike featured Although instead bringing sense feminine strength equality gesture depict weak passive instance Sif despite fierce warrior several battle scene film posed arm chest open soft — almost helpless facial expression Compared Viking god seem fearlessly charging battle stagnant juxtaposition Along pose Sif completely weaponless sword wielding hand clumsily cropped poster edge last symbol strength though phallic metaphorically castrated Meanwhile Jane featured decorative Asgardian dress considering film take place earth reflects expectation woman assimilate man’s custom matter circumstance Also Jane stand foreground body completely absorbed Thor’s frame Illustrating lustful accessory rather entire standalone figure Gerry Conway creator Punisher comic stated “the comic follow society don’t lead society” Rosenburg 2013 However claiming would mean imagination fiction writer confined society grown Thor Dark Night story mythic Norse Viking God life space wields magic hammer yet somehow still convincing strong intelligent independent minority today’s medium Rosenberg 2013 ‘Legendary Comics Creators Dismiss Sexism Critiques Say ‘The Comics Follow Society Don’t Lead’ Retrieved httpsthinkprogressorglegendarycomicscreatorsdismisssexismcritiquessaythecomicsfollowsocietytheydontleaded26ddf4ebf0i5s4xhxny Creative Commons Attribution 2016 ‘Unit Two BComposition’ Retrieved httpsmhsart1wikispacescomComposition Marvel Studios 2013 Thor Dark Night Retrieved httpsenwikipediaorgwikiThorTheDarkWorldmediaFileThorTheDarkWorldposterjpg Pau J 2015 ‘Ritmes Compositius En L’Escultura’ Retrieved httpjoanipau3bvipblogspotcom Sklar R Cook 2016 ‘History motion picture’ Retrieved httpswwwbritannicacomarthistoryofthemotionpictureTags Comics Marvel

Black Panther

Black Panther Movies are a favorite past time for many people. There are many different types of movies, and people prefer different ones. Whether it is drama, comedy, or suspense, it seems like they are all equally preferred. My favorite movie so far is a super hero movie based on the marvel comics character Black Panther. It is the story of five African tribes that were at war with each other because they all wanted possession of a meteorite filled with vibranium. In the movie Black Panther, T’Challa returned home as a king of a place named Wakanda in Africa after the passing of his father.As soon as T’Challa (Black Panther) arrived to his kingdom, he faced many challenges from other tribes exept his allies.One the challenges was a man who is named M’Bakou. In Wakanda culture, before a king is crowned, they have to fight and the winner will be named a king. M’Bakou had to challenge T’Challa for the crown. T’Challa defeated M’Bakou and was soon after proclaimed him. Two thiefs stole a tresor from a museum. W’Kabi, T’Challa’s friend, and Okoye had brought it back, dead or alive. T’Challa, Okoye and Nakia travel to Busan in South Korea where they have learned that the thied planned to sell the tresor. The tresor was a technological super-power. Stevens, one of the thiefs attacks Ross to enable Klaue to get away. Ross is severely injured, T’Challa takes him to Wakanda where the technology can save him. Shuri was a young girl who could manage the wakanda super power technology very well, and she took care of Ross until he gets completely better. Killmonger is T’Challa cousin, he came back after his dad died to get his crown and destroy everybody, even his family. Killmonger wanted to sell wakanda technologies to people of African descent across the globe.T’Chaka haven’t left no choice but to kill him. He orders Zuri to lie about what happened and to say that N’Jobu has simply disappeared. Killmonger kills Klaue and takes his body to Wakanda, bringing it before tribal elders. He reveals his identity and sets forth his claim to the throne. Killmonger challenges T’Challa to a ritual combat; he kills Zuri and then defeats T’Challa, throwing him over a waterfall. Killmonger wanted to destroy the herb but Nakia had the exact time to save one of the herb. Killmonger was about to distribute shipments of vribanium from Wakanda around the world. They were another tribe that was managed by Jabari. This is where Nakia, Shuri and other people from wakanda fleed to get help. They find a comatose T’Challa, who has been cared for by the Jabari tribe in return for his benevolence in sparing M’Baku’s life. Healed by Nakia’s herb, T’Challa returns to Wakanda to fight Killmonger who by now has dressed himself as the Black Panther. Shuri, Nakia and the Dora Milaje joined T’Challa to fight for the vibranium mine. T’Challa manages to stab Killmonger. Killmonger refuses to allow himself to be healed as he would rather. Black Panther was a big hit ever since it was shown in theaters. I love this movie because it showcases the black color and it makes our international pride. Black is a film which helps me rethink about my origin. It is declared that Black Panther is the best film of the year 2018.This story is about my roots, my culture. This movie is good message for all africans. It exposes a lot of things about African culture and heritage.It shows how strong we are while describing the gaps of the leaders that cause disappearance of natural resources. I was very entertained while watching Black Panther. I love it and I’m proud of it.

https://medium.com/keepit112/black-panther-451a98923137

['Muneca Brava']

2018-12-19 14:08:47.523000+00:00

['Marvel']

Title Black PantherContent Black Panther Movies favorite past time many people many different type movie people prefer different one Whether drama comedy suspense seems like equally preferred favorite movie far super hero movie based marvel comic character Black Panther story five African tribe war wanted possession meteorite filled vibranium movie Black Panther T’Challa returned home king place named Wakanda Africa passing fatherAs soon T’Challa Black Panther arrived kingdom faced many challenge tribe exept alliesOne challenge man named M’Bakou Wakanda culture king crowned fight winner named king M’Bakou challenge T’Challa crown T’Challa defeated M’Bakou soon proclaimed Two thief stole tresor museum W’Kabi T’Challa’s friend Okoye brought back dead alive T’Challa Okoye Nakia travel Busan South Korea learned thied planned sell tresor tresor technological superpower Stevens one thief attack Ross enable Klaue get away Ross severely injured T’Challa take Wakanda technology save Shuri young girl could manage wakanda super power technology well took care Ross get completely better Killmonger T’Challa cousin came back dad died get crown destroy everybody even family Killmonger wanted sell wakanda technology people African descent across globeT’Chaka haven’t left choice kill order Zuri lie happened say N’Jobu simply disappeared Killmonger kill Klaue take body Wakanda bringing tribal elder reveals identity set forth claim throne Killmonger challenge T’Challa ritual combat kill Zuri defeat T’Challa throwing waterfall Killmonger wanted destroy herb Nakia exact time save one herb Killmonger distribute shipment vribanium Wakanda around world another tribe managed Jabari Nakia Shuri people wakanda fleed get help find comatose T’Challa cared Jabari tribe return benevolence sparing M’Baku’s life Healed Nakia’s herb T’Challa return Wakanda fight Killmonger dressed Black Panther Shuri Nakia Dora Milaje joined T’Challa fight vibranium mine T’Challa manages stab Killmonger Killmonger refuse allow healed would rather Black Panther big hit ever since shown theater love movie showcase black color make international pride Black film help rethink origin declared Black Panther best film year 2018This story root culture movie good message african expose lot thing African culture heritageIt show strong describing gap leader cause disappearance natural resource entertained watching Black Panther love I’m proud itTags Marvel

The Wisdom of a 6-year-old.

You can be a Superhero Too! I found out last night that this week was going to be the best week ever for my 6yr old. It is superhero week at school, and this kid loves superheroes. To say my son is unique would be an understatement. He is the child that we can’t figure out where he came from. But he is easily one of the funniest people I have ever known, young or old. His gift is seeing the world in such a special way that it makes everyone around him smile and laugh. It really is a gift. Have you ever heard of the book….Amazing Grace by Mary Hoffman His teacher was recently reading it to his class, and its a wonderful book about how a young African American girl wants to be Peter Pan in a play. Its a great message for any kid regardless of race or sex. Which is exactly how my child heard it. So when we go to a parent-teacher conference she brings up this book and mentions that my son was the first person to raise his hand during a group discussion so he could eagerly ask a question. He was dying to share his thoughts on this girl in the book. Now as she is setting this up, my wife and I are just waiting for the other shoe to drop. What did he say? Did he blurt out some racist/sexist offensive comment? Thankfully no, it was crazier than I could have imagined. Now keep in mind he is a superhero fanatic. So when she called on him, he looked at her with an earnest face and said the following…… “I know exactly how she feels, I tell myself every day that I can be Black Panther if I want to be.” Never in a million years did the teacher expect to get that sort of response in a group discussion. She said it took everything she had to not die out laughing. But that is my son. He meant every word of what he said. He clearly had given it hours of thought and was dead serious about his belief that he could become “Black Panther.” So the moral of the story is, a child has a wonderfully unique perspective on life. As an adult, we should never dismiss the simple wisdom of a child. He told himself to believe that he could become whatever he wants, which is a fantastic attribute for the mind of a 6-year-old. We could all stand to live by this simple idea. Even if your goal is to become Black Panther

https://medium.com/@j.chris.alexander/the-wisdom-of-a-6-year-old-2e501a36a0c0

['Chris Alexander']

2018-12-12 02:49:43.230000+00:00

['Marvel', 'Superhero', 'Wisdom', 'Black Panther']

Title Wisdom 6yearoldContent Superhero found last night week going best week ever 6yr old superhero week school kid love superheroes say son unique would understatement child can’t figure came easily one funniest people ever known young old gift seeing world special way make everyone around smile laugh really gift ever heard book…Amazing Grace Mary Hoffman teacher recently reading class wonderful book young African American girl want Peter Pan play great message kid regardless race sex exactly child heard go parentteacher conference brings book mention son first person raise hand group discussion could eagerly ask question dying share thought girl book setting wife waiting shoe drop say blurt racistsexist offensive comment Thankfully crazier could imagined keep mind superhero fanatic called looked earnest face said following…… “I know exactly feel tell every day Black Panther want be” Never million year teacher expect get sort response group discussion said took everything die laughing son meant every word said clearly given hour thought dead serious belief could become “Black Panther” moral story child wonderfully unique perspective life adult never dismiss simple wisdom child told believe could become whatever want fantastic attribute mind 6yearold could stand live simple idea Even goal become Black PantherTags Marvel Superhero Wisdom Black Panther

TV review: Agents of SHIELD — ‘Shadows’

The string of entertaining and surprising episodes that Agents of SHIELD began to pull together at the close of its ropey first season continues with ‘Shadows’, a solid premiere that throws us back into the uncertain world of the agents with an added edge of hopelessness and desperation as they lay everything on the line to gain something that barely gives them an advantage in the war against Hydra. To make matters worse, they even lose the important MacGuffin in the process of securing themselves a quinjet that is capable of being cloaked. The real kicker is seeing that Fitz has been trying to work on such technology and has made no headway, as he talks to a hallucination of Simmons while struggling to recall the scientific knowledge he had before Ward tried to kill the two of them last season. As far as the others go, we can see that Skye and May now have a really effective working partnership in the field and that Coulson has become somewhat reclusive. Ward’s locked up (in a cell that bizarrely seems to have no bars) and has apparently gone through a couple of suicidal experiences. Chances are, no matter what he says, he can’t be trusted. Although, without Garrett to command him, what kind of man is Ward meant to be anymore? There are a whole host of new characters too, and none of them have a particularly great time working alongside the SHIELD agents, ending up in a car crash after Lucy Lawless’s Isabelle Hartley has been forced to have her hand sliced off (courtesy of said mysterious MacGuffin, which is introduced in an early sequence that’ll get people excited for the upcoming Agent Carter series starring Hayley Atwell) and Nick Blood’s Lance Hunter has likely sustained some serious injuries of his own. The best addition is on the villainous side of things, though, as new character Carl Creel (Brian Patrick Wade) provides the first truly menacing superpowered foe for our heroes. This character, also known as the Absorbing Man, is straight from the comics and he has the ability to take on the properties of whatever material he comes into contact with. It’s going to make him difficult to defeat and I’m looking forward to seeing what the show decides to do with him next. All in all, this is a really decent return for SHIELD that should reassure fans that the improvements it made at the end of Season 1 were more than just momentum built off the great twist in Captain America 2. There’s a lot to be excited about here, some of the execution is still clumsy, but it has a very watchable quality and I’m hopeful about the signs of where this is going. Agents of SHIELD airs on Channel 4, on Fridays at 8pm

https://simonc.me.uk/tv-review-agents-of-shield-shadows-8c39f52a629e

['Simon Cocks']

2016-11-14 18:01:25.040000+00:00

['Movies', 'TV', 'Marvel', 'Review']

Title TV review Agents SHIELD — ‘Shadows’Content string entertaining surprising episode Agents SHIELD began pull together close ropey first season continues ‘Shadows’ solid premiere throw u back uncertain world agent added edge hopelessness desperation lay everything line gain something barely give advantage war Hydra make matter worse even lose important MacGuffin process securing quinjet capable cloaked real kicker seeing Fitz trying work technology made headway talk hallucination Simmons struggling recall scientific knowledge Ward tried kill two last season far others go see Skye May really effective working partnership field Coulson become somewhat reclusive Ward’s locked cell bizarrely seems bar apparently gone couple suicidal experience Chances matter say can’t trusted Although without Garrett command kind man Ward meant anymore whole host new character none particularly great time working alongside SHIELD agent ending car crash Lucy Lawless’s Isabelle Hartley forced hand sliced courtesy said mysterious MacGuffin introduced early sequence that’ll get people excited upcoming Agent Carter series starring Hayley Atwell Nick Blood’s Lance Hunter likely sustained serious injury best addition villainous side thing though new character Carl Creel Brian Patrick Wade provides first truly menacing superpowered foe hero character also known Absorbing Man straight comic ability take property whatever material come contact It’s going make difficult defeat I’m looking forward seeing show decides next really decent return SHIELD reassure fan improvement made end Season 1 momentum built great twist Captain America 2 There’s lot excited execution still clumsy watchable quality I’m hopeful sign going Agents SHIELD air Channel 4 Fridays 8pmTags Movies TV Marvel Review

Letterbox’d Litter #6

Letterbox’d Litter #6 The Hobbit (the old one) / Iron Man 2 / Baskin I watched this movie many times as a kid, which I think explains a lot. It’s very pretty, very strange, very ’70s. Per their usual MO, Rankin and Bass bring their weird little vision to life with painterly animation, wonderful voice performances and unsettling character design pretty much across the board. Thanks to the demands of broadcast schedules and kids’ attention spans, it blasts through Tolkien’s story at a bonkers pace. Don’t look to it for a religious translation of the book; instead this is more of a… funky aesthetic reprocessing of it. Sometimes to great effect. For example, Andy Serkis was great and all, but for sheer creepiness he didn’t get within a stone’s throw of Theodore Gottlieb’s frog-faced cave-lake-lurking Gollum. That whole sequence is spooky as hell; the random sung riddle about darkness makes my skin crawl every time. Just one of many things in this movie that left my six-year-old self a bit more screwed-up. But for all its terrors, there’s a real sweetness here as well. Can’t quite put my finger on it, but it’s something to do with Thorin’s words to Bilbo at the end, and Glenn Yarborough’s warbly anthem woven throughout. That all being said — I’ve had the mfing goblins’ song popping into my head repeatedly ever since I watched this. When will it stop. 3/5 Me: So this was written by Justin Theroux. Also Me: Hold up hold up — this was written by Justin Theroux?? Me: … yes, James. This was written by Justin Theroux. Also Me: Well! Butter my butt and call me a biscuit! (bemusedly, to self) This was written by Justin Theroux… Anyway, my flabbergastery at that little revelation aside, this movie is not very good. Not as good as the first, as someone else has probably said somewhere. I mean it’s fun, don’t get me wrong. But fun in a way that neatly highlights my beef with the Marvel brand. The performances are universally winning, the dialogue snappy and enjoyable, the effects and production design dazzling. But all of this is offered as a kind of cocksure smokescreen to obscure some frankly ridiculous storytelling, and seasoned with perfunctory lip service toward moral and political tH3mEs as well as some cringy portrayals of women / people with foreign accents. At its best, the Marvel formula offers license for mythic, boisterous, freewheeling escapism. But just as often, it tries to legitimize lazy writing (sorry Justin 😭) with a $200 million swagger. This is far from Marvel’s best; in fact, I’d go so far as to say that it’s, like, fine I guess. 2.5/5 Ok, I’m probably not gonna be able to sleep until I get my thoughts down about this movie. Baskin blew my mind. I never — like, never — bail on a movie part-way through because of its content, but I was on the razor’s edge of doing so with this one. Coming from a horror fan, I know that sounds like a recommendation, but I’m not sure that it is. Maybe I should have bailed, I dunno. The fact that Baskin ultimately left me exhilarated rather than nauseated is a bit disturbing to me. This film is really depraved, and really effective. I could break down a lot of the technical reasons for why I think it works as well as it does, but I’ll skip that for now. There’s also some interesting symbolic and thematic stuff going on, pretty near the surface, but I won’t get into that either. Suffice to say that, as a devout Catholic, I think this film paints an extraordinarily vivid and convincing picture of hell. Jesus said that “the kingdom of Heaven is among you,” suggesting that heaven is less a physical place than it is a state of being. And as Baskin’s transfixing villain puts it, the reverse is also true. 4/5

https://medium.com/sensor-e-motor/letterboxd-litter-6-c07f438d0673

['James Powers']

2020-11-30 21:33:36.620000+00:00

['Film', 'Film Criticism', 'Review', 'Animation', 'Marvel']

Title Letterbox’d Litter 6Content Letterbox’d Litter 6 Hobbit old one Iron Man 2 Baskin watched movie many time kid think explains lot It’s pretty strange ’70s Per usual MO Rankin Bass bring weird little vision life painterly animation wonderful voice performance unsettling character design pretty much across board Thanks demand broadcast schedule kids’ attention span blast Tolkien’s story bonkers pace Don’t look religious translation book instead a… funky aesthetic reprocessing Sometimes great effect example Andy Serkis great sheer creepiness didn’t get within stone’s throw Theodore Gottlieb’s frogfaced cavelakelurking Gollum whole sequence spooky hell random sung riddle darkness make skin crawl every time one many thing movie left sixyearold self bit screwedup terror there’s real sweetness well Can’t quite put finger it’s something Thorin’s word Bilbo end Glenn Yarborough’s warbly anthem woven throughout said — I’ve mfing goblins’ song popping head repeatedly ever since watched stop 35 written Justin Theroux Also Hold hold — written Justin Theroux … yes James written Justin Theroux Also Well Butter butt call biscuit bemusedly self written Justin Theroux… Anyway flabbergastery little revelation aside movie good good first someone else probably said somewhere mean it’s fun don’t get wrong fun way neatly highlight beef Marvel brand performance universally winning dialogue snappy enjoyable effect production design dazzling offered kind cocksure smokescreen obscure frankly ridiculous storytelling seasoned perfunctory lip service toward moral political tH3mEs well cringy portrayal woman people foreign accent best Marvel formula offer license mythic boisterous freewheeling escapism often try legitimize lazy writing sorry Justin 😭 200 million swagger far Marvel’s best fact I’d go far say it’s like fine guess 255 Ok I’m probably gonna able sleep get thought movie Baskin blew mind never — like never — bail movie partway content razor’s edge one Coming horror fan know sound like recommendation I’m sure Maybe bailed dunno fact Baskin ultimately left exhilarated rather nauseated bit disturbing film really depraved really effective could break lot technical reason think work well I’ll skip There’s also interesting symbolic thematic stuff going pretty near surface won’t get either Suffice say devout Catholic think film paint extraordinarily vivid convincing picture hell Jesus said “the kingdom Heaven among you” suggesting heaven le physical place state Baskin’s transfixing villain put reverse also true 45Tags Film Film Criticism Review Animation Marvel

Five New Marvel Studios Projects Announced for Disney+

Alongside the currently announced lineup of new movie-quality shows coming to Disney+, Marvel Studios has announced four new shows that will explore new and returning heroes. Samuel L. Jackson returns as Nick Fury alongside Ben Mendelsohn as Talos the Skrull in Secret Invasion. The show was teased at the end of Marvel’s Spider-Man: Far From Home and will presumably follow the comic story of the same name, with Skrulls invading the Marvel world right under everyone’s noses. Image provided by Marvel Studios Ironheart, a newer Marvel character, makes her MCU debut in the new titular series. Riri Williams will be played by Dominique Thorne and create the most advanced suit the world has seen since the original Iron Man. Don Cheadle returns as James Rhodes A.K.A. War Machine for the first time ever as a solo character in Armor Wars! A new threat rises using Tony Stark’s technology and Rhodes will have to face it. A new series of shorts about Guardians of the Galaxy fan-favorite Baby Groot will explore his antics. Last but most definitely not least is James Gunn’s live-action The Guardians of the Galaxy Holiday Special! Set to rival the 1978 classic, Star Wars: The Holiday Special, James Gunn gets to write and direct a project he has been bugging Kevin Feige over for years. The special will hit Disney+ in 2022. From the man himself! The future of Marvel on Disney+ is looking bright. Make sure to keep an eye on all things, Disney, at the Boardwalk Times for release dates and more! Giovanni Delgadillo is a columnist for the Boardwalk Times.

https://boardwalktimes.net/five-new-marvel-studios-projects-announced-for-disney-2150999edfe8

[]

2020-12-11 03:58:00.366000+00:00

['Marvel', 'News', 'Disney Plus']

Title Five New Marvel Studios Projects Announced DisneyContent Alongside currently announced lineup new moviequality show coming Disney Marvel Studios announced four new show explore new returning hero Samuel L Jackson return Nick Fury alongside Ben Mendelsohn Talos Skrull Secret Invasion show teased end Marvel’s SpiderMan Far Home presumably follow comic story name Skrulls invading Marvel world right everyone’s nose Image provided Marvel Studios Ironheart newer Marvel character make MCU debut new titular series Riri Williams played Dominique Thorne create advanced suit world seen since original Iron Man Cheadle return James Rhodes AKA War Machine first time ever solo character Armor Wars new threat rise using Tony Stark’s technology Rhodes face new series short Guardians Galaxy fanfavorite Baby Groot explore antic Last definitely least James Gunn’s liveaction Guardians Galaxy Holiday Special Set rival 1978 classic Star Wars Holiday Special James Gunn get write direct project bugging Kevin Feige year special hit Disney 2022 man future Marvel Disney looking bright Make sure keep eye thing Disney Boardwalk Times release date Giovanni Delgadillo columnist Boardwalk TimesTags Marvel News Disney Plus

Justice League vs. The Avengers: Who Would Win & Why It Doesn’t Matter

As an avid comic book reader, I loathe this question. Let me explain why… Imagine this. Wonder Woman, Superman, Batman, and the rest of the Justice League descend onto an open field. About a football field away, you see Captain Marvel, Captain America, Thor, and the rest of the Avengers walk through a Dr. Strange-like portal. The greatest superheroes of all time are about to face off in a battle-to-the-death. It sounds amazing (well, amazing to watch at a safe distance anyway). But who would win? Let me ask you another, more relevant question: Why does it matter? I’ve read about or heard of this event from time to time, and have even discussed at length with a few of my friends who are also comic nerds. TLDR, it was 4 votes out of 4 for the Justice League. But, we also determined that the question itself was pointless. In any event, let’s entertain this epic battle for a few moments. Before all the elitist Marvel fanboys say anything, I’m very indifferent towards either the Justice League or The Avengers, whether it’s the movies or the comics. I watch both, I read both, they’re both awesome. I’m not apt to pick one over the other — they both have their fair share of strengths and weaknesses, so let’s put that argument aside. Watching any of these heroes go toe-to-toe would be absolutely awesome. Reel it back. Let’s keep things in context and go with current comic book teams. The lineups are: Justice League - Batman - Superman - Wonder Woman - Green Lantern (John Stewart) - The Flash (Barry Allen) - Aquaman - Cyborg The Avengers: - Black Panther (T’Challa) - Captain America (Steve Rogers) - Iron Man - Thor - Captain Marvel - She-Hulk There are some notable exclusions here for those who do read comics, like Martian Manhunter and Bruce Banner’s Hulk. These are the current core teams at this very moment. For the sake of equality, we’ll take Cyborg out of the fight, leaving teams balanced at 6 against 6. We can take a few stabs at 1v1 scenarios, such as Batman vs. Iron Man; Thor vs. Wonder Woman; Aquaman vs. Black Panther; all great fights, but there’s a pivotal problem here: If this were truly a fight to the death, Superman and/or Wonder Woman would likely take out any Avenger. Stay with me here and think about this for a minute. Thor is easily the most powerful of all Avengers in this lineup, followed by Captain Marvel and She-Hulk. However, when Thor is faced with any emotional backlash or strife, he immediately breaks down and wallows in his own guilt. After Wonder Woman hits him with the Lasso of Truth to face his demons, he’s done. Yes, it really is that simple for the Amazonian princess. On top of that, it was revealed during a past crossover (and a Jane Foster Thor issue) that both Superman and Wonder Woman can wield Mjolnir. The two snippets on the right of this scene reveal what appears to be Superman and Wonder Woman holding Mjolnir. Whether they are still worthy to do so, and whether they would use this to their advantage, is another question. But I would place my bets on, at the very least, Wonder Woman being able to wield the thunder god’s hammer. Now, even without his hammer, Thor is still incredibly powerful. He has proven time and again that it’s not the hammer that makes him who he is. He’s just…not Superman and Wonder Woman powerful. Aquaman vs. Black Panther would be a hellofa fight to watch. I give a slight edge to Black Panther because of his intellect, suit, and sheer fighting ability, but we would have to consider that Aquaman is some 150 times stronger than the average human. On top of that, we need to consider the venue of said fight. Is this in or near the ocean? If so, Aquaman wins. Is this on dry land? In that case, T’Challa wins. Next up are the genius-level billionaires, Batman vs. Iron Man. Here’s where things get tricky. Two men, Bruce Wayne and Tony Stark, both without actual powers, but with more than enough money and smarts to buy them superhero getups. Batman always has a contingency plan. Iron Man’s many suits are considered top-level Earth nanotech. In many ways, both men allow their egos to get in their own way. What do you get when two men with giant egos and plenty of money go head to head? Destruction. A lot of destruction. I’ll call this one even with an edge towards Batman, the man with the (backup) plan. Even if he were beaten, I’m sure there would be one final ace up his batsuit sleeve. The next few contestants in our fight are a little harder to match up. We have Captains Marvel and America with She-Hulk, against Superman, The Flash, and Green Lantern. Let’s go with a 3 vs. 3 here. Superman and The Flash’s super speed and The Flash’s connection with the Speed Force make this a no-brainer in contest with She-Hulk and Captain America. I know Steve Rogers is the guy that never gives up, and I have a lot of respect for him, but he’s simply no match for either Superman or The Flash. Again, we can go into where this action takes place — if this were Earth-616 (the Marvel Earth), The Flash loses his connection to the Speed Force and is left in a much weaker state — but overall, ol’ reliable is not up to par with these two Justice Leaguers. Though she does get stronger the angrier she gets and is arguably the strongest Avenger in terms of pure strength, She-Hulk would likely fall to Superman alone. When Jen Walters does fight as She-Hulk, it’s often unabated anger that has no clear direction, something Superman is all too familiar fighting against. Against The Flash, she’s far too slow. It would almost take a lucky swing to land a hit on Barry. Then again, the question remains on whether The Flash would be able to do any damage to She-Hulk. With Barry Allen’s high IQ, I’m sure he’d figure it out. Captain Marvel is easily one of the most revered super heroes in the Marvel universe. Her immunity to toxins and energy absorption abilities bring her up to par with some of the top-tier superheroes. Captain Marvel would be carrying this team of 3 Avengers, but it simply wouldn’t be enough. We haven’t even factored in Green Lantern, who’s ring is considered one of the most powerful objects in the DC universe. This fight goes to the Justice League. The next question I’ve brought to the forefront — does this argument even matter? It doesn’t. There would never be a moment, without being force-fed to fans, that these two teams would go against each other in a fight to the death. If anything, they would work together as they’ve done so in the past even if they do clash for a fight or two. As such, this is all speculative and debatable material. I’m sure I could be countered into a viable Avengers-winning argument, an argument I’m open to. There are so many revolving members for both teams that it’s tough to keep tabs on who is part of the team and who is not at any given point in time. On top of that, there are several off-shoots of both teams: Savage Avengers, West Coast Avengers, Secret Avengers, Dark Avengers, Justice League Dark, Justice Incarnate, Justice League Beyond, etc. etc. etc. It’s fun to think about, perhaps even aggravatingly fun for some. But for now, I’ll continue to enjoy my comics for what they are — some of the best stories ever made.

https://medium.com/@jprestonofficial/justice-league-vs-the-avengers-who-would-win-why-it-doesnt-matter-db7244641590

['J Preston']

2020-12-17 15:11:55.024000+00:00

['Comics', 'Justice League', 'Avengers', 'Marvel', 'Dc']

Title Justice League v Avengers Would Win Doesn’t MatterContent avid comic book reader loathe question Let explain why… Imagine Wonder Woman Superman Batman rest Justice League descend onto open field football field away see Captain Marvel Captain America Thor rest Avengers walk Dr Strangelike portal greatest superheroes time face battletothedeath sound amazing well amazing watch safe distance anyway would win Let ask another relevant question matter I’ve read heard event time time even discussed length friend also comic nerd TLDR 4 vote 4 Justice League also determined question pointless event let’s entertain epic battle moment elitist Marvel fanboys say anything I’m indifferent towards either Justice League Avengers whether it’s movie comic watch read they’re awesome I’m apt pick one — fair share strength weakness let’s put argument aside Watching hero go toetotoe would absolutely awesome Reel back Let’s keep thing context go current comic book team lineup Justice League Batman Superman Wonder Woman Green Lantern John Stewart Flash Barry Allen Aquaman Cyborg Avengers Black Panther T’Challa Captain America Steve Rogers Iron Man Thor Captain Marvel SheHulk notable exclusion read comic like Martian Manhunter Bruce Banner’s Hulk current core team moment sake equality we’ll take Cyborg fight leaving team balanced 6 6 take stab 1v1 scenario Batman v Iron Man Thor v Wonder Woman Aquaman v Black Panther great fight there’s pivotal problem truly fight death Superman andor Wonder Woman would likely take Avenger Stay think minute Thor easily powerful Avengers lineup followed Captain Marvel SheHulk However Thor faced emotional backlash strife immediately break wallow guilt Wonder Woman hit Lasso Truth face demon he’s done Yes really simple Amazonian princess top revealed past crossover Jane Foster Thor issue Superman Wonder Woman wield Mjolnir two snippet right scene reveal appears Superman Wonder Woman holding Mjolnir Whether still worthy whether would use advantage another question would place bet least Wonder Woman able wield thunder god’s hammer even without hammer Thor still incredibly powerful proven time it’s hammer make He’s just…not Superman Wonder Woman powerful Aquaman v Black Panther would hellofa fight watch give slight edge Black Panther intellect suit sheer fighting ability would consider Aquaman 150 time stronger average human top need consider venue said fight near ocean Aquaman win dry land case T’Challa win Next geniuslevel billionaire Batman v Iron Man Here’s thing get tricky Two men Bruce Wayne Tony Stark without actual power enough money smart buy superhero getup Batman always contingency plan Iron Man’s many suit considered toplevel Earth nanotech many way men allow ego get way get two men giant ego plenty money go head head Destruction lot destruction I’ll call one even edge towards Batman man backup plan Even beaten I’m sure would one final ace batsuit sleeve next contestant fight little harder match Captains Marvel America SheHulk Superman Flash Green Lantern Let’s go 3 v 3 Superman Flash’s super speed Flash’s connection Speed Force make nobrainer contest SheHulk Captain America know Steve Rogers guy never give lot respect he’s simply match either Superman Flash go action take place — Earth616 Marvel Earth Flash loses connection Speed Force left much weaker state — overall ol’ reliable par two Justice Leaguers Though get stronger angrier get arguably strongest Avenger term pure strength SheHulk would likely fall Superman alone Jen Walters fight SheHulk it’s often unabated anger clear direction something Superman familiar fighting Flash she’s far slow would almost take lucky swing land hit Barry question remains whether Flash would able damage SheHulk Barry Allen’s high IQ I’m sure he’d figure Captain Marvel easily one revered super hero Marvel universe immunity toxin energy absorption ability bring par toptier superheroes Captain Marvel would carrying team 3 Avengers simply wouldn’t enough haven’t even factored Green Lantern who’s ring considered one powerful object DC universe fight go Justice League next question I’ve brought forefront — argument even matter doesn’t would never moment without forcefed fan two team would go fight death anything would work together they’ve done past even clash fight two speculative debatable material I’m sure could countered viable Avengerswinning argument argument I’m open many revolving member team it’s tough keep tab part team given point time top several offshoot team Savage Avengers West Coast Avengers Secret Avengers Dark Avengers Justice League Dark Justice Incarnate Justice League Beyond etc etc etc It’s fun think perhaps even aggravatingly fun I’ll continue enjoy comic — best story ever madeTags Comics Justice League Avengers Marvel Dc

Get to Know a Hero: America Chavez, Ms. America

Get to Know a Hero: America Chavez, Ms. America by Shiri Sondheimer I really, really wish Marvel managed better names for some of their heroes. That said, I was thrilled by the reports out of New York Comic Con this week that Ms. America was getting her own book. Thus far, she’s only been part of ensemble casts but I have no doubt that she can hold her own and gives Marvel fans a hero who is both Latina and LGBTQ. ‘Bout damn time. America is a strong, independent woman who has no fear of showing the world her powers and no hesitancy in using them hen she believes in what she’s doing. I like that in my heroes. You will too. Name: America Chavez Aliases: Ms. America (current), Miss America, Lil’ Chica, MAC Parents: Mrs. America (red) and Mrs. America (Blue). Foster Mother: Loki (which is entirely possible given in mythology, Loki switched gender at will. She actually gave birth to the eight-legged horse Sleipnir). Born: Utopian Parallel Abilities: flight, super-speed, super-strength, invulnerability, inter-dimensional travel, bilingual Affiliations: Teen Brigade, Young Avengers, Hel-Rangers, Ultimates, A-Force Creators: Joe Casey and Nick Dragotta First Appearance: Vengeance #1 (2011) Bio: America was born and raised by her mothers in the Utopian Prime dimension, absorbing her powers from the presence of the Demiurge (sentient life force of Earth’s biosphere). When her mothers were killed attempting to save Utopian prime from being sucked into the common Multiverse, America left home to travel across different dimensions heroing. She eventually took the name Miss America. She joined Teen Brigade, helping them to stop the Young Masters of Evil from disrupting the balance of Order and Chaos. She parted ways with her first team relatively quickly and became involved in a very complex plot set in motion by Kid Loki as an attempt to protect his friend Wiccan (destined to become the next Demiurge). In the course of the plot playing out, an inter-dimensional parasite was released; America helped the nascent squad defeat the parasite and the group (including Kid Loki, Kate Bishop, Wiccan, and Hulkling) decided to remain a team, dubbing themselves the Young Avengers. Mother remained their major adversary. During the most recent Secret Wars run, America lived on Arcadia with rest of A-Force. She earned the wrath of Doom when she disrupted his Shield (the power that kept Battleworld intact and contained), showing the other women not all was quite as it seems under Doom’s rule. She was arrested by one of the Thors (if you don’t know, trust me, you don’t want to) and sentenced to spend the rest of her life working the Shield to prevent others from uncovering what she had found. The Shield eventually collapsed and America was able to leave Battleworld through one of her portals. It was America who urged her friend Kate Bishop to move out from under the influence of Clint Barton, who America though caused Kate more stress than was warranted. After the reconstitution of the Multiverse, Ms. America joined Captain Marvel’s Ultimates squadron, defeating Galactus and saving the universe again. Her extensive knowledge of parallel universes was ignored, almost getting the entire group killed during their next mission, but America managed to save them with the help of her girlfriend, Lisa (an EMT in training. Perhaps a Night Nurse of the future?). During the current Civil War, Ms. America has remained with the Ultimates, backing Captain Marvel. Despite grieving for (redacted) and being very concerned about (other redacted), America followed Carol on additional missions, however, after they apprehended Alison Green, who did not have the purported black hole generator in her briefcase, America began to doubt their cause. She told T’Challa she had been in universes with predictive justice and that it never played out as intended. Captain Marvel asked America to make a choice that point; America hit Carol with a chair, declaring her intention to leave the Ultimates. Carol attempted to have America apprehended and failed. And that is the story so far. Sources: http://marvel.wikia.com/wiki/A-Force_Vol_1_1 http://marvel.wikia.com/wiki/America_Chavez_(Utopian_Parallel) http://marvel.wikia.com/wiki/Demiurge_(Earth-616) http://marvel.wikia.com/wiki/Lisa_Halloran_(Earth-616) http://marvel.wikia.com/wiki/Young_Masters_(Earth-616) Blogniatrix and disembodied voice at The Last Chance Salon. RN at the Department of Therapeutic Misadventures. Author of HERO HANDLERS. Drinker of much coffee. Acquire-er of many comics. Lust-afterer of all the books. Step-uponer of multitudenous Legos.

https://medium.com/@geekdads/get-to-know-a-hero-america-chavez-ms-america-c6a77ec721b2

[]

2016-10-19 19:36:38.279000+00:00

['Comics', 'Marvel']

Title Get Know Hero America Chavez Ms AmericaContent Get Know Hero America Chavez Ms America Shiri Sondheimer really really wish Marvel managed better name hero said thrilled report New York Comic Con week Ms America getting book Thus far she’s part ensemble cast doubt hold give Marvel fan hero Latina LGBTQ ‘Bout damn time America strong independent woman fear showing world power hesitancy using hen belief she’s like hero Name America Chavez Aliases Ms America current Miss America Lil’ Chica MAC Parents Mrs America red Mrs America Blue Foster Mother Loki entirely possible given mythology Loki switched gender actually gave birth eightlegged horse Sleipnir Born Utopian Parallel Abilities flight superspeed superstrength invulnerability interdimensional travel bilingual Affiliations Teen Brigade Young Avengers HelRangers Ultimates AForce Creators Joe Casey Nick Dragotta First Appearance Vengeance 1 2011 Bio America born raised mother Utopian Prime dimension absorbing power presence Demiurge sentient life force Earth’s biosphere mother killed attempting save Utopian prime sucked common Multiverse America left home travel across different dimension heroing eventually took name Miss America joined Teen Brigade helping stop Young Masters Evil disrupting balance Order Chaos parted way first team relatively quickly became involved complex plot set motion Kid Loki attempt protect friend Wiccan destined become next Demiurge course plot playing interdimensional parasite released America helped nascent squad defeat parasite group including Kid Loki Kate Bishop Wiccan Hulkling decided remain team dubbing Young Avengers Mother remained major adversary recent Secret Wars run America lived Arcadia rest AForce earned wrath Doom disrupted Shield power kept Battleworld intact contained showing woman quite seems Doom’s rule arrested one Thors don’t know trust don’t want sentenced spend rest life working Shield prevent others uncovering found Shield eventually collapsed America able leave Battleworld one portal America urged friend Kate Bishop move influence Clint Barton America though caused Kate stress warranted reconstitution Multiverse Ms America joined Captain Marvel’s Ultimates squadron defeating Galactus saving universe extensive knowledge parallel universe ignored almost getting entire group killed next mission America managed save help girlfriend Lisa EMT training Perhaps Night Nurse future current Civil War Ms America remained Ultimates backing Captain Marvel Despite grieving redacted concerned redacted America followed Carol additional mission however apprehended Alison Green purported black hole generator briefcase America began doubt cause told T’Challa universe predictive justice never played intended Captain Marvel asked America make choice point America hit Carol chair declaring intention leave Ultimates Carol attempted America apprehended failed story far Sources httpmarvelwikiacomwikiAForceVol11 httpmarvelwikiacomwikiAmericaChavezUtopianParallel httpmarvelwikiacomwikiDemiurgeEarth616 httpmarvelwikiacomwikiLisaHalloranEarth616 httpmarvelwikiacomwikiYoungMastersEarth616 Blogniatrix disembodied voice Last Chance Salon RN Department Therapeutic Misadventures Author HERO HANDLERS Drinker much coffee Acquireer many comic Lustafterer book Stepuponer multitudenous LegosTags Comics Marvel

NutGain’s Ecosystem Gives a Platform to Surging Crypto Adoption

NutGain’s Ecosystem Gives a Platform to Surging Crypto Adoption Introduction: Developing advancements in the motorized space have opened huge freedoms for shoppers. Accoutrements from digital currencies to smart perusing operations, to online retail stages, have opened colossal freedoms for the customer and made these capacities available and harmonious. While simply these accoutrements offer exceptional influence and comfort, consolidating them in one brought together frame could exponentialize these advantages. What’s NutGain? NutGain is a worldwide decentralized natural system offering guests strong innovative accoutrements and remarkable benefits in the internet business space. At the core of NutGain’s advancements is the uniting of strong nascent inventions in the motorized space, to shape a coordinated frame. Vision of Nutgain: The vision for the program was to make a broad and profitable instrument that empowers the two guests and masterminds to extend the utility of the web. - NutGain Ecosystem - NutGain Browser - NutGain program, accoutred with a set-up of state of the art operations to ameliorate web customer experience and security, for illustration, a custom VPN, firewall and web assault insurance, voice-and- videotape call, and an elite talk stage. Notwithstanding the former accoutrements, the program likewise includes NutGain’s dApps program that permits contrivers to make a wide compass of uses in colorful fields, associate web grounded gaming, and module other diversion operations. NutGain’s program flauntssuper-quick poring pets, offers an announcement free web- grounded sapience, and has been bettered for effectiveness. The program likewise accompanies a many customized highlights, for illustration, altered news channels and a sidebar to effectively pierce and control foundation handling operations. Capacity of Nutgain Browser: The essential capacity of the program is to fill in as the base subcaste of the terrain’s integrative utility. This part of the terrain will permit it to interminably develop and ameliorate, as individualities fabricate and offer redundant upgraded highlights. The focal element of the program is the capacity it gives guests to control the progressions of their poring information. This incorporates the overseeing of treats and the swell of data in respects to the destinations they visit. NutGain program returns guests' veritably own information to their own hands. Assuming a customer chose to uncover their poring information, the data is gathered with complete facelessness stamped distinctly with an advanced recognizable evidence number. The information will not ever contain individual identifying craft, for illustration, telephone figures, dispatch or factual addresses, or customer IDs. Either, guests can decide to quit participating their poring information whenever. D-Hyperactive web grounded business NutGain’s D-HyperactiveE-business stage works grounded on NutGain’s Stoner Data Program, which empowers guests to gain by the worth of their veritably own poring information. At the point when guests decided to join the NutGain people group, they recover the worth of their information for entrance to the terrain and every one of its prizes. D-Hyper was intended to permit guests and contrivers to liberate topmost advantage from their internet grounded exercises. Grounded on NutGain’s picky program, D-Hyperactive opens a full compass of retail choices to purchasers just as satisfying business sectors for online merchandisers. NutGain highlights customer unequivocal advertising bias fueled by the frame’s information base of individual information and poring patterns. give a full compass of administrations to business operations, including the capacity to admit cryptographic forms of plutocrat and put together showcasing advancement of business systems. At the point when guests decide to assume responsibility for their information with NutGain, they’re compensated with entrance to the D-Hyperactive web grounded business stage. With the wide range of dealers uniting with D-Hyper, guests will actually want to recover the worth of their information for copping drive and get exceptional limits on deals they make. The motorized marketable center will likewise have prize and responsibility programs empowered to profit the two purchasers and dealers. NutGain Token: The plutocrat that controls the frame, the NutGain Token, is a fully working digital currency that can be employed to either make deals in the natural system or be recovered for other advanced financial norms. The Token is an advanced plutocrat dependent on Binance Smart Chain (BSC) BEP20 standard employed for Etherum and other notable digital currencies. Mileage All administrations in the NutGain natural system are paid exercising NutGain Token. Token at the same time works as a system of compensating guests and joining the NutGain people group. The operation to store Tokens is incorporated into the program as a Defi Wallet, a decentralized crypto portmanteau that makes guests the sole overseer of their NutGain cash. The Wallet also takes into account guests to trade their NutGain Tokens for other cryptographic forms of plutocrat, further opening the compass of motorized business to the terrain’s individualities. Tokonomics: Token Name: Nutgain Token Ticker: NUTG Network: Binance Smart Chain Complete Supply. Conclusion: NutGain is authentically the first of its kind. Riding the main patterns in the advanced space, from crypto event to flooding on the web business, the frame is the main one to offer a fully coordinated web- grounded stage, helping the two closures of the present web requests. The fresh advantage of NutGain, taking everything into account is the extension it offers to redundant motorized purchasing choices. The cash that controls the frame, the NutGain Token, is a fully working cryptographic plutocrat that can be employed to either make deals in the natural system or be recovered for other motorized financial norms. Get Further Information: Twitter: https//twitter.com/NutGainOfficial Telegram: https//t.me/ nutgainofficial Medium: https//medium.com/@NutGain ________________AUTHOR___________ Bitcointalk username: Uzairmoti11 Bitcointalk Profile Link: https://bitcointalk.org/index.php?action=profile;u=2856508 BSC wallet address: 0x03f6BeA720b87e4E59968e52b9deEABbDD42df4E

https://medium.com/@uzairnasir859/nutgains-ecosystem-gives-a-platform-to-surging-crypto-adoption-56f4b29f8ee

['Earning Master']

2021-12-26 11:22:39.422000+00:00

['Bsc', 'Crypto']

Title NutGain’s Ecosystem Gives Platform Surging Crypto AdoptionContent NutGain’s Ecosystem Gives Platform Surging Crypto Adoption Introduction Developing advancement motorized space opened huge freedom shopper Accoutrements digital currency smart perusing operation online retail stage opened colossal freedom customer made capacity available harmonious simply accoutrement offer exceptional influence comfort consolidating one brought together frame could exponentialize advantage What’s NutGain NutGain worldwide decentralized natural system offering guest strong innovative accoutrement remarkable benefit internet business space core NutGain’s advancement uniting strong nascent invention motorized space shape coordinated frame Vision Nutgain vision program make broad profitable instrument empowers two guest mastermind extend utility web NutGain Ecosystem NutGain Browser NutGain program accoutred setup state art operation ameliorate web customer experience security illustration custom VPN firewall web assault insurance voiceand videotape call elite talk stage Notwithstanding former accoutrement program likewise includes NutGain’s dApps program permit contriver make wide compass us colorful field associate web grounded gaming module diversion operation NutGain’s program flauntssuperquick poring pet offer announcement free web grounded sapience bettered effectiveness program likewise accompanies many customized highlight illustration altered news channel sidebar effectively pierce control foundation handling operation Capacity Nutgain Browser essential capacity program fill base subcaste terrain’s integrative utility part terrain permit interminably develop ameliorate individuality fabricate offer redundant upgraded highlight focal element program capacity give guest control progression poring information incorporates overseeing treat swell data respect destination visit NutGain program return guest veritably information hand Assuming customer chose uncover poring information data gathered complete facelessness stamped distinctly advanced recognizable evidence number information ever contain individual identifying craft illustration telephone figure dispatch factual address customer IDs Either guest decide quit participating poring information whenever DHyperactive web grounded business NutGain’s DHyperactiveEbusiness stage work grounded NutGain’s Stoner Data Program empowers guest gain worth veritably poring information point guest decided join NutGain people group recover worth information entrance terrain every one prize DHyper intended permit guest contriver liberate topmost advantage internet grounded exercise Grounded NutGain’s picky program DHyperactive open full compass retail choice purchaser satisfying business sector online merchandiser NutGain highlight customer unequivocal advertising bias fueled frame’s information base individual information poring pattern give full compass administration business operation including capacity admit cryptographic form plutocrat put together showcasing advancement business system point guest decide assume responsibility information NutGain they’re compensated entrance DHyperactive web grounded business stage wide range dealer uniting DHyper guest actually want recover worth information copping drive get exceptional limit deal make motorized marketable center likewise prize responsibility program empowered profit two purchaser dealer NutGain Token plutocrat control frame NutGain Token fully working digital currency employed either make deal natural system recovered advanced financial norm Token advanced plutocrat dependent Binance Smart Chain BSC BEP20 standard employed Etherum notable digital currency Mileage administration NutGain natural system paid exercising NutGain Token Token time work system compensating guest joining NutGain people group operation store Tokens incorporated program Defi Wallet decentralized crypto portmanteau make guest sole overseer NutGain cash Wallet also take account guest trade NutGain Tokens cryptographic form plutocrat opening compass motorized business terrain’s individuality Tokonomics Token Name Nutgain Token Ticker NUTG Network Binance Smart Chain Complete Supply Conclusion NutGain authentically first kind Riding main pattern advanced space crypto event flooding web business frame main one offer fully coordinated web grounded stage helping two closure present web request fresh advantage NutGain taking everything account extension offer redundant motorized purchasing choice cash control frame NutGain Token fully working cryptographic plutocrat employed either make deal natural system recovered motorized financial norm Get Information Twitter httpstwittercomNutGainOfficial Telegram httpstme nutgainofficial Medium httpsmediumcomNutGain AUTHOR Bitcointalk username Uzairmoti11 Bitcointalk Profile Link httpsbitcointalkorgindexphpactionprofileu2856508 BSC wallet address 0x03f6BeA720b87e4E59968e52b9deEABbDD42df4ETags Bsc Crypto

CryptoArt.Ai is now deployed on both Ethereum BSC network

CryptoArt.Ai is now deployed on both Ethereum BSC network CryptoArt.Ai has successfully transmitted to the BSC network, which is one of only a few decentralized NFT digital crypto art trading marketplaces in the business where both the ethereum and coin ecosystems are currently conveyed. Why cross-chain? Fees for ethereum gas are exorbitant. The popularity of DeFi, NFT, and GameFi has pushed the Ethernet Gas charge to an all-time high in a short period of time, resulting in clients paying more and persevering through the network outage. Interestingly, BSC can address client exchange issues while lowering the on-chain Gas charge, thereby lowering the barrier for clients to use and enter the blockchain and providing more options to project parties and client exchanges. The environmental benefits of BSC cannot be overlooked. The BSC network, which was conceived more than a year ago as the top ecological establishment, is currently growing brilliantly in the public chain field. In the DeFi field, while ethereum's lock volume remains first, its ecological thriving is not identical to that of the BSC, which ranks second in lock volume. The absolute exchange volume on the BSC exceeds one billion, there are over 800 dynamic activities, and the average daily dynamic location exceeds one million, all of which outperform ethereum. The BSC chain has a rich and rapidly developing ecosystem, currently covering notable activities in DeFi, gaming, NFT, wallets, social, and instruments. The cross-chain BSC can entice NFT makers from the Binance Smartchain to integrate their NFT works into the CryptoArt.Ai BSC ecosystem, resulting in a diverse, multi-faceted, and multi-chain NFT framework. The primary market strategy of CryptoArt.Ai is to complete cross-chain transactions. CryptoArt.Ai has been deployed at a consistent rate, with advancements in innovation, speculation and participation, market improvement, and ecological development, and its fundamental beliefs can all be found in the improvement interaction. As of September 14, the ecological pass CART has completed cross-chain, currently supporting two public chains, ETH and BSC, and giving CART/BNB beginning liquidity on PancakeSwap, as claimed by the market. The implementation of the BSC network on CryptoArt.Ai at this time will aid in the enhancement of the CryptoArt.Ai ecology, as well as the addition of more application scenarios and greater liquidity. Assuming that advancement and market capitalisation are the windows through which the market can see the current state of public chain advancement, then, as the fundamental base layer of the blockchain business, the developer ecology and community are drives. It has a rich ecological experience. To provide a better support and product experience to the majority of NFT community, we have consistently concluded that we will formally convey the BSC network! What comes next? Enhance options and the client experience Clients can choose whether to enter the Ether or BSC network for NFT art exchanges when signing up for the CryptoArt.Ai stage. Artists can freely choose to distribute their deals across multiple chains, and gatherers can choose to purchase NFT artworks across multiple eco-chains. Because the chains are distinct, the comparing fees and confirmation times will be as well. Taking care of charge: when compared to the high expense of $1000 for the ETH main chain, the BNB taking care of charge is significantly lower. Affirmation time: In comparison to the ETH main chain's 15s-1min affirmation time, the BSC network is many times faster. Strong environmental assistance, allowing for more effective approaches to NFT The versatility of the CryptoArt.Ai trading market is enhanced by the use of different chains, and resource exchange activity is simplified. In the meantime, multi-chain will expand in format, client volume, and impact. We want to build a solid foundation for CA's future growth and to accelerate stage improvement. CryptoArt.Ai will continue to open up the NFT market, breaking down barriers, expanding its international impact, and providing easy access to everyone. The establishment of the BSC network is a critical stage in the development of CryptoArt. Ai, we'd like to think that you'll be able to use it to investigate and appreciate NFT art as well. Join the CryptoArt.Ai ($CART) People group Site: https://cryptoart.ai/ Disunity: https://discord.com/welcome/CEUbwjJKeQ Telegram：https://t.me/cryptoartai Twitter: https://twitter.com/CryptoArt_Ai Medium: https://cryptoart-ai.medium.com/ Instagram：https://www.instagram.com/cryptoart.ai/

https://medium.com/@obedobed21/cryptoart-ai-is-now-deployed-on-both-ethereum-bsc-network-a9c304f41f83

[]

2021-12-26 11:12:28.832000+00:00

['Ethereum', 'Bsc', 'Cryptoart', 'Cross Platform', 'Gas Fees']

Title CryptoArtAi deployed Ethereum BSC networkContent CryptoArtAi deployed Ethereum BSC network CryptoArtAi successfully transmitted BSC network one decentralized NFT digital crypto art trading marketplace business ethereum coin ecosystem currently conveyed crosschain Fees ethereum gas exorbitant popularity DeFi NFT GameFi pushed Ethernet Gas charge alltime high short period time resulting client paying persevering network outage Interestingly BSC address client exchange issue lowering onchain Gas charge thereby lowering barrier client use enter blockchain providing option project party client exchange environmental benefit BSC cannot overlooked BSC network conceived year ago top ecological establishment currently growing brilliantly public chain field DeFi field ethereums lock volume remains first ecological thriving identical BSC rank second lock volume absolute exchange volume BSC exceeds one billion 800 dynamic activity average daily dynamic location exceeds one million outperform ethereum BSC chain rich rapidly developing ecosystem currently covering notable activity DeFi gaming NFT wallet social instrument crosschain BSC entice NFT maker Binance Smartchain integrate NFT work CryptoArtAi BSC ecosystem resulting diverse multifaceted multichain NFT framework primary market strategy CryptoArtAi complete crosschain transaction CryptoArtAi deployed consistent rate advancement innovation speculation participation market improvement ecological development fundamental belief found improvement interaction September 14 ecological pas CART completed crosschain currently supporting two public chain ETH BSC giving CARTBNB beginning liquidity PancakeSwap claimed market implementation BSC network CryptoArtAi time aid enhancement CryptoArtAi ecology well addition application scenario greater liquidity Assuming advancement market capitalisation window market see current state public chain advancement fundamental base layer blockchain business developer ecology community drive rich ecological experience provide better support product experience majority NFT community consistently concluded formally convey BSC network come next Enhance option client experience Clients choose whether enter Ether BSC network NFT art exchange signing CryptoArtAi stage Artists freely choose distribute deal across multiple chain gatherer choose purchase NFT artwork across multiple ecochains chain distinct comparing fee confirmation time well Taking care charge compared high expense 1000 ETH main chain BNB taking care charge significantly lower Affirmation time comparison ETH main chain 15s1min affirmation time BSC network many time faster Strong environmental assistance allowing effective approach NFT versatility CryptoArtAi trading market enhanced use different chain resource exchange activity simplified meantime multichain expand format client volume impact want build solid foundation CAs future growth accelerate stage improvement CryptoArtAi continue open NFT market breaking barrier expanding international impact providing easy access everyone establishment BSC network critical stage development CryptoArt Ai wed like think youll able use investigate appreciate NFT art well Join CryptoArtAi CART People group Site httpscryptoartai Disunity httpsdiscordcomwelcomeCEUbwjJKeQ Telegram：httpstmecryptoartai Twitter httpstwittercomCryptoArtAi Medium httpscryptoartaimediumcom Instagram：httpswwwinstagramcomcryptoartaiTags Ethereum Bsc Cryptoart Cross Platform Gas Fees

Get Ready To Celebrate This XMASS With Santa Coin

Santa Coin is a new cryptocurrency with its own blockchain technology used to make payments within its project system.The price of this coin can go up at any moment due to the increasing demand here.This Santa Coin is made up of a primary blockchain and various off chain payment mechanisms. This technology allows users to make faster transactions without having to create a communication channel and the fees are significantly lower than with payment systems such as Bitcoin or Ethereum. SANTA Coin is a payment method as well as an investment tool that allows you to make a profit from its development.It provides a decentralized marketplace where Santa Coins can be used to buy and sell products and services.In addition,an auction platform will be created that will allow users to acquire assets at affordable prices as well as access to a variety of health and quality of life services. I’m right to say that the Santa Coin club comes through the meme coin concept.The meme coin concept can be interpreted as an internet joke that can be transformed into a digital currency.It is not supported by anything other than the market like other cryptocurrencies.The reason why someone wants to invest in a meme coin is because its value has a high potential to increase rapidly and you can earn a lot of money in just one month.Did you know that many people are currently making millions of dollars by investing in popular meme coin projects like Dogecoin,Ripples and Pepe Cash? The crypto world has embraced the Santa Coin project as one of the most promising new cryptoqurrencies currently on the market created under that meme concept.It was released a few weeks ago and it is already coming in first place among meme currencies.now it contains information and data of over 25 million users and more and more people are joining every day. Santacoin’s architecture is unique among other innovation projects because it can be used as an investment as well as a transaction currency.It provides incentives for keeping,trading and pricing.It also has a MasterNode function that provides additional rewards and incentives.The incentive scheme is designed to encourage people to use Santa Coin as a payment method.If the value of Santacoin goes up,its trade incentives are meant to help.It encourages merchants to sell their currency more than once,rewarding them with extra Santacoins for every transaction completed on Binance. Every day Santa Coin Binance Pegged pays 8% of the transaction tax in USD.So if someone buys 10 coins for 100$ each and pays a transaction fee of 10$ he will receive 0.08 X 10 = 0.8 USD from Santa Coin every day.because the conversion option in Santacoin Web Wallet can be converted to real USD. Token distribution for Santa Coin has several components.There are three stages to pre sale.The first phase is the Presale phase,which lasts for six months.During that round 5% of the total volume is sold out.Then the number of tokens available for purchase during the pre sale period fluctuates according to the following formula. (Monthly demand x 5%) + Savings supply = monthly supply Here it is important to remember that the supply for each month is always less than or equal to the demand for the previous month.This is done to encourage people to keep them as an investment rather than selling them as soon as Santa arrives. In discussing all of this,it shows the commitment of its designers to the Santa Coin.It certainly contributes to the growth of money.Gifts can be exchanged on Binance so people can start trading immediately and earn money even if they do not keep it,so they do not have to worry about keeping it the same as they do with other currencies.It is based on Binance’s Pegged USD and will not fluctuate in price. The primary objective of Santa Coin is to provide users with computerized ownership of the play-to-acquire Santa Sport and Santa F1 Sport Games and to create a worldview for the game.Players who can collect Santa tokens via blockchain are not allowed to be interested in the play-procurement game framework. All the central sports resources in Santa F1 are used and sold by the players in the same way as the actual game. Features of Santa Coin 1. Against the pause system Having a high variance with a fair intervention sanctions structure. 2. Existence of a liquidity pool. 3. The point of having to make multiple purchases. 4. Directness. 5. Public approval and trust. 6. Proficiency and timeliness of the staff. How useful is it to be able to reap the benefits of such an effective project among the innovative crypto platforms?The world does not always reward the best.So be wise to make the most of the opportunity.Thank you ….! #Santa_coin #BSC #Binancechain #BTC #C_z #Shiba #evergrow #cryptomoonshots #busd @cryptosantax #binance #christmas #bitcoin For More Details and Buy Santa Coins Visit Here Website : Twitter : Telegram : Announcement AUTHOR Forum Username: Ndkroxxx Forum Profile Link: https://bitcointalk.org/index.php?action=profile;u=3373106 Telegram Username: @Hyper009 BEP-20 Wallet Address: 0x8af202823e95845E418ece83A1E57eD95eeD4a74

https://medium.com/@hyper4563/get-ready-to-celebrate-this-xmass-with-santa-coin-25f099e611bb

[]

2021-12-20 00:45:18.622000+00:00

['Bsc', 'Binance Chain', 'Christmas', 'Bitcoin']

Title Get Ready Celebrate XMASS Santa CoinContent Santa Coin new cryptocurrency blockchain technology used make payment within project systemThe price coin go moment due increasing demand hereThis Santa Coin made primary blockchain various chain payment mechanism technology allows user make faster transaction without create communication channel fee significantly lower payment system Bitcoin Ethereum SANTA Coin payment method well investment tool allows make profit developmentIt provides decentralized marketplace Santa Coins used buy sell product servicesIn additionan auction platform created allow user acquire asset affordable price well access variety health quality life service I’m right say Santa Coin club come meme coin conceptThe meme coin concept interpreted internet joke transformed digital currencyIt supported anything market like cryptocurrenciesThe reason someone want invest meme coin value high potential increase rapidly earn lot money one monthDid know many people currently making million dollar investing popular meme coin project like DogecoinRipples Pepe Cash crypto world embraced Santa Coin project one promising new cryptoqurrencies currently market created meme conceptIt released week ago already coming first place among meme currenciesnow contains information data 25 million user people joining every day Santacoin’s architecture unique among innovation project used investment well transaction currencyIt provides incentive keepingtrading pricingIt also MasterNode function provides additional reward incentivesThe incentive scheme designed encourage people use Santa Coin payment methodIf value Santacoin go upits trade incentive meant helpIt encourages merchant sell currency oncerewarding extra Santacoins every transaction completed Binance Every day Santa Coin Binance Pegged pay 8 transaction tax USDSo someone buy 10 coin 100 pay transaction fee 10 receive 008 X 10 08 USD Santa Coin every daybecause conversion option Santacoin Web Wallet converted real USD Token distribution Santa Coin several componentsThere three stage pre saleThe first phase Presale phasewhich last six monthsDuring round 5 total volume sold outThen number token available purchase pre sale period fluctuates according following formula Monthly demand x 5 Savings supply monthly supply important remember supply month always le equal demand previous monthThis done encourage people keep investment rather selling soon Santa arrives discussing thisit show commitment designer Santa CoinIt certainly contributes growth moneyGifts exchanged Binance people start trading immediately earn money even keep itso worry keeping currenciesIt based Binance’s Pegged USD fluctuate price primary objective Santa Coin provide user computerized ownership playtoacquire Santa Sport Santa F1 Sport Games create worldview gamePlayers collect Santa token via blockchain allowed interested playprocurement game framework central sport resource Santa F1 used sold player way actual game Features Santa Coin 1 pause system high variance fair intervention sanction structure 2 Existence liquidity pool 3 point make multiple purchase 4 Directness 5 Public approval trust 6 Proficiency timeliness staff useful able reap benefit effective project among innovative crypto platformsThe world always reward bestSo wise make opportunityThank … Santacoin BSC Binancechain BTC Cz Shiba evergrow cryptomoonshots busd cryptosantax binance christmas bitcoin Details Buy Santa Coins Visit Website Twitter Telegram Announcement AUTHOR Forum Username Ndkroxxx Forum Profile Link httpsbitcointalkorgindexphpactionprofileu3373106 Telegram Username Hyper009 BEP20 Wallet Address 0x8af202823e95845E418ece83A1E57eD95eeD4a74Tags Bsc Binance Chain Christmas Bitcoin

#YearnNFT Finance Presale is Running!

#YearnNFT Finance Presale is Running! Hello Friends Biggest YearnNFT Presale Is Live Now ! YearnNFT is all new BSC based NFT marketplace to trace and mint NFT’s with ease. Hurry Up! Buy #YFNFT from YearnNFT Finance up things to make it 300X #YFNFT to moon 🚀🚀 Lowest Supply : 73332 Presale Live : https://yearnnft.finance/Presale 🔔 𝐓𝐨𝐤𝐞𝐧𝐨𝐦𝐢𝐜𝐬 𝐚𝐧𝐝 𝐃𝐢𝐬𝐭𝐫𝐢𝐛𝐮𝐭𝐢𝐨𝐧 🔔 Token Name: YearnNFT Symbol : YFNFT Network : Binance Smart Chain(BSC) Features : Digital Art🌄 NFT, Governance, Fees, Rewards , Payments and Trade Presale link : https://yearnnft.finance/Presale 𝐃𝐢𝐬𝐭𝐫𝐢𝐛𝐮𝐭𝐢𝐨𝐧 Total Supply : 73332 YFNFT Available Supply : 73332 YFNFT Presale : 40% ( 29332.8) Liquidity : 35% ( 25666.20 ) Registration Bounty 4% ( 2933.28) Referral Bounty 4% ( 2933.28) Listing : After Presale #Pancakeswap & #Apeswap $YFNFT is a #BSC Based #NFT Marketplace Powered by YearnNFT , the low Supply Token. Website : https://yearnnft.finance/ Follow us on twitter : https://twitter.com/YearnNft Telegram : https://t.me/YearnNFT Medium: https://medium.com/@yearnnft Reddit : https://www.reddit.com/user/YearnNFT/ #YearnNFT #Bsc #Bnb #Binance #BSCGems #NFT

https://medium.com/@zaynalewis01/yearnnft-finance-presale-is-running-829abad2fb17

[]

2021-12-18 05:37:48.640000+00:00

['Nft', 'Bnb', 'Bsc', 'Binance']

Title YearnNFT Finance Presale RunningContent YearnNFT Finance Presale Running Hello Friends Biggest YearnNFT Presale Live YearnNFT new BSC based NFT marketplace trace mint NFT’s ease Hurry Buy YFNFT YearnNFT Finance thing make 300X YFNFT moon 🚀🚀 Lowest Supply 73332 Presale Live httpsyearnnftfinancePresale 🔔 𝐓𝐨𝐤𝐞𝐧𝐨𝐦𝐢𝐜𝐬 𝐚𝐧𝐝 𝐃𝐢𝐬𝐭𝐫𝐢𝐛𝐮𝐭𝐢𝐨𝐧 🔔 Token Name YearnNFT Symbol YFNFT Network Binance Smart ChainBSC Features Digital Art🌄 NFT Governance Fees Rewards Payments Trade Presale link httpsyearnnftfinancePresale 𝐃𝐢𝐬𝐭𝐫𝐢𝐛𝐮𝐭𝐢𝐨𝐧 Total Supply 73332 YFNFT Available Supply 73332 YFNFT Presale 40 293328 Liquidity 35 2566620 Registration Bounty 4 293328 Referral Bounty 4 293328 Listing Presale Pancakeswap Apeswap YFNFT BSC Based NFT Marketplace Powered YearnNFT low Supply Token Website httpsyearnnftfinance Follow u twitter httpstwittercomYearnNft Telegram httpstmeYearnNFT Medium httpsmediumcomyearnnft Reddit httpswwwredditcomuserYearnNFT YearnNFT Bsc Bnb Binance BSCGems NFTTags Nft Bnb Bsc Binance

PROPEL TOKEN

PROPEL TOKEN INTRODUCTION:- Hello everyone, how are you? If you are interested in joining the project PayRue you should read the information that will help you get information that can help you in seeing your vision and mission #crypto #bitcoin #cryptocurrency #blockchain #foxcampaigns #btc #nft #nftart #digitalart #cryptoart #nftartist #crypto #nfts #ethereum #nftcommunity #nftcollector #propel #payrue #pump #cryptopumps Lately we have witnessed a recurring trend in blockchain where individuals and organizations are pooling resources to create, renovate or simply replicate existing technologies to produce something new in the form of applications/dapps with which users can manage their digital assets easily. good while at the same time saving them from the stress and sometimes frustration of dealing with conventional financial institutions (like banks). And this is where Payrue comes in. What is Payrue? PayRue, a fully functional, fully decentralized platform with a focus on financial services through exchange operations, financial wallets, payments and transfers of cryptocurrencies with the aim of creating a secure means for Cryptocurrency usage and adoption through a simple and easy-to-use application. One single platform for all secure financial services, PayRue offers its users the opportunity to use a unique decentralized exchange for trading- PROPEL DEX, the platform also offers a cryptocurrency wallet, the ability to make and receive payments using its mobile application (Android and IOS), web version and great liquidity features- Purchase of cryptocurrencies using a debit card. PayRue owns a native token called “Propel” which is on the Stellar Blockchain and has submitted a proposal for a listing on Binance Dex which will reduce the migration of Propel Coin to Binance Chain. PayRue is a working platform and has been able to achieve all this without an IEO, ICO or any form of fundraising. Payrue Wallet App Features : Purse Payrue is a wallet in its own right, and allows users to securely store move tokens and other cryptocurrencies until they need them to be used. The wallet supports multiple currencies from different blockchains and offers an SMS notification service that alerts users on every transaction in their account. The image above is a glimpse of the payrue wallet. Exchange The Payrue project operates two exchanges namely: Propel DEX and Payrue DEX . Both are hybrid exchanges with decentralized wallets (meaning they use extensions like meta masks), but with a centralized order book. However, while Payrue DEX is built on the Ethereum Blockchain, Propel DEX is set on a stellar Blockchain network. The exchange allows users to exchange virtual currencies with each other at any time. Salary Invoice Another unique feature of the Payrue app is Payrue's invoicing service. This feature is very useful for freelancers. Pay Invoice is an invoicing service that allows freelancers everywhere to receive payments in cryptocurrency for work done. Without a doubt, this feature was implemented to bring about mass adoption of cryptocurrency which is the core mission of the project. This will save freelancers looking to earn cryptocurrency from the stress of having to manually convert their fiat income to crypto. PayRue Wallet PayRue Wallet is your digital asset wallet for transfers, swaps, staking and NFT collections With PayRue Wallet you control your private keys, easy access to transfer and exchange multiple blockchains and manage multiple tokens easily right from your phone. Multichain Wallet Binance Smart Chain Ethereum Polygon Phantom Avalanche Your own wallet for Crypto and NFT: Trade any token on BSC, Ethereum and Polygon right from your phone Bring Your NFT Collection Closer Control your own private key PayRue Exchanges & Wallets PayRue Wallet is a multi-chain wallet Manage your wallet Instant Swap right from your phone NFT Wallet Connect with NFT Marketplaces Hold any NFT in your wallet Exchange NFT using WalletConnect PROPEL TOKENOMICS The propel token has a total supply of 10 billion. Of this amount, 50% (5 billion) is allocated for distribution to users at various points through registration, gifts, referrals, etc. 15% (1.5 billion) will be shared among project team members, while 35% (3.5 billion) will be reserved by the team for the general growth of the project in the future as well as for partnerships. Payrue does not have an ICO/IEO, but raises funds through crunchbase for its projects. The tokens are mostly provided free of charge to users upon registration/verification as well as through referrals. The project is currently distributing 2000 propel to every verified user on their mobile app. Yes, that means you can pick up your 2000 drive now that you have downloaded and registered on their mobile app, and successfully completed the kyc verification. The mobile app can be found in the playstore as shown in the screenshot above. Payrue has also scheduled a token burning event that will occur every first day of every quarter of the year. Token Name and Symbol: Propel Total supply: 10 billion Stellar Blockchain Explorer Link: https://stellar.expert/explorer/public/asset/Propel-GAQ66FKC4YLWZEA2TWMKFB5I44ICSPOHEULJB7BLIOCGPDYEFSUZIORO?filter=asset-holders&order=desc Conclusion PayRue is on a mission to drive cryptocurrency adoption and become a leading crypto payment gateway, what could be more glorious than that? And with its functional financial features; operational wallets, decentralized exchanges, payments, all this without external financial assistance and fundraising make PayRue a great platform. For More Information:- Website: https://payrue.com/ Twitter : https://twitter.com/pay_rue Facebook : https://www.facebook.com/payrue Telegram : https://t.me/payrue_global Instagram : https://www.instagram.com/payrueofficial Reddit: https://www.reddit.com/user/payrue Payrue Wallet : https://wallet.payrue.com/ Coinmarketcap : https://coinmarketcap.com/currencies/payrue-propel/ AUTHOR:- Bitcointalk Username: @shiva Bitcointalk Profile Link: https://bitcointalk.org/index.php?action=profile;u=2015378 POA Link: https://bitcointalk.org/index.php?topic=5375402.msg58629440#msg58629440 Telegram Username: @shivamaster123 People Address: 0x34955a14b32c4d0c57d22655a5b8e4087a44a84b

https://medium.com/@shivagautam307/propel-token-d750add4be24

['Shiva Gautam']

2021-12-26 17:23:28.987000+00:00

['Nft', 'Crypto', 'Pump', 'Bsc']

Title PROPEL TOKENContent PROPEL TOKEN INTRODUCTION Hello everyone interested joining project PayRue read information help get information help seeing vision mission crypto bitcoin cryptocurrency blockchain foxcampaigns btc nft nftart digitalart cryptoart nftartist crypto nfts ethereum nftcommunity nftcollector propel payrue pump cryptopumps Lately witnessed recurring trend blockchain individual organization pooling resource create renovate simply replicate existing technology produce something new form applicationsdapps user manage digital asset easily good time saving stress sometimes frustration dealing conventional financial institution like bank Payrue come Payrue PayRue fully functional fully decentralized platform focus financial service exchange operation financial wallet payment transfer cryptocurrencies aim creating secure mean Cryptocurrency usage adoption simple easytouse application One single platform secure financial service PayRue offer user opportunity use unique decentralized exchange trading PROPEL DEX platform also offer cryptocurrency wallet ability make receive payment using mobile application Android IOS web version great liquidity feature Purchase cryptocurrencies using debit card PayRue owns native token called “Propel” Stellar Blockchain submitted proposal listing Binance Dex reduce migration Propel Coin Binance Chain PayRue working platform able achieve without IEO ICO form fundraising Payrue Wallet App Features Purse Payrue wallet right allows user securely store move token cryptocurrencies need used wallet support multiple currency different blockchains offer SMS notification service alert user every transaction account image glimpse payrue wallet Exchange Payrue project operates two exchange namely Propel DEX Payrue DEX hybrid exchange decentralized wallet meaning use extension like meta mask centralized order book However Payrue DEX built Ethereum Blockchain Propel DEX set stellar Blockchain network exchange allows user exchange virtual currency time Salary Invoice Another unique feature Payrue app Payrues invoicing service feature useful freelancer Pay Invoice invoicing service allows freelancer everywhere receive payment cryptocurrency work done Without doubt feature implemented bring mass adoption cryptocurrency core mission project save freelancer looking earn cryptocurrency stress manually convert fiat income crypto PayRue Wallet PayRue Wallet digital asset wallet transfer swap staking NFT collection PayRue Wallet control private key easy access transfer exchange multiple blockchains manage multiple token easily right phone Multichain Wallet Binance Smart Chain Ethereum Polygon Phantom Avalanche wallet Crypto NFT Trade token BSC Ethereum Polygon right phone Bring NFT Collection Closer Control private key PayRue Exchanges Wallets PayRue Wallet multichain wallet Manage wallet Instant Swap right phone NFT Wallet Connect NFT Marketplaces Hold NFT wallet Exchange NFT using WalletConnect PROPEL TOKENOMICS propel token total supply 10 billion amount 50 5 billion allocated distribution user various point registration gift referral etc 15 15 billion shared among project team member 35 35 billion reserved team general growth project future well partnership Payrue ICOIEO raise fund crunchbase project token mostly provided free charge user upon registrationverification well referral project currently distributing 2000 propel every verified user mobile app Yes mean pick 2000 drive downloaded registered mobile app successfully completed kyc verification mobile app found playstore shown screenshot Payrue also scheduled token burning event occur every first day every quarter year Token Name Symbol Propel Total supply 10 billion Stellar Blockchain Explorer Link httpsstellarexpertexplorerpublicassetPropelGAQ66FKC4YLWZEA2TWMKFB5I44ICSPOHEULJB7BLIOCGPDYEFSUZIOROfilterassetholdersorderdesc Conclusion PayRue mission drive cryptocurrency adoption become leading crypto payment gateway could glorious functional financial feature operational wallet decentralized exchange payment without external financial assistance fundraising make PayRue great platform Information Website httpspayruecom Twitter httpstwittercompayrue Facebook httpswwwfacebookcompayrue Telegram httpstmepayrueglobal Instagram httpswwwinstagramcompayrueofficial Reddit httpswwwredditcomuserpayrue Payrue Wallet httpswalletpayruecom Coinmarketcap httpscoinmarketcapcomcurrenciespayruepropel AUTHOR Bitcointalk Username shiva Bitcointalk Profile Link httpsbitcointalkorgindexphpactionprofileu2015378 POA Link httpsbitcointalkorgindexphptopic5375402msg58629440msg58629440 Telegram Username shivamaster123 People Address 0x34955a14b32c4d0c57d22655a5b8e4087a44a84bTags Nft Crypto Pump Bsc

INTRODUCING THE BLOCK MINE GOLDBAR ERA

INTRODUCING THE BLOCK MINE GOLDBAR ERA Howdy miners, we hope you had a relaxing Christmas, because now it’s time to go back to the mines and dig for precious $GOLDNUGGETs again! ⚒️ We have TONS OF NEW FEATURES that we are proud to present to you, so read carefully! UNLOCKED $GOLDBAR Thanks to our innovative Token Evolution, miners have been refining since three months their hard earned $GOLDNUGGETs into $GOLDCOIN and $GOLDBAR. Today is finally the day where the Booster is finally unlocked and Miners are rewarded for their patience!🎉 The first $GOLDBAR utility is for fee reduction on our upcoming #WildWestVerse game.📜 Hold’em and you get neat discounts in the #Saloon!🎲 More on that in the upcoming weeks! In the meantime, stake your $GOLDBARs so you can start with a bigger purse in the next year!💰 NEW $GOLDBAR POOLS & MINE $GOLDBAR will be the new main token regarding all staking utilities in our beloved Blockmine. We are going to gradually phase out $GOLDNUGGET pools and replace them with $GOLDBAR pools. That means more incentive to boost your $GOLDNUGGET, more incentive to hold your $GOLDBAR, more profit for YOU!🏅 These are the new $GOLDBAR pools which are going live today: NEVADA POOL: STAKE $GOLDBAR — EARN $NEVADA GMR POOL: STAKE $GOLDBAR — EARN $GMR KOALA DEFI POOLS: STAKE $GOLDBAR — EARN $NALIS STAKE $LYPTUS -EARN $GOLDCOIN (POOL ON KOALA) The staking limit will be 25 $GOLDBAR per pool. Additionally, we add a new $GOLDBAR — $GOLDNUGGET mine, another safe liquidity mining option for our impatient cowboys! Do the maths, and a shiny future is ahead of you⛏ And don’t worry: $GOLDBAR CAN BE BOUGHT WITH $GOLDNUGGET ONLY❗️ $GOLDNUGGET are not sold, but bought when buying $GOLDBAR and then stored in the GN/GB pool. NEW PARTNERSHIP WITH KNIGHTSWAP KnightSwap is the preeminent decentralized exchange (DEX) on Binance Smart Chain (BSC) built for reliable & sustainable yields while providing the highest quality Decentralized Finance(DeFi) experience.⚔️ For now, our first step in our new partnership is setting up new pools: STAKE KNIGHT — EARN $GOLDNUGGET (POOL ON KNIGHTSWAP) STAKE $GOLDBAR — EARN $KNIGHT (POOL ON BLOCKMINE) BUYBACK UPDATE — NEW BTC POOL We discussed the buyback heavily in our team and are of the opinion that we want to do something for $GOLDNUGGETs, but at the same time we want to increase the incentive to hold $GOLDBAR even more! We have decided that we will set up 50% of the buyback as a wBTC pool, which we believe is much more effective than a simple buyback! STAKE $GOLDBAR — EARN $wBTC The staking limit will be 10 $GOLDBAR for the wBTC pool. Regarding the other 50%…we will buy up $GOLDNUGGETs and burn them forever!🔥 We wish every cowboy a profitable last week in 2021, so that we can start fresh into the WildWestVerse in 2022, with many $GOLDNUGGETS in your bags! More updates will follow in the next two weeks! Thank you everyone for staying in BLOCKMINE this year. And as always: The moon shines bright on the mines tonight🌙

https://medium.com/@blockmine/introducing-the-blockmine-goldbar-era-e4a9aadb28bb

[]

2021-12-26 18:25:04.357000+00:00

['Cryptocurrency', 'Bsc', 'Nft', 'Liquidity Mining', 'Binance Smart Chain']

Title INTRODUCING BLOCK MINE GOLDBAR ERAContent INTRODUCING BLOCK MINE GOLDBAR ERA Howdy miner hope relaxing Christmas it’s time go back mine dig precious GOLDNUGGETs ⚒️ TONS NEW FEATURES proud present read carefully UNLOCKED GOLDBAR Thanks innovative Token Evolution miner refining since three month hard earned GOLDNUGGETs GOLDCOIN GOLDBAR Today finally day Booster finally unlocked Miners rewarded patience🎉 first GOLDBAR utility fee reduction upcoming WildWestVerse game📜 Hold’em get neat discount Saloon🎲 upcoming week meantime stake GOLDBARs start bigger purse next year💰 NEW GOLDBAR POOLS MINE GOLDBAR new main token regarding staking utility beloved Blockmine going gradually phase GOLDNUGGET pool replace GOLDBAR pool mean incentive boost GOLDNUGGET incentive hold GOLDBAR profit YOU🏅 new GOLDBAR pool going live today NEVADA POOL STAKE GOLDBAR — EARN NEVADA GMR POOL STAKE GOLDBAR — EARN GMR KOALA DEFI POOLS STAKE GOLDBAR — EARN NALIS STAKE LYPTUS EARN GOLDCOIN POOL KOALA staking limit 25 GOLDBAR per pool Additionally add new GOLDBAR — GOLDNUGGET mine another safe liquidity mining option impatient cowboy math shiny future ahead you⛏ don’t worry GOLDBAR BOUGHT GOLDNUGGET ONLY❗️ GOLDNUGGET sold bought buying GOLDBAR stored GNGB pool NEW PARTNERSHIP KNIGHTSWAP KnightSwap preeminent decentralized exchange DEX Binance Smart Chain BSC built reliable sustainable yield providing highest quality Decentralized FinanceDeFi experience⚔️ first step new partnership setting new pool STAKE KNIGHT — EARN GOLDNUGGET POOL KNIGHTSWAP STAKE GOLDBAR — EARN KNIGHT POOL BLOCKMINE BUYBACK UPDATE — NEW BTC POOL discussed buyback heavily team opinion want something GOLDNUGGETs time want increase incentive hold GOLDBAR even decided set 50 buyback wBTC pool believe much effective simple buyback STAKE GOLDBAR — EARN wBTC staking limit 10 GOLDBAR wBTC pool Regarding 50…we buy GOLDNUGGETs burn forever🔥 wish every cowboy profitable last week 2021 start fresh WildWestVerse 2022 many GOLDNUGGETS bag update follow next two week Thank everyone staying BLOCKMINE year always moon shine bright mine tonight🌙Tags Cryptocurrency Bsc Nft Liquidity Mining Binance Smart Chain

pump swap exchange

#pumswap #pum #cryptocurrency #presale #ico INTRODUCTION But before going any further, I want to tell you first about Cryptoqurrency or Blockchain Technology. Cryptocurrency was originally known as a payment system that allows people to be able to make transactions quickly, without third parties, transparently, securely, and anonymously. Satoshi who is the creator of Bitcoin, makes Bitcoin beat the centralized financial system that is prone to manipulation and controlled by one party. With the growth and development of the Crypto or blockchain ecosystem, a number of alternative investment options have emerged, and have proven to be more efficient and profitable investment tools than traditional financial returns. Innovative projects are consistently emerging in the crypto industry with high return investments and continuous trends, such as PUM SWAP.is one of the projects that will attract large market investments. So, don’t waste this golden opportunity. What is a PUMP SWAP? PumSwap is a decentralized exchange or DEX created for swapping BEP20 tokens on the Binance Smart Chain, ERC20 tokens on Ethereum with KIP20 tokens on the OkexChain Network. PumSwap is a decentralized exchange or DEX created for swapping BEP20 tokens on the Binance Smart Chain, ERC20 tokens on Ethereum with KIP20 tokens on the OkexChain Network. PumSwap is the perfect ecosystem for automated liquidity that is provisioned in the Binance Smart Chain, Ethereum & OkexChain Network where users can trade against a liquidity pool. PumSwap is a DEX Exchanger with 3 Different Type Of Blockchain Binance Smart Chain, Ethereum & OkexChain Network PumSwap Exchange Upcoming events for all community. We will release airdrop bounty events for our PumSwap community. PumSwap upcoming events is… Evens Testnet Airdrop Mainnet Airdrop Pre-Sale Bounty Campaign More Stay connected on Telegram Testnet Airdrop PumSwap Testnet airdrop for pre-sale testing. If you join PumSwap ttestnet airdrop you will get PumSwap Mainnet tokens. Testnet Airdrop Will Be Live On 15 Oct 2021. All the step here Mainnet Airdrop After the end of testnet airdrop we will release PumSwap mainnet airdrop event for PumSwaper. All airdrop token based on Binance smart chain. PumSwap exchanger have three different type of network for dex trading will be live. You can trade mainnet $PUM tokens in our own dex with others DEX/CEX. Mainnet airdrop can join PumSwap all members. Pre-Sale PumSwap Pre-Sale will be live after the testnet airdrop ends. Mainnet Pre-Sale sttartt from 27 Oct 2021. Mainnet Token you can transfer & use this token for trade or swap. Mainnet Token will be live on our own DEX & others decentralized/centralized exchangers. Mainnet Pre-Sale Starting Date: (27 October 2021) Mainnet Pre-Sale Token price is 1 PUM = 0.00005 BNB Mainnet Pre-Sale will be live for: 30 Days Bonus For Mainnet Pre-Sale Investors Investors of presale who had bought minimum amount of 1 BNB will be enlisted to drawing list.Total $10,000 USDT reword pool. Take snapshote for 3 winner randomly.Winners will be announced 3 working days after the pre-sale ends. First Winner: $5000 USDT Second Winner: $3000 USDT Third Winner: $2000 USDT Bounty Campaign PumSwap Bounty Campaign will be live after the ends of Testnet Airdrop Event. Stay connected on Telegram More Events Will Be Launch Soon… Pre Sale The Mainnet Pre-Sale Price Is 1 PUM = 0.00005 BNB 1 BNB = 20,000 PUM Mainnet Pre-Sale Starting Date: (27 October 2021) Mainnet Pre-Sale Token price is 1 PUM = 0.00005 BNB Mainnet Pre-Sale will be live for: 30 Days Bonus For Mainnet Pre-Sale Investors: Investors of presale who had bought minimum amount of 1 BNB will be enlisted to drawing list.Total $10,000 USDT reward pool. Take snapshote for 3 winner randomly.Winners will be announced 3 working days after the pre-sale ends. Pumswap staking platform is live now. You can stake your PUM tokens into pumswap staking platform. Now, you can earn passive income every day by staked your PUM tokens. Stake your PUM in here: https://app.pumswap.finance Happy trading/staking.... PumSwap (PUM) Token: Smart Contract: 0x11608EDd16091f296F12D362cB8756655C7FA986 Presale Contract: 0x25954aa2C327D2358dC3dA7156D57Dd7B9519f3C For more information about pump swap project: Web: https://pumswap.org Telegram: https://t.me/pumswap Telegram Announcement: https://t.me/pumswapannouncement Twitter: https://twitter.com/Pumswap_ Facebook: https://www.facebook.com/PumSwap Reddit: https://www.reddit.com/user/PumSwap Linkedin: https://www.linkedin.com/company/pumswap Medium: https://pumswap.medium.com Author Bitcointalk username: Arie07 Bitcointalk profile: https://bitcointalk.org/index.php?action=profile;u=2346804 Bep-20 wallet address: 0x1EA625cC96682BAB3855820cd871b41B81cb7e78

https://medium.com/@rezaateng27/pump-swap-exchange-2580a0682383

[]

2021-12-18 17:02:20.136000+00:00

['Bitcoin', 'Blockchain', 'Cryptocurrency', 'Bsc', 'ICO']

Title pump swap exchangeContent pumswap pum cryptocurrency presale ico INTRODUCTION going want tell first Cryptoqurrency Blockchain Technology Cryptocurrency originally known payment system allows people able make transaction quickly without third party transparently securely anonymously Satoshi creator Bitcoin make Bitcoin beat centralized financial system prone manipulation controlled one party growth development Crypto blockchain ecosystem number alternative investment option emerged proven efficient profitable investment tool traditional financial return Innovative project consistently emerging crypto industry high return investment continuous trend PUM SWAPis one project attract large market investment don’t waste golden opportunity PUMP SWAP PumSwap decentralized exchange DEX created swapping BEP20 token Binance Smart Chain ERC20 token Ethereum KIP20 token OkexChain Network PumSwap decentralized exchange DEX created swapping BEP20 token Binance Smart Chain ERC20 token Ethereum KIP20 token OkexChain Network PumSwap perfect ecosystem automated liquidity provisioned Binance Smart Chain Ethereum OkexChain Network user trade liquidity pool PumSwap DEX Exchanger 3 Different Type Blockchain Binance Smart Chain Ethereum OkexChain Network PumSwap Exchange Upcoming event community release airdrop bounty event PumSwap community PumSwap upcoming event is… Evens Testnet Airdrop Mainnet Airdrop PreSale Bounty Campaign Stay connected Telegram Testnet Airdrop PumSwap Testnet airdrop presale testing join PumSwap ttestnet airdrop get PumSwap Mainnet token Testnet Airdrop Live 15 Oct 2021 step Mainnet Airdrop end testnet airdrop release PumSwap mainnet airdrop event PumSwaper airdrop token based Binance smart chain PumSwap exchanger three different type network dex trading live trade mainnet PUM token dex others DEXCEX Mainnet airdrop join PumSwap member PreSale PumSwap PreSale live testnet airdrop end Mainnet PreSale sttartt 27 Oct 2021 Mainnet Token transfer use token trade swap Mainnet Token live DEX others decentralizedcentralized exchanger Mainnet PreSale Starting Date 27 October 2021 Mainnet PreSale Token price 1 PUM 000005 BNB Mainnet PreSale live 30 Days Bonus Mainnet PreSale Investors Investors presale bought minimum amount 1 BNB enlisted drawing listTotal 10000 USDT reword pool Take snapshote 3 winner randomlyWinners announced 3 working day presale end First Winner 5000 USDT Second Winner 3000 USDT Third Winner 2000 USDT Bounty Campaign PumSwap Bounty Campaign live end Testnet Airdrop Event Stay connected Telegram Events Launch Soon… Pre Sale Mainnet PreSale Price 1 PUM 000005 BNB 1 BNB 20000 PUM Mainnet PreSale Starting Date 27 October 2021 Mainnet PreSale Token price 1 PUM 000005 BNB Mainnet PreSale live 30 Days Bonus Mainnet PreSale Investors Investors presale bought minimum amount 1 BNB enlisted drawing listTotal 10000 USDT reward pool Take snapshote 3 winner randomlyWinners announced 3 working day presale end Pumswap staking platform live stake PUM token pumswap staking platform earn passive income every day staked PUM token Stake PUM httpsapppumswapfinance Happy tradingstaking PumSwap PUM Token Smart Contract 0x11608EDd16091f296F12D362cB8756655C7FA986 Presale Contract 0x25954aa2C327D2358dC3dA7156D57Dd7B9519f3C information pump swap project Web httpspumswaporg Telegram httpstmepumswap Telegram Announcement httpstmepumswapannouncement Twitter httpstwittercomPumswap Facebook httpswwwfacebookcomPumSwap Reddit httpswwwredditcomuserPumSwap Linkedin httpswwwlinkedincomcompanypumswap Medium httpspumswapmediumcom Author Bitcointalk username Arie07 Bitcointalk profile httpsbitcointalkorgindexphpactionprofileu2346804 Bep20 wallet address 0x1EA625cC96682BAB3855820cd871b41B81cb7e78Tags Bitcoin Blockchain Cryptocurrency Bsc ICO

How To Buy SANIC

How To Buy SANIC SANIC #SanicHegehog We see a lot of people having issues trying to purchase SANIC. Here are some basic instructions on how to purchase Sanic on Pancake swap. Step 1 First you must download the app metamask to your computer or phone. Once installed, set up your wallet and continue to the next step. Step 2 SANIC/BNB In MetaMask : settings -> networks -> add network Type in following data: Network Name: Binance Smart Chain New RPC URL: https://bsc-dataseed.binance.org Chain ID: 56 Symbol (optional): BNB Block Explorer URL (optional): https://bscscan.com Click save Select Binance Smart Chain as the network in the drop-down menu in the main metamask interface Send BNB to your wallet using binance global or binance.us Use the BNB to trade on a BSCDEX such as : https://exchange.pancakeswap.finance If you are having trouble connecting to your wallet using pancake swap, access pancake swap using the metamask browser and connect to your wallet within the metamask browser. Just input this link into the metamask browser to swap bnb for SANIC Before buying anything, your going to want to add the custom token SANIC to your wallet. Go into your metamask wallet and select add token. Then copy and paste the contract address from BSCscan into the add token address field. Here is the contract address if you can not find it. The token symbol section should fill automatically when done correctly. Leave slippage on 0.1% or change it to 1%. Click swap. https://bscscan.com/token/0xdae16522f6a4f8d0cc9b1b6c14055b9a7fe8ec73 Contract: 0xdae16522f6a4f8d0cc9b1b6c14055b9a7fe8ec73 Congrats, you now have SANIC token! Fastest token on #BSC 🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥

https://medium.com/@santarickinfo/how-to-buy-sanic-c3b969017f5

['Marco S']

2021-12-21 18:37:31.897000+00:00

['Crypto', 'Bnb', 'Bscgem', 'Bsc', 'Shiba Inu']

Title Buy SANICContent Buy SANIC SANIC SanicHegehog see lot people issue trying purchase SANIC basic instruction purchase Sanic Pancake swap Step 1 First must download app metamask computer phone installed set wallet continue next step Step 2 SANICBNB MetaMask setting network add network Type following data Network Name Binance Smart Chain New RPC URL httpsbscdataseedbinanceorg Chain ID 56 Symbol optional BNB Block Explorer URL optional httpsbscscancom Click save Select Binance Smart Chain network dropdown menu main metamask interface Send BNB wallet using binance global binanceus Use BNB trade BSCDEX httpsexchangepancakeswapfinance trouble connecting wallet using pancake swap access pancake swap using metamask browser connect wallet within metamask browser input link metamask browser swap bnb SANIC buying anything going want add custom token SANIC wallet Go metamask wallet select add token copy paste contract address BSCscan add token address field contract address find token symbol section fill automatically done correctly Leave slippage 01 change 1 Click swap httpsbscscancomtoken0xdae16522f6a4f8d0cc9b1b6c14055b9a7fe8ec73 Contract 0xdae16522f6a4f8d0cc9b1b6c14055b9a7fe8ec73 Congrats SANIC token Fastest token BSC 🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥🔥Tags Crypto Bnb Bscgem Bsc Shiba Inu

vBABY: Your Crypto Membership

Fella babies! Haven’t seen you in a long time! We’ve been really busy working with The Crypto You and other games and features, but we would never forget about vBABY! Feeling like this is a great New Year’s gift to our dearest holders! What’s vBABY vBABY is the VIP membership of BabySwap, which earns more benefits for users. How to get vBABY? vBABY is minted by BABY in the ratio of 100:1. You can get as many vBABY as you want. vBABY Membership Rewards Share vBABY: Each block produces 2 BABY, which will be distributed to vBABY holders in vBABY as rewards Trading fee: 0.025% of the user’s trading volume will be distributed to vBABY holders in vBABY as rewards NFT market trading fee: 2% of the NFT market trading volume will be distributed to vBABY holders in vBABY as rewards vBABY redeem fee: 50% of vBABY redeem fees will be distributed to vBABY holders in vBABY as rewards Referral reward: Invite your friends to get 10% vBABY minted by users. If your invited friend uses 100 BABY to mint 1 vBABY, he/she will get 1 vBABY, and you will get 0.1 vBABY at the same time. If you leave the referral blank, you will be bonded to the protocol address automatically. Please note that vBABY in the protocol address CANNOT be redeemed to BABY Hint: There’s a 10% redeem fee for users who redeem vBABY to BABY again. 50% will be allocated to vBABY holders as mentioned above, 30% will be burnt, and 20% will go to the treasury. Tokenomic Upgrade The daily emission will still be 576,000 BABY. Since we are going to add vBABY feature, the allocation will be slightly changed. Trade Mining — 30% Yield Farm — 40% Snack Pool — 20% vBABY — 10% Be ready to enjoy your 10% vBABY daily emission. vBABY will be online on Dec 28th UTC. The exact time will be announced soon. See you in vBABY. Lemme see your membership shining. Principal’s Note 🍼Twitter 🍼Telegram 🍼Discord 🍼Docs

https://medium.com/@babyswap/vbaby-your-crypto-membership-85e40dff10a4

[]

2021-12-27 14:32:30.578000+00:00

['Babyswap', 'Binance', 'Binance Smart Chain', 'Bsc', 'Metaverse']

Title vBABY Crypto MembershipContent Fella baby Haven’t seen long time We’ve really busy working Crypto game feature would never forget vBABY Feeling like great New Year’s gift dearest holder What’s vBABY vBABY VIP membership BabySwap earns benefit user get vBABY vBABY minted BABY ratio 1001 get many vBABY want vBABY Membership Rewards Share vBABY block produce 2 BABY distributed vBABY holder vBABY reward Trading fee 0025 user’s trading volume distributed vBABY holder vBABY reward NFT market trading fee 2 NFT market trading volume distributed vBABY holder vBABY reward vBABY redeem fee 50 vBABY redeem fee distributed vBABY holder vBABY reward Referral reward Invite friend get 10 vBABY minted user invited friend us 100 BABY mint 1 vBABY heshe get 1 vBABY get 01 vBABY time leave referral blank bonded protocol address automatically Please note vBABY protocol address CANNOT redeemed BABY Hint There’s 10 redeem fee user redeem vBABY BABY 50 allocated vBABY holder mentioned 30 burnt 20 go treasury Tokenomic Upgrade daily emission still 576000 BABY Since going add vBABY feature allocation slightly changed Trade Mining — 30 Yield Farm — 40 Snack Pool — 20 vBABY — 10 ready enjoy 10 vBABY daily emission vBABY online Dec 28th UTC exact time announced soon See vBABY Lemme see membership shining Principal’s Note 🍼Twitter 🍼Telegram 🍼Discord 🍼DocsTags Babyswap Binance Binance Smart Chain Bsc Metaverse

Whitelist instruction of Stay in Destiny World IDO on Enjin Starter

We’re super excited to announce our next IDO is on Enjin Starter (21st December, 2021). Here’s a complete and simple guide to participating in $SIW IDO on Enjin Starter— the forth launchpad in our series of 5 IDO platforms. $SIW Token Metrics Initial market cap excluding liquidity: $328,500 IDO: $0.06 (30% at Listing, then 17,5% vesting on 4 months) Details of tokenomics can be found on slide 24 of the Whitepaper HERE. Details about $SIW IDO on Enjin Starter Chain: Binance Smart Chain Date: December 21st, 2021 Price per token: $0.06 (30% at Listing, then 17,5% vesting on 4 months) Total allocation: $100.000 How to join the IDO Whitelist? First, you’ll need to Register & KYC to be qualified for IDOs on Enjin Starter platform. 📝 Register & KYC: click here 🔍 Check Your KYC Status: click here At Enjin Starter, there are 2 ways to buy IDO tokens: Community Pool and Guaranteed Pool Community Allocation Pool (CAP): The Community Allocation pool is limited to only the first come first serve (FCFS) pool. The minimum amount of $EJS you need to hold is 1250 EJS. Your allocation for the FCFS will depend on your Token Boost and Time Boost (this means the more EJS you hold and the longer you hold it, you will be rewarded with a larger FCFS allocation) GUARANTEED ALLOCATION POOL (GAP): The Guaranteed Allocation Pool obviously gives you a guaranteed allocation but this is determined by which Tier you are in, how much $EJS you hold (compared to the other wallets in your Tier; i.e. the Token Boost and how long you have been holding the same or more number of $EJS in your wallet; i.e. the Time Boost). Can also take part in FCFS Rounds for community. There are 3 tiers in the GAP as follow: More details can be found here. How to buy $SIW IDO on Enjin Starter? 1️⃣ Go to launchpad.enjinstarter.com to view the live IDOs in the Active Projects section. 2️⃣ On Active Projects, click “Learn More” on Stay in Destiny World. You’ll find relevant information on $SIW + countdown clock top right of your screen. 3️⃣ Sale will be active once countdown hits Zero. Click “Participate” once countdown runs out. 4️⃣ Connect your Metamask wallet. Ensure you use the wallet that was whitelisted to us. 5️⃣ Click on the “Accounts” drop down list in your Metamask Chrome Extension and select settings. 6️⃣ Select Custom RPC and fill out the following in the form that appears: ▫️ Network Name: Binance Smart Chain ▫️ RPC URLs: https://bsc-dataseed.binance.org/ ▫️ ChainID: 56 ▫️ Symbol: BNB ▫️ Block Explorer: https://bscscan.com 7️⃣ Make sure you have enough BUSD to claim your allocations. Don’t forget BNB for gas! And that’s all for you to get ready for $SIW IDO on Enjin Starter!!! Hurry up and get a slot to join us. We’re gonna rock the whole world soon!!!!

https://medium.com/@stayindestinyworld/whitelist-instruction-of-stay-in-destiny-world-ido-on-enjin-starter-58becb193d6

[]

2021-12-18 13:00:17.084000+00:00

['Metaverse', 'Nft', 'Nft Collectibles', 'Gamefi', 'Bsc']

Title Whitelist instruction Stay Destiny World IDO Enjin StarterContent We’re super excited announce next IDO Enjin Starter 21st December 2021 Here’s complete simple guide participating SIW IDO Enjin Starter— forth launchpad series 5 IDO platform SIW Token Metrics Initial market cap excluding liquidity 328500 IDO 006 30 Listing 175 vesting 4 month Details tokenomics found slide 24 Whitepaper Details SIW IDO Enjin Starter Chain Binance Smart Chain Date December 21st 2021 Price per token 006 30 Listing 175 vesting 4 month Total allocation 100000 join IDO Whitelist First you’ll need Register KYC qualified IDOs Enjin Starter platform 📝 Register KYC click 🔍 Check KYC Status click Enjin Starter 2 way buy IDO token Community Pool Guaranteed Pool Community Allocation Pool CAP Community Allocation pool limited first come first serve FCFS pool minimum amount EJS need hold 1250 EJS allocation FCFS depend Token Boost Time Boost mean EJS hold longer hold rewarded larger FCFS allocation GUARANTEED ALLOCATION POOL GAP Guaranteed Allocation Pool obviously give guaranteed allocation determined Tier much EJS hold compared wallet Tier ie Token Boost long holding number EJS wallet ie Time Boost also take part FCFS Rounds community 3 tier GAP follow detail found buy SIW IDO Enjin Starter 1️⃣ Go launchpadenjinstartercom view live IDOs Active Projects section 2️⃣ Active Projects click “Learn More” Stay Destiny World You’ll find relevant information SIW countdown clock top right screen 3️⃣ Sale active countdown hit Zero Click “Participate” countdown run 4️⃣ Connect Metamask wallet Ensure use wallet whitelisted u 5️⃣ Click “Accounts” drop list Metamask Chrome Extension select setting 6️⃣ Select Custom RPC fill following form appears ▫️ Network Name Binance Smart Chain ▫️ RPC URLs httpsbscdataseedbinanceorg ▫️ ChainID 56 ▫️ Symbol BNB ▫️ Block Explorer httpsbscscancom 7️⃣ Make sure enough BUSD claim allocation Don’t forget BNB gas that’s get ready SIW IDO Enjin Starter Hurry get slot join u We’re gonna rock whole world soonTags Metaverse Nft Nft Collectibles Gamefi Bsc

Cryptopiece Game Pie Honey Bucket Whitelist Participate in Initial Investment Application

Cryptopiece Game Pie Honey Bucket Whitelist Participate in Initial Investment Application Join Now https://wn.nr/R8qvWx Astronaut x Cryptopiece IDO Information: 🚨Astronaut will be launching Cryptopiece on December 19th at 3PM UTC🚨 ⏰COUNTDOWN: https://countingdownto.com/?c=3972252 👉WHITELIST giveaway HERE [TBA]. You don’t need to hold NAUT if you win. This is for the whitelist round. 👉If you didn’t win a whitelist spot, you must hold 1000 NAUT to participate in Round 2 of the IDO. 💰Cryptopiece Raise Amount: $100,000 💰Max Contribution: $300 👉Minimum contribution per wallet: No minumum 👉$BELLY per BUSD (IDO): $0.005 BUSD 🦺 Vesting: Please review tokenomics and vesting in photos above. FIRST ROUND : WHITELIST ✅ALL THE WHITELIST WINNERS CAN CONTRIBUTE FROM 3:00 PM UTC TO 3:30 PM UTC. (Guaranteed allocation.) Get honey information for free that informs only good initial investment of coins. KakaoTalk : https://open.kakao.com/o/gd7nxqMd (daldal99) Twitter: https://twitter.com/feelyourlife999 Telegram: https://t.me/honeyboxcoin

https://medium.com/@feelyourlife999/cryptopiece-game-pie-honey-bucket-whitelist-participate-in-initial-investment-application-2fdac54f9386

[]

2021-12-18 01:33:49.120000+00:00

['Ido', 'Whitelist', 'Coin', 'Gamefi', 'Bsc']

Title Cryptopiece Game Pie Honey Bucket Whitelist Participate Initial Investment ApplicationContent Cryptopiece Game Pie Honey Bucket Whitelist Participate Initial Investment Application Join httpswnnrR8qvWx Astronaut x Cryptopiece IDO Information 🚨Astronaut launching Cryptopiece December 19th 3PM UTC🚨 ⏰COUNTDOWN httpscountingdowntocomc3972252 👉WHITELIST giveaway TBA don’t need hold NAUT win whitelist round 👉If didn’t win whitelist spot must hold 1000 NAUT participate Round 2 IDO 💰Cryptopiece Raise Amount 100000 💰Max Contribution 300 👉Minimum contribution per wallet minumum 👉BELLY per BUSD IDO 0005 BUSD 🦺 Vesting Please review tokenomics vesting photo FIRST ROUND WHITELIST ✅ALL WHITELIST WINNERS CONTRIBUTE 300 PM UTC 330 PM UTC Guaranteed allocation Get honey information free informs good initial investment coin KakaoTalk httpsopenkakaocomogd7nxqMd daldal99 Twitter httpstwittercomfeelyourlife999 Telegram httpstmehoneyboxcoinTags Ido Whitelist Coin Gamefi Bsc

Metakings is World’s First A.I Game on the BSC Network

Metakings is World’s First A.I Game on the BSC Network The universe of non-fungible tokens, ordinarily alluded to as NFTs, has detonated in prevalence. Indeed, the NFT business permits specialists to procure a huge number of dollars from their computerized workmanship. NFTs are non-fungible computerized resources that address one of a kind things on different blockchains About Metakings Metakings is an AI-controlled battling universe in which anybody can procure rewards, for example, tokens and NFTs through capable ongoing interaction and commitments to the environment. Players can take part in battle, assemble assets, foster their characters, and build up their own property based realms. The game will be fueled by its authority token, the Metakings token ($MTK). In-game characters can likewise be gathered as NFTs in the game and traded for tokens in our authority NFT commercial center. Metakings AI was dispatched as a universe of battle in advanced, the group of the game task Metakings got together with the game local area to foster the game capacities, for example, game substance to connection to the name. Metakings brand. Put in the extraordinary confidence of the undertaking, the Metaking game will be a game with appealing ongoing interaction with a decent story to give clients the best gaming experience. Metakings is a fight world fueled by computerized reasoning where anyone might procure tokens through able interactivity and commitments to the environment. Players might participate in battle, secure assets, develop their characters, and build a land-based realm for them.Third-party designers may promptly get to all workmanship resources and Metakings hereditary information, permitting them to make their own devices and encounters in the Metakings Metaverse. Mission The Mission of MetakingsMetakings was made as a strategy to show the public blockchain innovation in an engaging and enlightening manner. A large number of the establishing colleagues met while playing Decentraland, their first openness to Blockchain innovation for purposes other than unadulterated hypothesis. They immediately started creating Metakings to carry the force of Blockchain innovation to billions of gamers.The ConceptionWe have faith in a future in which work and joy become inseparably linked.We are focused on fostering our competitors and furnishing them with financial prospects.Most critically, we accept that battling and gathering delightful creatures can possibly further develop the world.We sincerely welcome you to join our development. Our Goal While we are as yet in the beginning phases of advancement, Metakings means to be the #1 BSC game as far as every day, week after week, and month to month dynamic players.While Metakings is a pleasant game, it has developed into an informal organization and occupation stage because of the solid local area and opportunities for play to acquire that have come about because of its initial prevalence. The contrast between Metaking games and conventional games The essential qualification among Metakings and a conventional game is that our members are compensated for their commitments to the biological system by means of a Blockchain monetary structure. This new gaming idea has been authored play to procure. Large number of gamers from immature countries have run to Metakings looking for a new income source during the Covid pandemic. A considerable lot of these members are fathers, aunties, and even grandparents who have never known about Blockchain innovation. Profit are conceivable through the accompanying techniques: - Partaking in PVP battles with the opportunity to procure leaderboard grants. - Rearing $MTK fully intent on exchanging them available. - Gathering and conjecturing on uncommon Mystics and Origins. - Cultivating to acquire the affection elixirs needed to raise Metakings. These might be exchanged on cryptographic money trades like Pancakeswap and Binance. Starting in 2021, players can secure an administration token, $MTK, which addresses a certified lump of the game world because of its administration privileges and expense sharing. Because of the way that players might acquire this token through ongoing interaction, a Ready Player One-style journey advances in which players can procure a piece of the universe. These undertakings, then again, are not champ bring home all the glory and prize players dependent on their work and ability. The MKT Tokenomics and Accurate Roadmap MTK token is a sort of administration badge of the game, it has a place with the BEP-20 organization. Proprietors of this sort of MTK token will get many in-game motivating forces, reserve the privilege to partake in deciding on administration issues in the game. Moreover, players can acquire this MTK token by partaking in game exercises. Subtleties of the $MTK token : Token Name: Metakings Token Image: MTK Decimals: 18 Network: Binance Smart Chain Absolute Supply: 1.000.000.000 MTK Token Allocation To more readily comprehend the cost of the $MTK token in the Metakings game venture and the data on the quantity of tokens brought to the market, you want to obviously see the data about the symbolic conveyance of the Metakings game task that the group has partitioned. The following is a point by point picture of the Metakings token designation. Website : https://metakings.ai/ Twitter : https://twitter.com/metakingsai Telegram : https://t.me/metakings Medium : https://metakings.medium.com/ GitHub : https://github.com/metakings YouTube : https://www.youtube.com/channel/UCe70dNypBRBFkMBZbg47hhQ Bounty Thread : https://bitcointalk.org/index.php?topic=5377898.0 By : Goldy2011 Profile Bitcointalk : https://bitcointalk.org/index.php?action=profile;u=2825835 Wallet Address : 0xFcABe13bB834464f72A095e01eCD0d54b3f0BD7c #Metakings #binance #iota #BSC #cryptocurrencies #MTK #NFTGame

https://medium.com/@kerjacerdas7/metakings-is-worlds-first-a-i-game-on-the-bsc-network-50e6b16f4a36

['Bank Arto']

2021-12-26 01:41:14.874000+00:00

['Metaking', 'Nft', 'Game', 'Bsc', 'Tokensale']

Title Metakings World’s First AI Game BSC NetworkContent Metakings World’s First AI Game BSC Network universe nonfungible token ordinarily alluded NFTs detonated prevalence Indeed NFT business permit specialist procure huge number dollar computerized workmanship NFTs nonfungible computerized resource address one kind thing different blockchains Metakings Metakings AIcontrolled battling universe anybody procure reward example token NFTs capable ongoing interaction commitment environment Players take part battle assemble asset foster character build property based realm game fueled authority token Metakings token MTK Ingame character likewise gathered NFTs game traded token authority NFT commercial center Metakings AI dispatched universe battle advanced group game task Metakings got together game local area foster game capacity example game substance connection name Metakings brand Put extraordinary confidence undertaking Metaking game game appealing ongoing interaction decent story give client best gaming experience Metakings fight world fueled computerized reasoning anyone might procure token able interactivity commitment environment Players might participate battle secure asset develop character build landbased realm themThirdparty designer may promptly get workmanship resource Metakings hereditary information permitting make device encounter Metakings Metaverse Mission Mission MetakingsMetakings made strategy show public blockchain innovation engaging enlightening manner large number establishing colleague met playing Decentraland first openness Blockchain innovation purpose unadulterated hypothesis immediately started creating Metakings carry force Blockchain innovation billion gamersThe ConceptionWe faith future work joy become inseparably linkedWe focused fostering competitor furnishing financial prospectsMost critically accept battling gathering delightful creature possibly develop worldWe sincerely welcome join development Goal yet beginning phase advancement Metakings mean 1 BSC game far every day week week month month dynamic playersWhile Metakings pleasant game developed informal organization occupation stage solid local area opportunity play acquire come initial prevalence contrast Metaking game conventional game essential qualification among Metakings conventional game member compensated commitment biological system mean Blockchain monetary structure new gaming idea authored play procure Large number gamers immature country run Metakings looking new income source Covid pandemic considerable lot member father aunty even grandparent never known Blockchain innovation Profit conceivable accompanying technique Partaking PVP battle opportunity procure leaderboard grant Rearing MTK fully intent exchanging available Gathering conjecturing uncommon Mystics Origins Cultivating acquire affection elixir needed raise Metakings might exchanged cryptographic money trade like Pancakeswap Binance Starting 2021 player secure administration token MTK address certified lump game world administration privilege expense sharing way player might acquire token ongoing interaction Ready Player Onestyle journey advance player procure piece universe undertaking champ bring home glory prize player dependent work ability MKT Tokenomics Accurate Roadmap MTK token sort administration badge game place BEP20 organization Proprietors sort MTK token get many ingame motivating force reserve privilege partake deciding administration issue game Moreover player acquire MTK token partaking game exercise Subtleties MTK token Token Name Metakings Token Image MTK Decimals 18 Network Binance Smart Chain Absolute Supply 1000000000 MTK Token Allocation readily comprehend cost MTK token Metakings game venture data quantity token brought market want obviously see data symbolic conveyance Metakings game task group partitioned following point point picture Metakings token designation Website httpsmetakingsai Twitter httpstwittercommetakingsai Telegram httpstmemetakings Medium httpsmetakingsmediumcom GitHub httpsgithubcommetakings YouTube httpswwwyoutubecomchannelUCe70dNypBRBFkMBZbg47hhQ Bounty Thread httpsbitcointalkorgindexphptopic53778980 Goldy2011 Profile Bitcointalk httpsbitcointalkorgindexphpactionprofileu2825835 Wallet Address 0xFcABe13bB834464f72A095e01eCD0d54b3f0BD7c Metakings binance iota BSC cryptocurrencies MTK NFTGameTags Metaking Nft Game Bsc Tokensale

Crypto Mafia — Launch day is nearing! Here’s everything you need to know…

The support Crypto Mafia has received this past week is phenomenal to say the least. Our social media groups have grown exponentially and we are receiving great engagement, trending multiple times across many platforms. Our 130BNB hardcap presale filled in less than a day of being open, with whitelisters and eager investors alike securing their spot in the family prior to launch. We want to say a massive thank you to all participants, and all of our supporters that are helping us to grow and expand through our social media pages and telegram group. To show our appreciation, the developers here at Crypto Mafia hosted a poll on our telegram page, asking the community whether they would prefer a PS5 or Xbox Series X giveaway, and the PS5 won the poll confidently. With that being said, our PS5 giveaway will ensue shortly after our official launch (20/12/2021), and will exclusively be obtainable by you, the members of the Crypto Mafia family. We will be posting across all of our social media pages once the giveaway begins, so be sure to keep up to date with us! Not only have the developer team negotiated multiple promotional ventures that will execute in perfect timing for launch day (including multiple investor group calls and promo posts from influencers), as some of you may know, we have negotiated major exchange listings shortly after our launch. We truly believe these catalysts will push and maintain fantastic trading volume for our token, and with the help of our current investors adding to the holdings of their $CMF tokens, we will see some very bullish days ahead. Our contract address is now available to the public, and what will be the chart for our token is already accessible, the LP is filled up with most of the funds we raised through our presale. We are also scheduling a growth rebase within the first week of our launch, and as mentioned in previous articles, this is going to make us show up in the ‘Top Gainers’ section on many reputable coin sites, meaning another wave of FOMO will dive into our project, and hopefully indulge themselves in all of the long-term utility we have to offer. Once we maintain enough volume to justify releasing our NFT collectibles/marketplace, we will go full force with the next phase in our project, which will be entering the NFT universe. In the list of priority however, our token launch comes first and foremost. This is because $CMF tokens will be the primary asset used to trade and exchange our original NFTs, this means that if you are intending on buying our NFT collection eventually, holding $CMF will mean you can obtain the collectibles for a better deal than someone who would be purchasing with other applicable cryptocurrencies. ‘Special’ Don Variant — Extremely limited quantity With all of this being said, the Mafia community has grown, but it still has a long way to go. Leading up to launch, we urge our community to invite and tell as many of your friends about this project as possible, and ensure them that they will be missing out if not. We are wholly confident that this project has the ability to blossom into something that millions of people can be made aware about, the sky is the limit with Crypto Mafia. ‘The Mistress’ We hope all of our community are having a fantastic weekend, and we hope you are all as excited about launch day (Monday, 19:00 UTC) as we are. Articles on Medium regarding Crypto Mafia will be published weekly, so be sure to watch this space! Thank you for showing interest, and I look forward to seeing you join us along our journey to the top Take care, Mafioso! CM Hitman Our social media pages! Website — https://cryptomafianft.com Telegram — https://t.me/OfficialCryptoMafia Instagram — https://www.instagram.com/cryptomafia_nft/ Discord — https://discord.gg/YThdZzMRgx Twitter — https://twitter.com/CryptoMafia_NFT?t=ppmvoxYFy0fvy6wmNnnF8A&s=09 Reddit — https://www.reddit.com/u/Crypto_Mafia_bsc?utm_medium=android_app&utm_source=share

https://medium.com/@CryptoMafiaNFT/crypto-mafia-launch-day-is-nearing-heres-everything-you-need-to-know-9af2c081c971

[]

2021-12-18 16:28:45.114000+00:00

['Nft', 'Nft Collectibles', 'Nft Marketplace', 'Bsc', 'Binance Smart Chain']

Title Crypto Mafia — Launch day nearing Here’s everything need know…Content support Crypto Mafia received past week phenomenal say least social medium group grown exponentially receiving great engagement trending multiple time across many platform 130BNB hardcap presale filled le day open whitelisters eager investor alike securing spot family prior launch want say massive thank participant supporter helping u grow expand social medium page telegram group show appreciation developer Crypto Mafia hosted poll telegram page asking community whether would prefer PS5 Xbox Series X giveaway PS5 poll confidently said PS5 giveaway ensue shortly official launch 20122021 exclusively obtainable member Crypto Mafia family posting across social medium page giveaway begin sure keep date u developer team negotiated multiple promotional venture execute perfect timing launch day including multiple investor group call promo post influencers may know negotiated major exchange listing shortly launch truly believe catalyst push maintain fantastic trading volume token help current investor adding holding CMF token see bullish day ahead contract address available public chart token already accessible LP filled fund raised presale also scheduling growth rebase within first week launch mentioned previous article going make u show ‘Top Gainers’ section many reputable coin site meaning another wave FOMO dive project hopefully indulge longterm utility offer maintain enough volume justify releasing NFT collectiblesmarketplace go full force next phase project entering NFT universe list priority however token launch come first foremost CMF token primary asset used trade exchange original NFTs mean intending buying NFT collection eventually holding CMF mean obtain collectible better deal someone would purchasing applicable cryptocurrencies ‘Special’ Variant — Extremely limited quantity said Mafia community grown still long way go Leading launch urge community invite tell many friend project possible ensure missing wholly confident project ability blossom something million people made aware sky limit Crypto Mafia ‘The Mistress’ hope community fantastic weekend hope excited launch day Monday 1900 UTC Articles Medium regarding Crypto Mafia published weekly sure watch space Thank showing interest look forward seeing join u along journey top Take care Mafioso CM Hitman social medium page Website — httpscryptomafianftcom Telegram — httpstmeOfficialCryptoMafia Instagram — httpswwwinstagramcomcryptomafianft Discord — httpsdiscordggYThdZzMRgx Twitter — httpstwittercomCryptoMafiaNFTtppmvoxYFy0fvy6wmNnnF8As09 Reddit — httpswwwredditcomuCryptoMafiabscutmmediumandroidapputmsourceshareTags Nft Nft Collectibles Nft Marketplace Bsc Binance Smart Chain

Playground of the Week: TEN

Hi babies, how y‘all doing this week? On this lovely Sunday, BabySwap brings babies Playground of the week — TEN. We all know that Playground is the wonderland for BABY. You can use BABY to play and earn at our friend’s house. There are various types of games, prediction, vaults, payment, NFT minting, yield farm, etc for you to explore. For Playground of the Week, we will introduce a glowing project from BabySwap playground every week. Guess who’s baby’s favorite? Let us welcome the selected project this week — TEN. Introduce by Baby TEN stands for Token Enrichment Network and it’s a yield optimizer that simplifies staking and yield farming by auto-compounding your LP’s and tokens across multiple Binance Smart Chain farming ecosystems. TEN provides a robust yield earning environment on the market while committing to simplicity, sustainability, longevity and security. TEN is Decentralized Finance, Simplified! Learn more about TEN. Website: https://www.ten.finance/ Twitter: https://twitter.com/TENfinance Telegram: https://t.me/tenfinance Medium: https://medium.com/tenfinance Play with Baby You can stake BABY-LP in TEN and earn more juicy rewards. Besides our cooperation, we’d love to introduce more projects to connect with TEN in order to add more scenarios to empower their tokens. Growing together with the help of BabySwap and BabySwap Friends is a way to the moon! Chat with Baby Our baby invited TEN to the house and chatted a little bit, here’s the record! 1. What are the main advantages of TEN for the user, compared to the similar projects? I think our long term vision gives us an indefinite advantage over many projects which historically had a short rewards emissions schedule, therefore scrambling for ways to provide utility for their native tokens and more importantly, provide value for the token holders. We feel that crypto and in particular DeFi is the future of money and banking, therefore we bet on it from the beginning. Therefore, I think that our commitment to simplicity, sustainability, longevity and security is key for us and this goes along with the innovative thinking of how to simplify defi 1 click at a time! 2. What is your security strategy? How do you protect your users, their funds and data? Security has been a pillar of our motto since day one along with simplicity. All of our contracts/strategies/farms are derived from previously audited contracts with just minimal changes to reflect our project and anything new, like the YIELDEX, was fully audited by a third party auditor. We’ve had 3 total audits, 2 by Certik, which one was pre-launch, citing our commitment to security and the latest one for the YIELDEX, which we also just announced a $100,000 Bug Bounty through Immunefi. Since we are simply a conduit to the BSC network through our site via web3, there is no user data that is at risk or in need of protection. 3. What’s your roadmap for the next couple of months? You can check out our Roadmap here (https://tenfinance.gitbook.io/faq/protocol/roadmap) In the near-term we have TENLend, our lending platform in which will further incentivize TENFI holders via our TEN Lots coming up that we’re working on, TENSwap, which will allow us to tap into the BabySwap AMM liquidity pools and going multi-chain is a real possibility as well! As the crypto market moves so fast, knowing this also allows us to deviate from the roadmap as needed to ensure that we evolve and adapt with the space. 4. Tell me a little more about your latest feature. This is going to be a long baby, you ready? YIELDEX is basically the combination of the words Yield and Index, thus YIELDEX. Given we’re in the yield farming space, we felt the name was fitting and did exactly as we wanted it to do, simplify the process. YIELDEX is a pool of LP’s that you get to invest into with only having BUSD or BNB in your wallet, no need to create LP or buy tokens just for LP purposes, with YIELDEX, you choose the amount you want to invest, and the YIELDEX vault you’re investing in, will do the rest. Yield farming now is a cumbersome and long and sometimes annoying process, so what we did with YIELDEX is to literally cut down these time consuming tasks… 1.Buying each individual token 2.Creating each LP for each a.Approving each token b.Enabling each token c.Supplying each token 3.Moving to the yield farm or optimizer to deposit your LP’s 4.Withdrawing your LP’s, one by one 5.Going back to the AMM to unpair your LP 6.Then selling unwanted tokens you bought just to farm the LP 7.Repeat these steps if doing more farming As you see here, it’s a long and time consuming process! (in the background there are literally 60–100+ transactions occurring with the creation of each YIELDEX deposit!) The purpose of yield farming with the YIELDEX is just that, to farm for yields and not to worry about pairing, unpairing LP’s and then buying and selling unwanted tokens you got only for the purpose of yield farming in the first place! From my own personal experience, if this goes beyond the couple of LP’s, you’re talking about possibly hours wasted on something that we reduced to less than a minute! It should be noted that this is NOT an “index fund” where we buy the tokens and the value of the YIELDEX fluctuates due to price volatility of the constituents, there’s many of these around across both Ethereum and BSC running on the Balancer protocol, which resembles an ETF of sorts. YIELDEX is literally LP’s in the vault, the simplest way to yield farm multiple LP’s with one deposit! Easy to deposit and withdraw with a simple click and thus reducing your risk to Impermanent Loss through diversification of the said LP’s, it’s basically a yield farming manager for you doing all the work of the yield farming process with a click or two! Creating the YIELDEX is a key puzzle to our motto of Decentralized Finance, Simplified! 5. Why did you decide to cooperate with BabySwap? We wanted to work with other projects that have similar drive, energy and most importantly, ambition as us in continuing to improve and strive to higher levels! And we feel that working together, in a collective manner with the BabySwap team, we’ll be able to do great things together and take the next step in this ever evolving crypto ecosystem. Seeing as to how much BabySwap has grown and evolved over the last several months, we hope to be able to grow together with them as they move into new spheres of the crypto ecosystem and we’ll see how else we can get involved with Babyswap and how to integrate into the Baby Metaverse! 6. What do you hope to see next for BabySwap？ I think that in the current ecosystem and BabySwap’s inclination of working with all projects in allowing them to have a Farm is a big deal! And with the current cycle of GameFi/Metaverse projects being in full speed, when their users start to want additional sources of income on top of their P2E earnings, they will come to BabySwap and in turn hopefully to us through our partnership of the YIELDEX for BabySwap vaults, then I think it’s an ecosystem that BabySwap can take over. Continued growth is also something that we hope for BabySwap as we’ve been so used to! BabySwap has just barely started to crawl, can’t imagine where BabySwap will be when fully running! Very exciting times ahead for the team! 7. Are you going to have any other cooperation with BabySwap? What are they? Absolutely! We are launching a BabySwap version of the YIELDEX! And since Babyswap nurtures the newer/hottest projects in crypto, we’re going to start with a blast and what’s hot right now, which is GameFi! So we’ll be launching a BabySwap GameFi YIELDEX and soon after that we’ll be launching two other ones as well in the coming days! 8. Say something nice to the baby! Hi Baby! I have 3 babies of my own! BabySwap Playground welcomes more projects to join, and is committed to bringing more use cases and benefits to babies. Guess what’s the glowing project next week? Let us all play with the baby! Principal’s Note 🍼Twitter 🍼Telegram 🍼Discord 🍼Docs

https://medium.com/@babyswap/playground-of-the-week-ten-833b26feaae0

[]

2021-12-18 14:41:42.132000+00:00

['Babyswap', 'Dex', 'Bsc', 'Binance', 'Binance Smart Chain']

Title Playground Week TENContent Hi baby y‘all week lovely Sunday BabySwap brings baby Playground week — TEN know Playground wonderland BABY use BABY play earn friend’s house various type game prediction vault payment NFT minting yield farm etc explore Playground Week introduce glowing project BabySwap playground every week Guess who’s baby’s favorite Let u welcome selected project week — TEN Introduce Baby TEN stand Token Enrichment Network it’s yield optimizer simplifies staking yield farming autocompounding LP’s token across multiple Binance Smart Chain farming ecosystem TEN provides robust yield earning environment market committing simplicity sustainability longevity security TEN Decentralized Finance Simplified Learn TEN Website httpswwwtenfinance Twitter httpstwittercomTENfinance Telegram httpstmetenfinance Medium httpsmediumcomtenfinance Play Baby stake BABYLP TEN earn juicy reward Besides cooperation we’d love introduce project connect TEN order add scenario empower token Growing together help BabySwap BabySwap Friends way moon Chat Baby baby invited TEN house chatted little bit here’s record 1 main advantage TEN user compared similar project think long term vision give u indefinite advantage many project historically short reward emission schedule therefore scrambling way provide utility native token importantly provide value token holder feel crypto particular DeFi future money banking therefore bet beginning Therefore think commitment simplicity sustainability longevity security key u go along innovative thinking simplify defi 1 click time 2 security strategy protect user fund data Security pillar motto since day one along simplicity contractsstrategiesfarms derived previously audited contract minimal change reflect project anything new like YIELDEX fully audited third party auditor We’ve 3 total audit 2 Certik one prelaunch citing commitment security latest one YIELDEX also announced 100000 Bug Bounty Immunefi Since simply conduit BSC network site via web3 user data risk need protection 3 What’s roadmap next couple month check Roadmap httpstenfinancegitbookiofaqprotocolroadmap nearterm TENLend lending platform incentivize TENFI holder via TEN Lots coming we’re working TENSwap allow u tap BabySwap AMM liquidity pool going multichain real possibility well crypto market move fast knowing also allows u deviate roadmap needed ensure evolve adapt space 4 Tell little latest feature going long baby ready YIELDEX basically combination word Yield Index thus YIELDEX Given we’re yield farming space felt name fitting exactly wanted simplify process YIELDEX pool LP’s get invest BUSD BNB wallet need create LP buy token LP purpose YIELDEX choose amount want invest YIELDEX vault you’re investing rest Yield farming cumbersome long sometimes annoying process YIELDEX literally cut time consuming tasks… 1Buying individual token 2Creating LP aApproving token bEnabling token cSupplying token 3Moving yield farm optimizer deposit LP’s 4Withdrawing LP’s one one 5Going back AMM unpair LP 6Then selling unwanted token bought farm LP 7Repeat step farming see it’s long time consuming process background literally 60–100 transaction occurring creation YIELDEX deposit purpose yield farming YIELDEX farm yield worry pairing unpairing LP’s buying selling unwanted token got purpose yield farming first place personal experience go beyond couple LP’s you’re talking possibly hour wasted something reduced le minute noted “index fund” buy token value YIELDEX fluctuates due price volatility constituent there’s many around across Ethereum BSC running Balancer protocol resembles ETF sort YIELDEX literally LP’s vault simplest way yield farm multiple LP’s one deposit Easy deposit withdraw simple click thus reducing risk Impermanent Loss diversification said LP’s it’s basically yield farming manager work yield farming process click two Creating YIELDEX key puzzle motto Decentralized Finance Simplified 5 decide cooperate BabySwap wanted work project similar drive energy importantly ambition u continuing improve strive higher level feel working together collective manner BabySwap team we’ll able great thing together take next step ever evolving crypto ecosystem Seeing much BabySwap grown evolved last several month hope able grow together move new sphere crypto ecosystem we’ll see else get involved Babyswap integrate Baby Metaverse 6 hope see next BabySwap？ think current ecosystem BabySwap’s inclination working project allowing Farm big deal current cycle GameFiMetaverse project full speed user start want additional source income top P2E earnings come BabySwap turn hopefully u partnership YIELDEX BabySwap vault think it’s ecosystem BabySwap take Continued growth also something hope BabySwap we’ve used BabySwap barely started crawl can’t imagine BabySwap fully running exciting time ahead team 7 going cooperation BabySwap Absolutely launching BabySwap version YIELDEX since Babyswap nurture newerhottest project crypto we’re going start blast what’s hot right GameFi we’ll launching BabySwap GameFi YIELDEX soon we’ll launching two one well coming day 8 Say something nice baby Hi Baby 3 baby BabySwap Playground welcome project join committed bringing use case benefit baby Guess what’s glowing project next week Let u play baby Principal’s Note 🍼Twitter 🍼Telegram 🍼Discord 🍼DocsTags Babyswap Dex Bsc Binance Binance Smart Chain

Kim Jong Un Token

KIMJU What is Kim Jong Un Token? Introduction: Kim Jong Un coin was developed to assist Kim Jong Un, a young man living in North Korea. •On the Binance Smart Chain (BSC) network, Kim Jong Un is a token. •It was founded in November 2021 with the intention of becoming a decentralized meme project with a genuine purpose. •Kim Jong Un coin is a meme coin, but it’s more than that. •When the North Korean economy opens up if Kim Jong Un’s token will be utilized in the North Korean president’s MetaMask wallet! KIMJU Mascot Benefits Rewards and Charity •A 1% $KIMJONGUN incentive is given to holders of decentralized wallets for every active user transaction, promoting a healthy distributed network and community usage. •The more $KIMJONGUN is utilized actively, the more prizes are given! Furthermore, 1% of $KIMJUNGUN tokens are used for charity programs for North Koreans, advertising costs for the development of $KIMJUNGUN tokens, and other expenditures. Community •$KIMJONGUN is fully decentralized and owned by people and our great community •Our enthusiast's members welcome and embrace diverse perspectives to build $KIMJONGUN into the best meme community in crypto. HOW TO BUY $KIMJU Create a MetaMask Wallet MetaMask Information: MetaMask is a third-party BEP20 (Binance smart chain) browser wallet and is the most used multi-wallet. Kim Jong Un Token is available on the Binance Blockchain. •Open Google Chrome, Brave Browser, Firefox •Visit ‘metamask.io’ to download the extension and set up a wallet. •On mobile? Get MetaMask’s app for iPhone or Android. Send $BNB to MetaMask •Transfer BNB coin to your MetaMask wallet address from Centralization exchange wallet (e.g. Coinbase or Binance) BUY ON PANCAKESWAP •Go to PancakeSwap (https://pancakeswap.finance/), connect your wallet(Metamask), and paste the address to select a token. 0x9F9beC61586996f9c63bC26c9a9b179458ED30bE •Find Kim Jong Un(KIMJU) coins and import them. The token address is using the smart contract address. Support us by using our LOGO CLICK AND DOWNLOAD Visit us on: Telegram Twitter Instagram Discord

https://medium.com/@jefftnick/kim-jong-un-token-445a0084d312

['Jeff Nick']

2021-12-18 06:55:17.744000+00:00

['Bsc', 'Meme', 'Meta']

Title Kim Jong Un TokenContent KIMJU Kim Jong Un Token Introduction Kim Jong Un coin developed assist Kim Jong Un young man living North Korea •On Binance Smart Chain BSC network Kim Jong Un token •It founded November 2021 intention becoming decentralized meme project genuine purpose •Kim Jong Un coin meme coin it’s •When North Korean economy open Kim Jong Un’s token utilized North Korean president’s MetaMask wallet KIMJU Mascot Benefits Rewards Charity •A 1 KIMJONGUN incentive given holder decentralized wallet every active user transaction promoting healthy distributed network community usage •The KIMJONGUN utilized actively prize given Furthermore 1 KIMJUNGUN token used charity program North Koreans advertising cost development KIMJUNGUN token expenditure Community •KIMJONGUN fully decentralized owned people great community •Our enthusiast member welcome embrace diverse perspective build KIMJONGUN best meme community crypto BUY KIMJU Create MetaMask Wallet MetaMask Information MetaMask thirdparty BEP20 Binance smart chain browser wallet used multiwallet Kim Jong Un Token available Binance Blockchain •Open Google Chrome Brave Browser Firefox •Visit ‘metamaskio’ download extension set wallet •On mobile Get MetaMask’s app iPhone Android Send BNB MetaMask •Transfer BNB coin MetaMask wallet address Centralization exchange wallet eg Coinbase Binance BUY PANCAKESWAP •Go PancakeSwap httpspancakeswapfinance connect walletMetamask paste address select token 0x9F9beC61586996f9c63bC26c9a9b179458ED30bE •Find Kim Jong UnKIMJU coin import token address using smart contract address Support u using LOGO CLICK DOWNLOAD Visit u Telegram Twitter Instagram DiscordTags Bsc Meme Meta

Bottle Dec 13: Who’s the Shining Stars of this Round

After a 5-day competition, our Bottle Dec 13 Top 3 projects were finally selected! Please meet our shining stars of the week, the Bottle winners — Wing, Altura, and Airnfts! Bottle Result At the end, over 3.2 million of BABY participated in the Voting Stage, with 4 events held by the projects. The top 3 projects felt hard for the places and they are all amazing in liquidity building and trading incentive. Wing Liquidity: $780,194.09 Weekly Volume: $225,912.92 BABY Votes: 2,154,982.30 Total Votes: 3,161,089.31 Project Insight: Wing has built a decentralized finance (DeFi) platform to support cross-chain collaborative interactions between various DeFi products. Combining the platform’s decentralized governance model, the risk control mechanism introduced by Wing promotes a healthy, benign relationship between borrowers, creditors and guarantors, allowing the implementation of a wider range of DeFi plans on the platform and thus providing users with more DeFi products of premium quality. Wing has showcased an innovative credit valuation module as a strong support for DeFi credit products on the Wing platform. Links to Follow: Website: https://wing.finance/ Twitter: https://twitter.com/Wing_Finance Telegram: https://t.me/WingDAO USDT Reward TXID: 0x17990bfe7e4d9d3b02787fdbd2ffc531a2a4fb1e7e43d58ad5a888fb0bf8ca67 BABY Reward TXID: 0xa822f182efc52a083dc7fbd02c18ac1f9c14571899e7eaa1779f3ebf92b0e69b Altura Liquidity: $959,657.35 Weekly Volume: $865,657.35 BABY Votes: 2,511.32 Total Votes: 1,827,586.42 Project Insight: The current state of NFTs is comparable to that of the web in the 90s; static and boring. Altura is pioneering the concept of Smart NFTs, which have dynamically changing properties. For instance, a video game sword that gets stronger as you use it in-game or an evolving digital pet. Altura is developing APIs and SDKs for game developers to create and easily integrate NFTs into their video games, as well as a digital asset marketplace for buying, selling, minting, and trading Smart NFTs. Other products we provide include verifiably random NFT loot boxes, Altura Guard, a blockchain verification system for authenticating yourself in-game without needing a web3 wallet connection and perpetual royalties for game developers. Altura earns revenue by taking a 2.5% cut from every transaction on the Altura marketplace and taking a 7% cut for all NFT loot box interactions. Links to Follow: Website: https://www.alturanft.com/ Twitter: https://twitter.com/Alphakombatgame Telegram: https://t.me/alturanft USDT Reward TXID: 0xa378110543e2ae6c31194049c533a806f0095f797efe91063bae098cd789fa5d BABY Reward TXID: 0x32cfdb668ce4127498546d64ee5c1497fe627a984ed67352f99323f3f5a7e4d8 Airnfts Liquidity: $324,585.05 Weekly Volume: $154,963.91 BABY Votes: 1,055,356.74 Total Votes: 1,534,905.70 Project Insight: Airnfts is the NFT marketplace built on Binance Smart Chain focusing highly on user experience and ease of use to Create, Buy, Sell and use NFTs. Create NFT with ease.One click and your NFT is created. Set a price and start earning, NFT auction will come next. AIRT Farming & Royalties. You can earn AIRT Token for selling and buying NFTs. Use royalties for secondary sales. NFT Launchpad. For those artists that don’t have big following there will be launchpad to give exposure. Easy user experience, low fees, one-click minting, AirNFTs was built for artists by artists.Token economy is built around the AIRT Token, a unit of value on the platform that enables token holders to use applications on this platform, participate in network governance, and earn additional token rewards by using this project. Links to Follow: Website: https://www.airnfts.com/ Twitter: https://twitter.com/airnfts Telegram: https://t.me/joinchat/HKsQnSvxhfjjKGJe USDT Reward TXID: 0x6c2eaa27ac5e74198dee5cf54123a8e779b1cdecea5391e7316638713ed9ecca BABY Reward TXID: ：0x8aee46408f20722b76cc7a0d8f9c14b4bd0c972940f01ac9eff42c63125053e7 What’s Bottle? Bottle is BabySwap’s feature that grants BABY voting power and allows users to be more familiar with the new gems on BSC. You can stake to vote, and collect to earn! There are 3 stages in each round of Bottle: The first stage is called the Audition Stage, from Monday 00:00:00 to Thursday 23:59:59 UTC Time. Projects will work hard to add liquidity and increase their trading volume during this time, since each dollar counts as 1 vote. The top 30 projects will enter the next stage. The second stage is called the Voting Stage, from Friday 00:00:00 to Friday 23:59:59 UTC Time, and the projects need your efforts to win the final round! You can stake BABY in the project pool that you wanna vote for, 1 BABY = 1 Vote. The final stage is called the Announcement Stage from Saturday 00:00:00 to Sunday 23:59:59 UTC Time. The top 3 projects who win the Bottle will share our weekly trading fee. The Bottle will be held weekly, and we hope to bring new gems and activities for you each week. What’s the Benefit of Bottle? Many have been asking about the benefit of Bottle since the rewards are the same with BABY pool. Well, there is a lot to say! Show your voting power!! That’s the meaning of DeFi, we want you to have the voting power and decide if a project can get its best support. Vote and earn at the same time. Learn about new projects, the ones that have potential. This is exactly the reason for the first stage, where projects need to have liquidity and trading volume to prove themselves. Imagine that you see a token in the top 30 list but never heard it before, do you wanna start looking at it? HOWEVER, please always DYOR before investing. The numbers mean something, but can’t represent everything. The projects’ communities will also pay more attention to BabySwap. And if they want their projects to win, guess what can be used as votes? Liquidity, trading volume, and BABY. Of course, if the project team intends to give airdrops to BABY holders for voting support, it’s also something we’d be glad to see and it’s also beneficial to our BABY holders. The stimulation process can only be community-wise for now, but it’s planned to be implemented in the Bottle 2.0 version as a function. Congrats on the Top 3 projects of Bottle Dec 13 again! It’s time to give babies some bottles. We are super excited to see the results next week. What’s your bet? Principal’s Note 🍼Twitter 🍼Telegram 🍼Discord 🍼Docs

https://medium.com/@babyswap/bottle-dec-13-whos-the-shining-stars-of-this-round-467f33368c8f

[]

2021-12-19 12:54:49.750000+00:00

['Babyswap', 'Dex', 'Bsc', 'Binance', 'Binance Smart Chain']

Title Bottle Dec 13 Who’s Shining Stars RoundContent 5day competition Bottle Dec 13 Top 3 project finally selected Please meet shining star week Bottle winner — Wing Altura Airnfts Bottle Result end 32 million BABY participated Voting Stage 4 event held project top 3 project felt hard place amazing liquidity building trading incentive Wing Liquidity 78019409 Weekly Volume 22591292 BABY Votes 215498230 Total Votes 316108931 Project Insight Wing built decentralized finance DeFi platform support crosschain collaborative interaction various DeFi product Combining platform’s decentralized governance model risk control mechanism introduced Wing promotes healthy benign relationship borrower creditor guarantor allowing implementation wider range DeFi plan platform thus providing user DeFi product premium quality Wing showcased innovative credit valuation module strong support DeFi credit product Wing platform Links Follow Website httpswingfinance Twitter httpstwittercomWingFinance Telegram httpstmeWingDAO USDT Reward TXID 0x17990bfe7e4d9d3b02787fdbd2ffc531a2a4fb1e7e43d58ad5a888fb0bf8ca67 BABY Reward TXID 0xa822f182efc52a083dc7fbd02c18ac1f9c14571899e7eaa1779f3ebf92b0e69b Altura Liquidity 95965735 Weekly Volume 86565735 BABY Votes 251132 Total Votes 182758642 Project Insight current state NFTs comparable web 90 static boring Altura pioneering concept Smart NFTs dynamically changing property instance video game sword get stronger use ingame evolving digital pet Altura developing APIs SDKs game developer create easily integrate NFTs video game well digital asset marketplace buying selling minting trading Smart NFTs product provide include verifiably random NFT loot box Altura Guard blockchain verification system authenticating ingame without needing web3 wallet connection perpetual royalty game developer Altura earns revenue taking 25 cut every transaction Altura marketplace taking 7 cut NFT loot box interaction Links Follow Website httpswwwalturanftcom Twitter httpstwittercomAlphakombatgame Telegram httpstmealturanft USDT Reward TXID 0xa378110543e2ae6c31194049c533a806f0095f797efe91063bae098cd789fa5d BABY Reward TXID 0x32cfdb668ce4127498546d64ee5c1497fe627a984ed67352f99323f3f5a7e4d8 Airnfts Liquidity 32458505 Weekly Volume 15496391 BABY Votes 105535674 Total Votes 153490570 Project Insight Airnfts NFT marketplace built Binance Smart Chain focusing highly user experience ease use Create Buy Sell use NFTs Create NFT easeOne click NFT created Set price start earning NFT auction come next AIRT Farming Royalties earn AIRT Token selling buying NFTs Use royalty secondary sale NFT Launchpad artist don’t big following launchpad give exposure Easy user experience low fee oneclick minting AirNFTs built artist artistsToken economy built around AIRT Token unit value platform enables token holder use application platform participate network governance earn additional token reward using project Links Follow Website httpswwwairnftscom Twitter httpstwittercomairnfts Telegram httpstmejoinchatHKsQnSvxhfjjKGJe USDT Reward TXID 0x6c2eaa27ac5e74198dee5cf54123a8e779b1cdecea5391e7316638713ed9ecca BABY Reward TXID ：0x8aee46408f20722b76cc7a0d8f9c14b4bd0c972940f01ac9eff42c63125053e7 What’s Bottle Bottle BabySwap’s feature grant BABY voting power allows user familiar new gem BSC stake vote collect earn 3 stage round Bottle first stage called Audition Stage Monday 000000 Thursday 235959 UTC Time Projects work hard add liquidity increase trading volume time since dollar count 1 vote top 30 project enter next stage second stage called Voting Stage Friday 000000 Friday 235959 UTC Time project need effort win final round stake BABY project pool wanna vote 1 BABY 1 Vote final stage called Announcement Stage Saturday 000000 Sunday 235959 UTC Time top 3 project win Bottle share weekly trading fee Bottle held weekly hope bring new gem activity week What’s Benefit Bottle Many asking benefit Bottle since reward BABY pool Well lot say Show voting power That’s meaning DeFi want voting power decide project get best support Vote earn time Learn new project one potential exactly reason first stage project need liquidity trading volume prove Imagine see token top 30 list never heard wanna start looking HOWEVER please always DYOR investing number mean something can’t represent everything projects’ community also pay attention BabySwap want project win guess used vote Liquidity trading volume BABY course project team intends give airdrop BABY holder voting support it’s also something we’d glad see it’s also beneficial BABY holder stimulation process communitywise it’s planned implemented Bottle 20 version function Congrats Top 3 project Bottle Dec 13 It’s time give baby bottle super excited see result next week What’s bet Principal’s Note 🍼Twitter 🍼Telegram 🍼Discord 🍼DocsTags Babyswap Dex Bsc Binance Binance Smart Chain

Top 20 Smart Grid Vendors by ARRA Award Total Amount

Top 20 Smart Grid Vendors by ARRA Award Total Amount Analysis of the total amount of Smart Grid Investment Grant (SGIG) and Smart Grid Demonstration Program (SGDP) funds awarded to Smart Grid vendors. The analysis covers the 131 projects funded by the SGIG (99) and the SGDP (32). The time period of the analysis is from February 17, 2009 to March 31, 2012. The top 20 Smart Grid ARRA awards total $1.13B, making up 12% of the overall $9.6B funds. The Zpryme INFOgraphic presents the top 20 Smart Grid ARRA awarded companies (in US dollars): Itron $304,828,804 Trilliant Networks Inc. $99,494,396 GE $98,668,171 Honeywell $60,932,262 Landis+Gyr $56,222,792 Accenture $53,955,271 Cooper Power Systems $48,680,230 Sensus $43,319,354 Elster $42,305,647 IBM $42,261,054 S&C Electric Company $39,431,504 Alcatel Lucent $38,664,493 BSC $32,078,744 A123 Systems $29,923,083 Oracle $28,673,666 Silver Spring Networks Inc. $28,611,707 Beacon Power Corporation $24,063,978 Tantalus $21,059,544 Undisclosed $18,399,024 Ervin Cable Construction, LLC $16,959,700 Source: Recovery.gov, Cumulative National Summary of Recipient Data (February 17, 2009 to March 31, 2012); ARRA: American Recovery and Reinvestment Act of 2009 [sc name=”Standard” ]

https://medium.com/ets-insights/top-20-smart-grid-vendors-by-arra-award-total-amount-ed1d4941725e

[]

2017-06-19 20:46:16.506000+00:00

['Infographics', 'Bsc']

Title Top 20 Smart Grid Vendors ARRA Award Total AmountContent Top 20 Smart Grid Vendors ARRA Award Total Amount Analysis total amount Smart Grid Investment Grant SGIG Smart Grid Demonstration Program SGDP fund awarded Smart Grid vendor analysis cover 131 project funded SGIG 99 SGDP 32 time period analysis February 17 2009 March 31 2012 top 20 Smart Grid ARRA award total 113B making 12 overall 96B fund Zpryme INFOgraphic present top 20 Smart Grid ARRA awarded company US dollar Itron 304828804 Trilliant Networks Inc 99494396 GE 98668171 Honeywell 60932262 LandisGyr 56222792 Accenture 53955271 Cooper Power Systems 48680230 Sensus 43319354 Elster 42305647 IBM 42261054 SC Electric Company 39431504 Alcatel Lucent 38664493 BSC 32078744 A123 Systems 29923083 Oracle 28673666 Silver Spring Networks Inc 28611707 Beacon Power Corporation 24063978 Tantalus 21059544 Undisclosed 18399024 Ervin Cable Construction LLC 16959700 Source Recoverygov Cumulative National Summary Recipient Data February 17 2009 March 31 2012 ARRA American Recovery Reinvestment Act 2009 sc name”Standard” Tags Infographics Bsc

FomoETH, a new Crypto Startup begins its presale for a new concept mobile app — NFTagram

FomoETH, a new Crypto Startup begins its presale for a new concept mobile app — NFTagram FomoETH Dec 18, 2021·3 min read The blockchain technology and the Non-Fungible Tokens (NFT) has become an integral part of the crypto industry. According to analysts there are possibilities for the entire crypto industry to die out, but not for the blockchain technology and the NFTs. True to the fact, NFTs at a time could even take over the crypto industry. In such aspects, a revolutionary project combining both the blockchain network and the NFTs, sounds quite amazing right? Yes, the FomoETH is one such which integrates both the blockchain technology along with the NFT together. The FomoETH actually serves as a democratic platform that focuses more towards it’s holders and supporters of the platform. Another aspiring fact is that, the native token of the FomoETH will be in operation upon both the Ethereum (ETH) blockchain as well as the Binance Smart Chain (BSC). Moreover, the 2 main attributes around which the complete project revolves around will be the FomoETH token and their NFT project, the NFTagram. 💫 Auto Reward Distribution in ETH Regardless, the FomoETH allows it’s holders and users to decide and vote for their opinions and proposals for the betterment of the project, making it completely democratic in all aspects. While there is also rewards distributed in both BSC and Ethereum network for the holders. It’s an automatic reward distribution in ETH (ETH for ERC20, WETH for BEP20) from its own transactions. 📸 NFTagram The NFTagram serves as the primary attribute for the FomoETH network. Unique features of this attribute is that every moment of one’s life through pictures captured could be converted into NFTs and they will remain in their blockchain forever. Apart from this, it even features mining of NFTs and you can even sell your own NFT upon your wish. The NFTagram will be available as an App both in the Apple store as well as the Google Play store. 💍 FomoETH Swap & FomoETH Wallet In addition to all this, FomoETH has further plans and are developing the ‘FomoETH Swap’, which will be launched around February 2022. This will be followed by another launch of their unique ‘FomoETH Wallet’ too. The plans and projects in hands of the FomoETH ecosystem is quite rigid, expanding itself towards the future. 💝 FomoETH Presale With regards to all above, the pre-sale of the FomoETH tokens will start first upon the Binance Smart Chain on December 22, 2021 exactly by 2:00am UTC, followed by the sale on Ethereum blockchain. The presale will feature about 431,872,120,000 FomoETH tokens, which constitutes about 43.18% of the overall FomoETH tokens available. The price of these tokens are 86,374,424 FomoETH per 1BNB, at 0% purchase fee. The maximum possible investment is limited to 5BNB and the minimum will be 0.5BNB, at 0. The presale will go on only for 2 days ending by December 24, 2021 exactly by the same 2:00am UTC. 💝 FomoETH Public Sale The public sale for the FomoETH tokens will start from December 24, 2021, 2:00am UTC, with 213,765,750,000 FomoETH at sale. The price will be 77,733,000 FomoETH per 1BNB, at 10% purchase fee. 👑 Funding Previously, FomoETH has successfully raised seed funding of 1M USD in total on June 21, 2021: https://fomoeth.gitbook.io/fomoeth-official-whitepaper/fundamentals/funding 📸 FomoETH Official Social Media Website: https://www.fomoeth.net Whitepaper: https://fomoeth.gitbook.io/fomoeth-official-whitepaper Facebook: https://www.facebook.com/FomoEth/ Twitter: https://twitter.com/fomo_eth Reddit: https://www.reddit.com/r/fomoeth/ Github: https://github.com/FOMO-ETH Telegram: https://t.me/FomoETH

https://medium.com/@fomoeth/fomoeth-a-new-crypto-startup-begins-its-presale-for-a-new-concept-mobile-app-nftagram-86600b3dd760

[]

2021-12-18 08:58:40.894000+00:00

['Nft', 'Bsc', 'Cryptocurrency', 'Instagram']

Title FomoETH new Crypto Startup begin presale new concept mobile app — NFTagramContent FomoETH new Crypto Startup begin presale new concept mobile app — NFTagram FomoETH Dec 18 2021·3 min read blockchain technology NonFungible Tokens NFT become integral part crypto industry According analyst possibility entire crypto industry die blockchain technology NFTs True fact NFTs time could even take crypto industry aspect revolutionary project combining blockchain network NFTs sound quite amazing right Yes FomoETH one integrates blockchain technology along NFT together FomoETH actually serf democratic platform focus towards it’s holder supporter platform Another aspiring fact native token FomoETH operation upon Ethereum ETH blockchain well Binance Smart Chain BSC Moreover 2 main attribute around complete project revolves around FomoETH token NFT project NFTagram 💫 Auto Reward Distribution ETH Regardless FomoETH allows it’s holder user decide vote opinion proposal betterment project making completely democratic aspect also reward distributed BSC Ethereum network holder It’s automatic reward distribution ETH ETH ERC20 WETH BEP20 transaction 📸 NFTagram NFTagram serf primary attribute FomoETH network Unique feature attribute every moment one’s life picture captured could converted NFTs remain blockchain forever Apart even feature mining NFTs even sell NFT upon wish NFTagram available App Apple store well Google Play store 💍 FomoETH Swap FomoETH Wallet addition FomoETH plan developing ‘FomoETH Swap’ launched around February 2022 followed another launch unique ‘FomoETH Wallet’ plan project hand FomoETH ecosystem quite rigid expanding towards future 💝 FomoETH Presale regard presale FomoETH token start first upon Binance Smart Chain December 22 2021 exactly 200am UTC followed sale Ethereum blockchain presale feature 431872120000 FomoETH token constitutes 4318 overall FomoETH token available price token 86374424 FomoETH per 1BNB 0 purchase fee maximum possible investment limited 5BNB minimum 05BNB 0 presale go 2 day ending December 24 2021 exactly 200am UTC 💝 FomoETH Public Sale public sale FomoETH token start December 24 2021 200am UTC 213765750000 FomoETH sale price 77733000 FomoETH per 1BNB 10 purchase fee 👑 Funding Previously FomoETH successfully raised seed funding 1M USD total June 21 2021 httpsfomoethgitbookiofomoethofficialwhitepaperfundamentalsfunding 📸 FomoETH Official Social Media Website httpswwwfomoethnet Whitepaper httpsfomoethgitbookiofomoethofficialwhitepaper Facebook httpswwwfacebookcomFomoEth Twitter httpstwittercomfomoeth Reddit httpswwwredditcomrfomoeth Github httpsgithubcomFOMOETH Telegram httpstmeFomoETHTags Nft Bsc Cryptocurrency Instagram

MELACOIN BEP20 PRESALE, AIRDROP & TOKEN OFFERING WHY RECIPIENTS PAY GAS FEES

Melacoin project implements an airdrop via cryptographic IOUs that users relay to a smart contract to collect their tokens at Airdrop.melacoin.org, paying for their own transaction gas costs, instead of the issuer. Minimum buy: 1,000,000 Mela tokens = 0.004BNB www.airdrop.melacoin.org Performing an airdrop the usual way can get costly and a bit difficult in technicalities, since it requires paying for gas costs to send the variable amount of Mela Bep20 tokens to a bunch of recipients. With Binance mainnet transaction costs being in the order of $0.20 to $1.56, implementing a massive airdrop can get rather expensive. With the implemented Melacoin Airdrop scheme, the bulk of the cost is offloaded to the recipients of the airdrop. To set up Melacoin Bep20 Airdrop, the issuer only needs to allow the Mela Bep20 contract to distribute tokens on their behalf, for example using token.approve(spacedrop, total_tokens_to_distribute) in the case of an Bep20 token. Then, the airdrop issuer must send off-chain (e.g., via email, or on a public website) a signed message that is unique for each recipient. Then, recipients can then send these messages to the Melacoin BEP20 smart contract to retrieve their tokens via claimTokens(). These messages are cryptographic IOUs that include: The token to be transferred. A sender, recipient, and token amount. A nonce (more on why this is necessary later). The signature of the sender. With these parameters, the smart contract can verify that in fact the sender did authorize this transaction, and execute a transaction on their behalf. Melacoin Airdrop allows user claim and collect tokens multiple times (that is, calling claimTokens BEP20() with the same parameters more than once). Since a multi-phase airdrop could entail sending the same amount of tokens to the same address multiple times, we allow the sender to provide a different nonce each time, effectively working around this limitation. Regarding costs. For the issuer, gas costs are reduced to setting up the spacedrop via calling approve() as explained above; Spacedrop is dramatically cheaper than a standard airdrop for the issuer. For recipients, the cost is comparable to a standard token transfer. The aggregate cost for a Spacedrop, including gas paid by issuer and recipients, is slighly higher than in a standard airdrop, since in the latter several token transfers can be lumped together in a single transaction. That said, the total cost should be in the same order of magnitude. Note that in Spacedrop recipients must actively collect the tokens they are granted. This may or may not be desirable. On one hand, the issuer can recover unclaimed tokens. Spacedrop does not help perform airdop spam, for better or worse. Finally, recipients must of course own some ether in order to pay for transaction costs. Again, this may not be desirable. Interestingly, the Spacedrop contract has no owner and does not require redeploying to implement different airdrops. None of that is required, since all the necessary data is encoded in the IOUs that recipients relay to the smart contract. One deployment of the smart contract should be forever good. Currently, the Spacedrop repository only includes the smart contract and basic tests. To dos are: a nice front-end to collect tokens, backend code to automate sending the info to recipients. A word of caution: this code has not been extensively tested. Use at your own risk!

https://medium.com/@MELACOIN_PROJECT/melacoin-bep20-presale-airdrop-token-offering-why-recipients-pay-gas-fees-1a07c5702a75

['Melacoin Project']

2021-12-26 10:11:05.225000+00:00

['Cryptocurrency', 'Crypto', 'Bsc', 'Token']

Title MELACOIN BEP20 PRESALE AIRDROP TOKEN OFFERING RECIPIENTS PAY GAS FEESContent Melacoin project implement airdrop via cryptographic IOUs user relay smart contract collect token Airdropmelacoinorg paying transaction gas cost instead issuer Minimum buy 1000000 Mela token 0004BNB wwwairdropmelacoinorg Performing airdrop usual way get costly bit difficult technicality since requires paying gas cost send variable amount Mela Bep20 token bunch recipient Binance mainnet transaction cost order 020 156 implementing massive airdrop get rather expensive implemented Melacoin Airdrop scheme bulk cost offloaded recipient airdrop set Melacoin Bep20 Airdrop issuer need allow Mela Bep20 contract distribute token behalf example using tokenapprovespacedrop totaltokenstodistribute case Bep20 token airdrop issuer must send offchain eg via email public website signed message unique recipient recipient send message Melacoin BEP20 smart contract retrieve token via claimTokens message cryptographic IOUs include token transferred sender recipient token amount nonce necessary later signature sender parameter smart contract verify fact sender authorize transaction execute transaction behalf Melacoin Airdrop allows user claim collect token multiple time calling claimTokens BEP20 parameter Since multiphase airdrop could entail sending amount token address multiple time allow sender provide different nonce time effectively working around limitation Regarding cost issuer gas cost reduced setting spacedrop via calling approve explained Spacedrop dramatically cheaper standard airdrop issuer recipient cost comparable standard token transfer aggregate cost Spacedrop including gas paid issuer recipient slighly higher standard airdrop since latter several token transfer lumped together single transaction said total cost order magnitude Note Spacedrop recipient must actively collect token granted may may desirable one hand issuer recover unclaimed token Spacedrop help perform airdop spam better worse Finally recipient must course ether order pay transaction cost may desirable Interestingly Spacedrop contract owner require redeploying implement different airdrop None required since necessary data encoded IOUs recipient relay smart contract One deployment smart contract forever good Currently Spacedrop repository includes smart contract basic test do nice frontend collect token backend code automate sending info recipient word caution code extensively tested Use riskTags Cryptocurrency Crypto Bsc Token

Belly is in Trade Mining & Farm & Pool with BabySwap!

Good morning, good afternoon, and good evening to our BABY sitters!! Let us introduce a new Farm and Pool from Belly! More is welcome, check this out to submit a request. Snack Snack Snack Pool🍫👶 Stake BABY tokens to earn Belly tokens! Total Tokens: 1,109,000 Belly Distribution duration: 30 days Start at Block height 13,844,530, approx. 12:00 PM UTC, December 27th End at Block height 14,708,530, approx. 12:00 PM UTC, January 26th Token rewards per block: 1.2835 Belly The 1x Farm & Trade Mining In order to host the Belly Snack Pool, we provide a Belly-USDT farm as well as trade mining that will have 1x BABY rewards for 30 days at the same time. What is CryptoPiece? CryptoPiece is a NFT game that focuses on gamers, made by gamers and for gamers. We want to have our players not only feeling relax, enjoying their favorite game, but also earning at the same time. Through our unique play to earn system, players can gather their crew by recruiting mercenary through a Mercenary Contract in Merc Centre. They then can sail their ship and go on an exciting adventure. By capturing criminals in Wanted list by the Government, players can earn Belly — ingame currency — and level up their Merc. To learn more about CryptoPiece, please visit our official communication channels Website: https://cryptopiece.online/ Twitter: https://twitter.com/CryptopieceNFT Telegram: https://t.me/cryptopiece_official How do you stake BABY to earn Belly rewards? If you are a BABY sitter which means you own BABY tokens, get in line here! BabySwap 101 is how to stake BABY with Belly pool. Visit this webpage: https://babyswap.finance/pools Click “Approve BABY” on the Belly Snack Pool Click on the stake button. Confirm the transaction. BEP20 Belly will also be circulating and transferable on BSC when we start the snack pool, so you will be able to harvest your Belly tokens and trade on BabySwap at any time! How do you stake Belly-USDT LP to earn BABY rewards? If you are a Belly holder, get in line here! BabySwap 102 is how to stake Belly-USDT LP in farm. Step 1 Get LP Go to the Liquidity page Click ‘Add Liquidity’. Select Belly & USDT and enter the amount. Check the details, and click ‘Supply’ Check the details, and click ‘Confirm Supply’ Confirm the transaction in your wallet. Done! You can click ‘View on BscScan’ to see your transaction details. Step 2 Stake LP Go to farms Select Belly-USDT farm Click ‘Approve Contract’ Click ‘Stake LP’ and enter the amount of LP, then click ‘Confirm’. Confirm the transaction in your wallet. Done! You can click ‘View on BscScan’ to see your transaction details. How to Earn BABY through Belly-USDT Trade Mining? Trade from Belly to USDT or from USDT to Belly, you will get BABY as trade mining rewards — simple as that! AUNTIE KINDLY REMINDER! ⚠️ The official Belly token contract address on Binance Smart Chain is: 0x3dfa90540ccdc77d543e6e61cacd5880f5c62391 Any other Belly token will be a scam and will result in a financial loss for users. Do not buy tokens from any other token address. Always verify the token address before purchasing tokens. If you receive airdrops from another address for Belly tokens, we advise you to ignore them. Principal’s Note 🍼Twitter 🍼Telegram 🍼Discord 🍼Docs

https://medium.com/@babyswap/belly-is-in-trade-mining-farm-pool-with-babyswap-51091929a38c

[]

2021-12-26 09:58:18.439000+00:00

['Babyswap', 'Bsc', 'Binance', 'Binance Smart Chain', 'Metaverse']

Title Belly Trade Mining Farm Pool BabySwapContent Good morning good afternoon good evening BABY sitter Let u introduce new Farm Pool Belly welcome check submit request Snack Snack Snack Pool🍫👶 Stake BABY token earn Belly token Total Tokens 1109000 Belly Distribution duration 30 day Start Block height 13844530 approx 1200 PM UTC December 27th End Block height 14708530 approx 1200 PM UTC January 26th Token reward per block 12835 Belly 1x Farm Trade Mining order host Belly Snack Pool provide BellyUSDT farm well trade mining 1x BABY reward 30 day time CryptoPiece CryptoPiece NFT game focus gamers made gamers gamers want player feeling relax enjoying favorite game also earning time unique play earn system player gather crew recruiting mercenary Mercenary Contract Merc Centre sail ship go exciting adventure capturing criminal Wanted list Government player earn Belly — ingame currency — level Merc learn CryptoPiece please visit official communication channel Website httpscryptopieceonline Twitter httpstwittercomCryptopieceNFT Telegram httpstmecryptopieceofficial stake BABY earn Belly reward BABY sitter mean BABY token get line BabySwap 101 stake BABY Belly pool Visit webpage httpsbabyswapfinancepools Click “Approve BABY” Belly Snack Pool Click stake button Confirm transaction BEP20 Belly also circulating transferable BSC start snack pool able harvest Belly token trade BabySwap time stake BellyUSDT LP earn BABY reward Belly holder get line BabySwap 102 stake BellyUSDT LP farm Step 1 Get LP Go Liquidity page Click ‘Add Liquidity’ Select Belly USDT enter amount Check detail click ‘Supply’ Check detail click ‘Confirm Supply’ Confirm transaction wallet Done click ‘View BscScan’ see transaction detail Step 2 Stake LP Go farm Select BellyUSDT farm Click ‘Approve Contract’ Click ‘Stake LP’ enter amount LP click ‘Confirm’ Confirm transaction wallet Done click ‘View BscScan’ see transaction detail Earn BABY BellyUSDT Trade Mining Trade Belly USDT USDT Belly get BABY trade mining reward — simple AUNTIE KINDLY REMINDER ⚠️ official Belly token contract address Binance Smart Chain 0x3dfa90540ccdc77d543e6e61cacd5880f5c62391 Belly token scam result financial loss user buy token token address Always verify token address purchasing token receive airdrop another address Belly token advise ignore Principal’s Note 🍼Twitter 🍼Telegram 🍼Discord 🍼DocsTags Babyswap Bsc Binance Binance Smart Chain Metaverse

How Fibonaut’s Revolutionary Chart Stabilization Works

How Fibonaut’s Revolutionary Chart Stabilization Works The following is taken from the Fibonaut whitepaper. Fibonaut, a BSC-based project, attempts to solve several common issues affecting other cryptocurrency tokens. Decentralized finance has made token creation easier than ever, creating a surge of new tokens each day. Some token creators try new and innovative concepts, though the vast majority of token contracts are carbon copies, changing little more than the name. What’s more, even with those that do offer something unique or different in way of tokenomics, most will fall short of expectations. The reality is that, no matter how ambitious or enticing a project, holders will want to take profits. Everyone invested into a project has the human desire of financial gain in mind at all times. We can consider “the market” to be the collective perception of each and every investor in a project. Because the market all has the same general goal in mind, to make financial gains, the market will more or less behave in a concurrent manner, not unlike a school of fish. Regardless of any small deviations, the group will more or less act predictably similar. As a token, especially the promising ones, increases in value so does the likelihood that its holders will take profits in order to realize their financial gains. Some of the sellers will sell early, some will sell later, and most will sell around the same time. Then, hopefully, after the price has decreased, more investors will choose to buy in and reset the cycle. However, in the fast-paced world of DeFi, this simple behavior can break a token, by crashing its price beyond repair. Because the market is a group of people, it is prone to emotional reaction and will panic at a declining price, further exacerbating the issue. What’s worse, when new investors join the market, they will (generally) be put off by a crashed token price. There are a few factors which contribute to this unfortunately common outcome: Whales — holders with an unusually high percentage of tokens relative to total supply Complete wallet dumps — holders are able to sell their entire wallets in one sell No transaction limitations — holders are able to sell anytime High circulating supply — tokens are plentiful and given away for free Airdrops — Some holders, who might also be whales, were sent their tokens without having to purchase them High taxes — users encounter high taxes when buying or selling a token, sometimes over 18% The above factors make a token crash all but inevitable. The only thing that could carry a project out of market dumps like that are those that have a good amount of community momentum. This, while nice, is very hard to keep going without major news or mainstream attention. Even then, it will require more and more to keep the price up as the market, still predictable, continues to try to dump at the first sign of profits. The Solution The solution to the classic problems of most tokens is Fibonaut’s approach to controlled, limited token sell frequencies. The average investor loses on the majority of their trades. Because the average investor is the market, they will create the same market cycles over and over. In traditional finance a company’s stock price can fluctuate knowing the company has gone nowhere. In DeFi with its inherent volatility, a simple fluctuation can cause a panic, subsequent crash, and spell the end of a token sometimes within hours of launch. The best way forward is to protect holders from themselves and the bad trades of others. Fibonaut does this by implementing the following safeguards: Max Wallet Control — No wallet can hold more 161.8 tokens, which is 1% of the supply, meaning no whales Quantity Limits — No wallet can sell more than 1.618 tokens at a time, meaning no complete wallet dumps causing a sudden drop in price Sell Frequency Limits — No wallet can sell more than once within each allotted interval (explained in the next section), meaning no sudden serial selling attempting to get around the Quantity Limitation Sell Intervals — Wallets can only sell in preset increasing intervals of time, meaning everyone must stagger their sells for longer amounts of time Limited Supply — With a small total supply of 16,180 tokens, and no minting nor self-reflection functions, Fibonaut will eventually encounter major supply shock, further increasing the price No Airdrops — Fibonaut will not airdrop any tokens to anyone, even the team, meaning no one will receive tokens without having to purchase them BUSD Rewards — Holders will receive rewards in BUSD (stablecoin) at 5% of each transaction proportional to their holdings, meaning longterm holders have a way to earn without selling Unique Contract Code — This contract has never been done before; it’s development has been catered specifically to solving the problems of price drop in traditional BSC and ETH-based tokens Sensible Taxes — A simple 10% flat tax applies to all transactions. 5% generates BUSD rewards, 3% automatically is added to token liquidity, and 2% goes to marketing and development of the token The above safeguards will dramatically protect the chart and long-term price action of the token. Huge price fluctuations will not be possible, and steady growth is inevitable. Many of the listed solutions have been done before in DeFi. However, their combination is what is important. Moreover, Fibonaut’s selling intervals are a revolutionary new addition to the traditional Solidity contract. Why It Works Fibonaut’s sell intervals prevent holders from selling any time they choose to. It effectively forces everyone to abide by the same schedule of long-term holding. However, they increment over time. Holders are only able to sell (up to 1.618 tokens) at each minute number of the Fibonacci sequence from the time of their first buy, with a 1-minute window (margin) for sells occurring in less than one hour (55 minutes), and a 16-minute margin for sells occurring after an hour. If you are familiar with the Fibonacci sequence, this means exponential growth in how long the holder must wait for their next sell. This means that to sell a maximum (1%) wallet of 161.8 tokens, the holder must meet each sell interval (including 1 minute after they bought) for a total of 1,226,132,595,394,188,293,000,174,702,095,995 years. Holders are not able to cheat the system, either. Buying again will not reset the _firstBuy timestamp, so their first buy will set the timetable of allowed sell points and margins for their wallet’s lifetime. Holders are not able to transfer tokens from wallet to wallet to evade this system. How It Works Fibonacci Sequence — Each Number is a Sell Interval _fibArray = 1, 2, 3, 5, 8, 13, 21, 34, 55, 89 … If a user, Bob, decides to buy any amount of Fibonaut (FIB), at 12:00pm, the contract will automatically timestamp this buy. He is then able to sell up to 1.618 tokens one time each interval in the above Fibonacci sequence. Each interval is one minute passed from his buy time. Because it is almost impossible to sell exactly at the right time, the contract first allows him a one-minute margin of error to do so. Therefore, he can sell at 12:01pm, 1 minute after he has bought. He can, consequently, sell 2 and 3 minutes after, meaning (because of the 1-minute margin) that he can sell anytime within the first 3 minutes from purchase. 12:00pm — Bob buys 100 tokens without checking the contract 12:01pm — Bob sells 1 token as a test 12:02–12:13 — Bob was watching the chart and missed his next sells 12:15 — Bob notices the price has risen and attempts to sell his remaining 99 tokens (common thought process for a token investor). The sell is rejected by the contract. 12:16–1:00pm — Bob researches the token and attempts to sell unsuccessfully again. He realizes he needs to check his wallet transaction history and find his _firstBuy in order to time his next sell. He realizes he can sell again at 1:29pm. 1:32pm — Bob sells 1.618 tokens slightly after the set sell time, though within the allowed margin of 16 minutes. He tries to sell again and is rejected because he has already sold within this sell interval. His wallet is still holding 97.382 tokens. Because Bob, and everyone else, must wait longer and longer for their next sell point, they won’t sell many tokens. However, because most people will not sell many tokens, the price will continue to climb. Market psychology is to panic at the sight of red candles in a chart, and to get excited at green ones. A steady fast-rising chart will cause pandemonium. As the price of the token grows, selling 1.618 tokens could very easily mean far more gain than Bob initially invested. The 9th number in the sequence is 55. At this point, all holders are rewarded for their patience with larger margins of error to sell in. For every interval at or after 55 minutes, Bob has a 16-minute window to sell once. He doesn’t, however, have any obligation to sell. After the first ten numbers in the sequence (0, and the first 1 have been omitted since that wouldn’t make sense for this contract) the wait times start to increase exponentially. Bob will very soon need to wait hours for his next sell point. And then days, weeks, months, years, decades. He will likely only be able to sell 38 times since he will need to wait 74~ years for his 38th sell. At this point, you might wonder why the maximum wallet is 161.8, since no holder of that many tokens will ever sell them all. The reason the maximum wallet is higher than something like 38, other than that it matches the golden ratio for our theme’s sake, is that the more tokens a user holds the higher their BUSD rewards. This encourages investors to purchase maximum wallets in order to reap long-term rewards in a stablecoin. This is enticing as they won’t need to expect any sudden drops later on. What’s more, this helps lock up supply and effectively deflates the token, as 123.8 tokens will likely never be sold. Any token whose supply nearly runs out will experience what is known as a supply shock, causing dramatic price increase. Every aspect, feature, and limitation in Fibonaut has been designed to create the most compelling chart ever. Our exponential growth using the Fibonacci sequence goes hand in hand with our astronomy theme, aiming to send Fibonaut even further than the moon. Website: www.fibonaut.net WhitePaper: https://www.fibonaut.net/s/Fibonaut-Whitepaper.pdf Telegram: https://t.me/+CnRj5ezE2j42M2Qx

https://medium.com/@fibonaut/how-fibonauts-revolutionary-chart-stabilization-works-34aa4e917413

[]

2021-12-29 16:02:30.343000+00:00

['Crytocurrency', 'Coins', 'Token', 'Bsc']

Title Fibonaut’s Revolutionary Chart Stabilization WorksContent Fibonaut’s Revolutionary Chart Stabilization Works following taken Fibonaut whitepaper Fibonaut BSCbased project attempt solve several common issue affecting cryptocurrency token Decentralized finance made token creation easier ever creating surge new token day token creator try new innovative concept though vast majority token contract carbon copy changing little name What’s even offer something unique different way tokenomics fall short expectation reality matter ambitious enticing project holder want take profit Everyone invested project human desire financial gain mind time consider “the market” collective perception every investor project market general goal mind make financial gain market le behave concurrent manner unlike school fish Regardless small deviation group le act predictably similar token especially promising one increase value likelihood holder take profit order realize financial gain seller sell early sell later sell around time hopefully price decreased investor choose buy reset cycle However fastpaced world DeFi simple behavior break token crashing price beyond repair market group people prone emotional reaction panic declining price exacerbating issue What’s worse new investor join market generally put crashed token price factor contribute unfortunately common outcome Whales — holder unusually high percentage token relative total supply Complete wallet dump — holder able sell entire wallet one sell transaction limitation — holder able sell anytime High circulating supply — token plentiful given away free Airdrops — holder might also whale sent token without purchase High tax — user encounter high tax buying selling token sometimes 18 factor make token crash inevitable thing could carry project market dump like good amount community momentum nice hard keep going without major news mainstream attention Even require keep price market still predictable continues try dump first sign profit Solution solution classic problem token Fibonaut’s approach controlled limited token sell frequency average investor loses majority trade average investor market create market cycle traditional finance company’s stock price fluctuate knowing company gone nowhere DeFi inherent volatility simple fluctuation cause panic subsequent crash spell end token sometimes within hour launch best way forward protect holder bad trade others Fibonaut implementing following safeguard Max Wallet Control — wallet hold 1618 token 1 supply meaning whale Quantity Limits — wallet sell 1618 token time meaning complete wallet dump causing sudden drop price Sell Frequency Limits — wallet sell within allotted interval explained next section meaning sudden serial selling attempting get around Quantity Limitation Sell Intervals — Wallets sell preset increasing interval time meaning everyone must stagger sell longer amount time Limited Supply — small total supply 16180 token minting selfreflection function Fibonaut eventually encounter major supply shock increasing price Airdrops — Fibonaut airdrop token anyone even team meaning one receive token without purchase BUSD Rewards — Holders receive reward BUSD stablecoin 5 transaction proportional holding meaning longterm holder way earn without selling Unique Contract Code — contract never done it’s development catered specifically solving problem price drop traditional BSC ETHbased token Sensible Taxes — simple 10 flat tax applies transaction 5 generates BUSD reward 3 automatically added token liquidity 2 go marketing development token safeguard dramatically protect chart longterm price action token Huge price fluctuation possible steady growth inevitable Many listed solution done DeFi However combination important Moreover Fibonaut’s selling interval revolutionary new addition traditional Solidity contract Works Fibonaut’s sell interval prevent holder selling time choose effectively force everyone abide schedule longterm holding However increment time Holders able sell 1618 token minute number Fibonacci sequence time first buy 1minute window margin sell occurring le one hour 55 minute 16minute margin sell occurring hour familiar Fibonacci sequence mean exponential growth long holder must wait next sell mean sell maximum 1 wallet 1618 token holder must meet sell interval including 1 minute bought total 1226132595394188293000174702095995 year Holders able cheat system either Buying reset firstBuy timestamp first buy set timetable allowed sell point margin wallet’s lifetime Holders able transfer token wallet wallet evade system Works Fibonacci Sequence — Number Sell Interval fibArray 1 2 3 5 8 13 21 34 55 89 … user Bob decides buy amount Fibonaut FIB 1200pm contract automatically timestamp buy able sell 1618 token one time interval Fibonacci sequence interval one minute passed buy time almost impossible sell exactly right time contract first allows oneminute margin error Therefore sell 1201pm 1 minute bought consequently sell 2 3 minute meaning 1minute margin sell anytime within first 3 minute purchase 1200pm — Bob buy 100 token without checking contract 1201pm — Bob sell 1 token test 1202–1213 — Bob watching chart missed next sell 1215 — Bob notice price risen attempt sell remaining 99 token common thought process token investor sell rejected contract 1216–100pm — Bob research token attempt sell unsuccessfully realizes need check wallet transaction history find firstBuy order time next sell realizes sell 129pm 132pm — Bob sell 1618 token slightly set sell time though within allowed margin 16 minute try sell rejected already sold within sell interval wallet still holding 97382 token Bob everyone else must wait longer longer next sell point won’t sell many token However people sell many token price continue climb Market psychology panic sight red candle chart get excited green one steady fastrising chart cause pandemonium price token grows selling 1618 token could easily mean far gain Bob initially invested 9th number sequence 55 point holder rewarded patience larger margin error sell every interval 55 minute Bob 16minute window sell doesn’t however obligation sell first ten number sequence 0 first 1 omitted since wouldn’t make sense contract wait time start increase exponentially Bob soon need wait hour next sell point day week month year decade likely able sell 38 time since need wait 74 year 38th sell point might wonder maximum wallet 1618 since holder many token ever sell reason maximum wallet higher something like 38 match golden ratio theme’s sake token user hold higher BUSD reward encourages investor purchase maximum wallet order reap longterm reward stablecoin enticing won’t need expect sudden drop later What’s help lock supply effectively deflates token 1238 token likely never sold token whose supply nearly run experience known supply shock causing dramatic price increase Every aspect feature limitation Fibonaut designed create compelling chart ever exponential growth using Fibonacci sequence go hand hand astronomy theme aiming send Fibonaut even moon Website wwwfibonautnet WhitePaper httpswwwfibonautnetsFibonautWhitepaperpdf Telegram httpstmeCnRj5ezE2j42M2QxTags Crytocurrency Coins Token Bsc

World’s First Halal NFT Marketplace Souq NFT Powered by MRHB DeFi Launches with ‘Hallal Gachyi’ from Gachyi Land

World’s First Halal NFT Marketplace Souq NFT Powered by MRHB DeFi Launches with ‘Hallal Gachyi’ from Gachyi Land Melbourne, Australia, December 23rd, 2021 — The world’s first ethical and inclusive DeFi ecosystem platform MRHB DeFi has launched its highly anticipated Souq NFT marketplace. Partnering with Gachyi Land, the first blockchain gaming gacha-launchpad ecosystem, the two parties will mint and issue Hallal Gachyi, a unique Gachyi Land-themed NFT collection created for Souq NFT. Souq NFT is the first NFT marketplace in the world focussed on creating an ethical and halal marketplace for digital art and other NFT assets. Artists on the platform follow image, audio and video content guidelines such as no hate speech, racism or nudity, and must verify that the artworks are original pieces (no rip-offs of existing NFTs). The MRHB DeFi collaboration with Gachyi Land will see the latter create 1,410 Hallal Gachyi NFTs (otherwise known as ‘Rimos’). MRHB DeFi will create and deploy the smart contract for these NFTs and Hallal Gachyi will be sold on Souq NFT marketplace. “Our vision to create an inclusive, ethical DeFi and NFT ecosystem continues to take shape,” says Deniz Dalkilic, CTO of MRHB DeFi. “The Hallal Gachyi collection is the result of a unique collaboration with Gachyi Land and demonstrates our commitment to launching quality crypto products that meet and hopefully exceed community expectations.” “NFTs are the building blocks of our digital future — they allow us to own digital items in ways we have never been able to before,” comments May Wong, founder of Gachyi Land. “We wanted to provide a colorful and cute entry point into the NFT space for the Islamic community, in the form of a ‘Rimo’. The NFT space has shown us that early adoption of NFTs that gain value over time represents opportunity. We are excited to release Hallal Gachyi with MRHB and provide value to their community!” Hallal Gachyi NFTs will be issued on the BSC blockchain using the ERC-721 token standard. NFT owners will be able to play a mini-game at a future date where they can earn rewards such as $MRHB tokens and $Polymer tokens. The NFTs will also receive utility in Gachyi Land’s MMO RPG (Massively Multiplayer Online Role-Playing Game), expected to be released in 2023. Both parties will promote the new venture together on their respective platforms and are exploring future plans for MRHB to create other gamification models that integrate with the MRHB ecosystem. A Shared Vision to Empower Communities The Gachyi Land platform was created with the desire to empower artists with its disruptive NFT ecosystem. Gachyi Land provides artists with the platform, community, technology and tools they need to display and sell their work, and further explore the possibilities of the digital realm. Similarly, MRHB DeFi was conceived with the goal of giving excluded and crypto-cautious communities better access to cryptoverse opportunities with a key focus on the provision of decentralized financial services that avoid interest-based profits and lending. MRHB DeFi bridges the existing gap between crypto offerings and the ethical faith-based community. The journey to an inclusive, ethical DeFi cryptoverse has not been a lonely one for MRHB DeFi. The halal project is currently backed by investors and partners which include Polygon Technology, Sheesha Finance, Blockchain Australia, Australian Gulf Capital, Mozaic, Contango Digital Assets, NewTribe Capital, Masary Capital, ZKSync, Acreditus Partners, EMGS Group, Sinofy Group, MKD Capital and others. In collaboration with management consulting group, Sinofy, MRHB DeFi has also organized an NFT art competition, designed for creators and artists, within the framework of the DEV Challenge Season 18 championships in Ukraine. More information on how to participate can be found in the MRHB DeFi Medium blog. December is turning out to be a very exciting and busy month for MRHB DeFi, having launched their IDO yesterday on December 22nd. The $MRHB tokens were sold out on the DODO launchpad in half a day, with the second launchpad ZeeDO catching up. Upon completion of IDO, TGE (Token Generation Event) will take place on December 24th 1PM UTC/GMT, which will then be closely followed by its listing on the popular DEX Pancakeswap. About MRHB DeFi MRHB DeFi is a halal, decentralized finance platform built to embody the true spirit of an “Ethical and Inclusive DeFi” by following faith-based financial and business principles, where all excluded communities can benefit from the full empowerment potential of DeFi. The diverse team comprises researchers, technocrats, influencers, Islamic fintech experts & business entrepreneurs, who came together to ensure that MRHB DeFi prevails in a manner that will impact society as a whole, essentially bridging the gap between the faith-conscious communities and the blockchain world. MRHB DeFi Official Channels Website: https://marhabadefi.com Twitter: https://twitter.com/marhabadefi Telegram: https://t.me/mdf_official Telegram Announcements: https://t.me/marhabadefi_ANN YouTube: https://www.youtube.com/channel/UCHuvZG9DbS5ffeoqLX_bERg Medium: https://medium.com/@mrhbdefi LinkedIn: https://www.linkedin.com/company/marhabadefi Facebook: https://www.facebook.com/MRHB-DeFi-105893235209147 Telegram (Arabic): https://t.me/mdf_arabic Telegram (Russian): https://t.me/marhabadefi_russia Telegram (Turkish): https://t.me/MarhabaDefiTR Telegram (Persian): https://t.me/mrhbdefi_persian Telegram (Urdu/Hindi): https://t.me/MRHBDeFi_Urdu_Hindi About Gachyi Land Gachyi Land is building an ecosystem that consists of an NFT Launchpad and Play-To-Earn MMORPG. NFTS issued on their platform will be incorporated within the ecosystem to serve either an in-game functionality such as boosts or exclusive pre-sale access, or their utility can be built into future games. With its disruptive Play2Earn MMORPG, Gachyi is providing artists with the platform, community, technology, and tools they need to unleash their creativity and gain the exposure they deserve. NFTs will be minted via Gachyi’s interactive gachapon machines on the Polygon blockchain based on the ERC-721 token standard, priced in MATIC. Gachyi Land Official Links Website: https://gachyiland.com/ Twitter: https://twitter.com/GachyiLand

https://medium.com/@yourprstrategist/worlds-first-halal-nft-marketplace-souq-nft-powered-by-mrhb-defi-launches-with-hallal-gachyi-855571e3f2af

[]

2021-12-29 05:17:53.160000+00:00

['Bsc', 'Ido']

Title World’s First Halal NFT Marketplace Souq NFT Powered MRHB DeFi Launches ‘Hallal Gachyi’ Gachyi LandContent World’s First Halal NFT Marketplace Souq NFT Powered MRHB DeFi Launches ‘Hallal Gachyi’ Gachyi Land Melbourne Australia December 23rd 2021 — world’s first ethical inclusive DeFi ecosystem platform MRHB DeFi launched highly anticipated Souq NFT marketplace Partnering Gachyi Land first blockchain gaming gachalaunchpad ecosystem two party mint issue Hallal Gachyi unique Gachyi Landthemed NFT collection created Souq NFT Souq NFT first NFT marketplace world focussed creating ethical halal marketplace digital art NFT asset Artists platform follow image audio video content guideline hate speech racism nudity must verify artwork original piece ripoffs existing NFTs MRHB DeFi collaboration Gachyi Land see latter create 1410 Hallal Gachyi NFTs otherwise known ‘Rimos’ MRHB DeFi create deploy smart contract NFTs Hallal Gachyi sold Souq NFT marketplace “Our vision create inclusive ethical DeFi NFT ecosystem continues take shape” say Deniz Dalkilic CTO MRHB DeFi “The Hallal Gachyi collection result unique collaboration Gachyi Land demonstrates commitment launching quality crypto product meet hopefully exceed community expectations” “NFTs building block digital future — allow u digital item way never able before” comment May Wong founder Gachyi Land “We wanted provide colorful cute entry point NFT space Islamic community form ‘Rimo’ NFT space shown u early adoption NFTs gain value time represents opportunity excited release Hallal Gachyi MRHB provide value community” Hallal Gachyi NFTs issued BSC blockchain using ERC721 token standard NFT owner able play minigame future date earn reward MRHB token Polymer token NFTs also receive utility Gachyi Land’s MMO RPG Massively Multiplayer Online RolePlaying Game expected released 2023 party promote new venture together respective platform exploring future plan MRHB create gamification model integrate MRHB ecosystem Shared Vision Empower Communities Gachyi Land platform created desire empower artist disruptive NFT ecosystem Gachyi Land provides artist platform community technology tool need display sell work explore possibility digital realm Similarly MRHB DeFi conceived goal giving excluded cryptocautious community better access cryptoverse opportunity key focus provision decentralized financial service avoid interestbased profit lending MRHB DeFi bridge existing gap crypto offering ethical faithbased community journey inclusive ethical DeFi cryptoverse lonely one MRHB DeFi halal project currently backed investor partner include Polygon Technology Sheesha Finance Blockchain Australia Australian Gulf Capital Mozaic Contango Digital Assets NewTribe Capital Masary Capital ZKSync Acreditus Partners EMGS Group Sinofy Group MKD Capital others collaboration management consulting group Sinofy MRHB DeFi also organized NFT art competition designed creator artist within framework DEV Challenge Season 18 championship Ukraine information participate found MRHB DeFi Medium blog December turning exciting busy month MRHB DeFi launched IDO yesterday December 22nd MRHB token sold DODO launchpad half day second launchpad ZeeDO catching Upon completion IDO TGE Token Generation Event take place December 24th 1PM UTCGMT closely followed listing popular DEX Pancakeswap MRHB DeFi MRHB DeFi halal decentralized finance platform built embody true spirit “Ethical Inclusive DeFi” following faithbased financial business principle excluded community benefit full empowerment potential DeFi diverse team comprises researcher technocrat influencers Islamic fintech expert business entrepreneur came together ensure MRHB DeFi prevails manner impact society whole essentially bridging gap faithconscious community blockchain world MRHB DeFi Official Channels Website httpsmarhabadeficom Twitter httpstwittercommarhabadefi Telegram httpstmemdfofficial Telegram Announcements httpstmemarhabadefiANN YouTube httpswwwyoutubecomchannelUCHuvZG9DbS5ffeoqLXbERg Medium httpsmediumcommrhbdefi LinkedIn httpswwwlinkedincomcompanymarhabadefi Facebook httpswwwfacebookcomMRHBDeFi105893235209147 Telegram Arabic httpstmemdfarabic Telegram Russian httpstmemarhabadefirussia Telegram Turkish httpstmeMarhabaDefiTR Telegram Persian httpstmemrhbdefipersian Telegram UrduHindi httpstmeMRHBDeFiUrduHindi Gachyi Land Gachyi Land building ecosystem consists NFT Launchpad PlayToEarn MMORPG NFTS issued platform incorporated within ecosystem serve either ingame functionality boost exclusive presale access utility built future game disruptive Play2Earn MMORPG Gachyi providing artist platform community technology tool need unleash creativity gain exposure deserve NFTs minted via Gachyi’s interactive gachapon machine Polygon blockchain based ERC721 token standard priced MATIC Gachyi Land Official Links Website httpsgachyilandcom Twitter httpstwittercomGachyiLandTags Bsc Ido

Kikswap.com $KIK token excellently passed SolidProof Smart Contract audit

Kikswap.com $KIK token excellently passed SolidProof Smart Contract audit Kikswap is a specified Crosschain DEX and staking platform for meme tokens. From staking these meme tokens to trading them with multi chain features, so it was important to us to audit the $KIK smart contract with the best smart contract security auditor on the blockchain ecosystem. SolidProof leads blockchain security by pioneering the use of cutting-edge Formal Verification technology on smart contracts and blockchains. Unlike traditional security audits, Formal Verification mathematically proves program correctness and hacker-resistance. What is smart contract audit? A smart contract audit is an extensive methodical examination and analysis of a smart contract’s code that is used to interact with a cryptocurrency or blockchain. This process is conducted to discover errors, issues and security vulnerabilities in the code in order to suggest improvements and ways to fix them. Generally, smart contract audits are necessary, because most of the contracts deal with financial assets and/or valuable items. SolidProof assess whether there are possible security errors in the $KIK contract, and if there are any errors in the contracts report is attach, they have described in a report that which issues critical, medium and low risk, Solidproof external audit give a chance us to improve the security of investments of the whole community in upcoming presale of kikswap. About SolidProof: Solid Proof was founded as a community-driven company, and they want to thank our community for being so supportive! Solidproof is Security Audits, DeFi Trust Made in Germany. Solidproof Socialmedia 🔹Group: https://t.me/solidproof 🔹Twitter: https://twitter.com/solidproof_io 🔹Facebook: https://www.facebook.com/solidproof.io Social Links: Website: https://kikswap.com/ Application: https://app.kikswap.com/ Whitepaper: https://kikswap.com/whitepaper.pdf Medium: https://kiktoken.medium.com/ Github: https://github.com/kiktoken Telegram: t.me/kiktoken Twitter: https://twitter.com/kiktoken Facebook: https://www.facebook.com/Kiktoken YouTube: https://www.youtube.com/channel/UCS-KTygQptMhtnlFVEyFJng Reddit: https://www.reddit.com/user/kiktoken Discord: https://discord.gg/CRRK3yPq Media: https://finance.yahoo.com/news/kikswap-com-not-another-meme-000000828.html

https://medium.com/@kiktoken/kikswap-com-kik-token-excellently-passed-solidproof-smart-contract-audit-ddda73f94525

['Kikswap', 'Official']

2021-12-26 13:07:06.914000+00:00

['Kwikswap', 'Kik', 'Binance', 'Bnb', 'Bsc']

Title Kikswapcom KIK token excellently passed SolidProof Smart Contract auditContent Kikswapcom KIK token excellently passed SolidProof Smart Contract audit Kikswap specified Crosschain DEX staking platform meme token staking meme token trading multi chain feature important u audit KIK smart contract best smart contract security auditor blockchain ecosystem SolidProof lead blockchain security pioneering use cuttingedge Formal Verification technology smart contract blockchains Unlike traditional security audit Formal Verification mathematically prof program correctness hackerresistance smart contract audit smart contract audit extensive methodical examination analysis smart contract’s code used interact cryptocurrency blockchain process conducted discover error issue security vulnerability code order suggest improvement way fix Generally smart contract audit necessary contract deal financial asset andor valuable item SolidProof ass whether possible security error KIK contract error contract report attach described report issue critical medium low risk Solidproof external audit give chance u improve security investment whole community upcoming presale kikswap SolidProof Solid Proof founded communitydriven company want thank community supportive Solidproof Security Audits DeFi Trust Made Germany Solidproof Socialmedia 🔹Group httpstmesolidproof 🔹Twitter httpstwittercomsolidproofio 🔹Facebook httpswwwfacebookcomsolidproofio Social Links Website httpskikswapcom Application httpsappkikswapcom Whitepaper httpskikswapcomwhitepaperpdf Medium httpskiktokenmediumcom Github httpsgithubcomkiktoken Telegram tmekiktoken Twitter httpstwittercomkiktoken Facebook httpswwwfacebookcomKiktoken YouTube httpswwwyoutubecomchannelUCSKTygQptMhtnlFVEyFJng Reddit httpswwwredditcomuserkiktoken Discord httpsdiscordggCRRK3yPq Media httpsfinanceyahoocomnewskikswapcomnotanothermeme000000828htmlTags Kwikswap Kik Binance Bnb Bsc

XcelDefi — The Next Generation Decentralized Exchange

The digital product blockchain age has just begun. We are here to support the establishment of a decentralized digital product ecosystem through the use of XcelLabs and its native coin. Using the startup’s distribution tools, developers will be able to monetize their digital products by selling tokens. You’re about to learn the fundamentals of beginning your own digital goods reselling business. Get yourself ready! DeFi ecosystem XcelDefi, which is based on blockchain technology, intends to become the world’s first comprehensive DeFi ecosystem. This system will be financed by $XLD worth of tokens. XcelDefi’s blockchain project has as its ultimate goal the decentralization of financial institutions and the removal of financial barriers. Investors of different races, ages, and cultural backgrounds can now engage in the financial markets thanks to the availability of XcelDefi. Why XcelDefi Thanks to XcelDefi, DeFi products will have new applications and standards defined in the future. To take advantage of the recent “DeFi explosion,” XcelDefi may be necessary. Since their ultimate goal is a decentralized economy, they started using $XLD to get there. The Xcel brand’s original goal included travel, bitcoin, and DeFi/Investment. On the Binance Smart Chain, XcelDefi is constructed, which is one of the world’s most secure and speedy chains. XcelSwap P2P trading is made possible via the decentralized exchange XcelSwap’s usage of the AMM idea. XcelSwap is a must-have feature in the XcelDeFi ecosystem. Ultimately, we want to be the first decentralized exchange that everyone can use. Most DeFi systems offer a terrible user experience for first-time DeFi users. Decentralized exchanges like XcelSwap let you trade with other people’s money while maintaining your privacy. For the purposes of exchanging tokens, there is no requirement to grant XcelDefi custody of any tokens. New projects can now be linked to the intended market thanks to XcelDefi’s network of liquidity providers. XcelPay Wallet Open-source, decentralized Bitcoin wallet XcelPay Wallet is now available. The $XLD utility token can be used to make purchases by XcelPay wallet users. A PR campaign is the best way to get the word out about cryptocurrencies like $XLD. XcelPay can also be used to buy gift cards and mobile phone recharges. On the Binance Smart Chain, XinFin Network and Ethereum Classic tokens can also be used. Open a wallet account with XcelPay and start trading cryptocurrencies right away. XcelPay wallets are available. Tokenomics A total of 111,000,000 XLDs are thought to be in existence. For a growing ecosystem, there is a limit to the amount of new tokens that may be made available. See how XcelDefi recommends allocating and distributing resources in the following table: Regular token burns are required under XcelDefi’s tokenomics to keep deflation under control and inflation from taking hold. The entire supply would be reduced by over 41% over the length of the project. The following is how the burns have been apportioned and accounted for: Conclusion DeFi has taken a giant step ahead as a result of this. When it comes to cutting-edge technology, XcelDefi is the go-to choice for its clients. According to XcelDefi, blockchain technology has the potential to be used in the real world.. Even if this goal is achieved, there will remain billions of dollars worth of gold left to be mined. If you combine the best of diverse industries, you’ll get a wide selection of digital solutions. Traditional funding will also be replaced by XcelDefi. Blockchain technology has been used in numerous industries by XcelDefi, which shows that this goal has been taken seriously. #xceldefi #xcelswap #BSC #XLD #DeFi #XcelLab #DEX #crypto #BinanceSmartChain #decentralizedfinance #defimarket #defiwallet #defilending #defistaking #pancakeswap #investinxld #buyxld For More Information Visit : Learn more about DafriBank: https://xceldefi.com/ Telegram group: https://t.me/XcelToken Facebook: https://www.facebook.com/XcelDefiOfficial Twitter: https://twitter.com/XcelDefi Instagram: https://www.instagram.com/xceldefi/ Follow DafriBank on Linkedin: https://www.linkedin.com/in/xcelpaywallet/ Reddit: https://reddit.com/r/xceldefi Discord: https://discord.gg/acUKN6nCYa Medium: https://xceldefi.medium.com/ Writer : Bitcointalk Username : Zahwatul BitcoinTalk Profile URL: https://bitcointalk.org/index.php?action=profile;u=3397556 BSC address (from XcelPay Wallet): 0x3bcCDfe70ba92Ae5eE7fa7a02AE2195F97b7DFdD

https://medium.com/@zahwatul/xceldefi-the-next-generation-decentralized-exchange-ef33b6557867

['Zahwatul Ulya']

2021-12-29 16:48:52.736000+00:00

['Xceldefi', 'Xcelswap', 'Bsc', 'Xld', 'Xcellab']

Title XcelDefi — Next Generation Decentralized ExchangeContent digital product blockchain age begun support establishment decentralized digital product ecosystem use XcelLabs native coin Using startup’s distribution tool developer able monetize digital product selling token You’re learn fundamental beginning digital good reselling business Get ready DeFi ecosystem XcelDefi based blockchain technology intends become world’s first comprehensive DeFi ecosystem system financed XLD worth token XcelDefi’s blockchain project ultimate goal decentralization financial institution removal financial barrier Investors different race age cultural background engage financial market thanks availability XcelDefi XcelDefi Thanks XcelDefi DeFi product new application standard defined future take advantage recent “DeFi explosion” XcelDefi may necessary Since ultimate goal decentralized economy started using XLD get Xcel brand’s original goal included travel bitcoin DeFiInvestment Binance Smart Chain XcelDefi constructed one world’s secure speedy chain XcelSwap P2P trading made possible via decentralized exchange XcelSwap’s usage AMM idea XcelSwap musthave feature XcelDeFi ecosystem Ultimately want first decentralized exchange everyone use DeFi system offer terrible user experience firsttime DeFi user Decentralized exchange like XcelSwap let trade people’s money maintaining privacy purpose exchanging token requirement grant XcelDefi custody token New project linked intended market thanks XcelDefi’s network liquidity provider XcelPay Wallet Opensource decentralized Bitcoin wallet XcelPay Wallet available XLD utility token used make purchase XcelPay wallet user PR campaign best way get word cryptocurrencies like XLD XcelPay also used buy gift card mobile phone recharges Binance Smart Chain XinFin Network Ethereum Classic token also used Open wallet account XcelPay start trading cryptocurrencies right away XcelPay wallet available Tokenomics total 111000000 XLDs thought existence growing ecosystem limit amount new token may made available See XcelDefi recommends allocating distributing resource following table Regular token burn required XcelDefi’s tokenomics keep deflation control inflation taking hold entire supply would reduced 41 length project following burn apportioned accounted Conclusion DeFi taken giant step ahead result come cuttingedge technology XcelDefi goto choice client According XcelDefi blockchain technology potential used real world Even goal achieved remain billion dollar worth gold left mined combine best diverse industry you’ll get wide selection digital solution Traditional funding also replaced XcelDefi Blockchain technology used numerous industry XcelDefi show goal taken seriously xceldefi xcelswap BSC XLD DeFi XcelLab DEX crypto BinanceSmartChain decentralizedfinance defimarket defiwallet defilending defistaking pancakeswap investinxld buyxld Information Visit Learn DafriBank httpsxceldeficom Telegram group httpstmeXcelToken Facebook httpswwwfacebookcomXcelDefiOfficial Twitter httpstwittercomXcelDefi Instagram httpswwwinstagramcomxceldefi Follow DafriBank Linkedin httpswwwlinkedincominxcelpaywallet Reddit httpsredditcomrxceldefi Discord httpsdiscordggacUKN6nCYa Medium httpsxceldefimediumcom Writer Bitcointalk Username Zahwatul BitcoinTalk Profile URL httpsbitcointalkorgindexphpactionprofileu3397556 BSC address XcelPay Wallet 0x3bcCDfe70ba92Ae5eE7fa7a02AE2195F97b7DFdDTags Xceldefi Xcelswap Bsc Xld Xcellab

What is FeeNix($FNX) Token?

What is FeeNix($FNX) Token? In this article, we’ll discuss information about the FeeNix project and $FNX token FeeNix is a hyper-deflationary token, which rewards investors for holding tokens long term, while also incorporating the Buyback approach currently present in the stock market. FeeNix is one of the first cryptocurrencies ever to include automatic Buyback. What is Buyback? If a particular stock has low value, but has the potential to perform better in the future, often companies will announce a buyback of the stock in the open market. Once companies announce the buyback, investors gain more confidence to purchase, and hold the stock as well. Additionally, the demand increases as the company starts buying the stock, which ultimately will drive the stock to raise. At FeeNix, we chose to apply the Buyback concept to cryptocurrency, and encourage investors to hold the token. Why invest in FeeNix? FeeNix token holders are not only benefited through static rewards but also by the Buy-Back process of the contract. As part of Buy-Back process, contract takes care of buying back some of the tokens and burn them whenever a sell happens. What’s So Great About That? There are 3 advantages: 1. Raise in Value ○ After the tokens from the Liquidity pool are bought, the new BNB amount is added to the pool and the amount of the tokens are reduced, which results in an increase in price. 2. Free BNB ○ Once those tokens are burnt, it is like adding free BNB to the pool as there are no tokens to sell in the future. 3. Trust & Reliability ○ Investors can be relentlessly hesitant, and often get spooked by a bearish market. Owners are not ready to renounce the ownership, because of its use when some things need to be changed. **Bonus Holder Advantages ** ● 2% rewards redistributed on every transaction ● Join a trusted network of investors, who are confident in the BuyBack contract, and understand the potential for growth in implementing this concept. ● Once the investors know that contract always buys after every sell, they feel confident about raise of the price and continue holding Tax Breakdown ➔ 3% rewards to holders ➔ 4% marketing tax ➔ 3% Buy-Back tax ➔ Slippage: 11.4% Tokenomics 1000000000: 1 BILLION INITIAL SUPPLY DEV WALLETS: 5% MARKETING AND PROMOTIONS WALLET: 5% FUTURE EXCHANGE LISTINGS: 15% AIRDROPS:10% LIQUIDITY: 35% INITIAL BURN: 30% TAXES: 3%: REWARDS TO HOLDERS 4%: MARKETING TAX 3%: BUY-BACK TAX* 11.4%: SLIPPAGE *will be utilized to keep the price of the token in check by buying back the tokens and burning them How and Where to Buy $FNX token? FeeNix token is now live on the Binance mainnet. The token address for FeeNix is 0x3F6d17676a2896D80F4a33c412eC04025679a48F. Be cautious not to purchase any other token with a smart contract different from this one (as this can be easily faked). We strongly advise to be vigilant and stay safe throughout the launch. Don’t let the excitement get the best of you. Just be sure you have enough BNB in your wallet to cover the transaction fees. Join To Get BNB (Binance Coin)! ☞ CLICK HERE You will have to first buy one of the major cryptocurrencies, usually either Bitcoin (BTC), Ethereum (ETH), Tether (USDT), Binance (BNB)… We will use Binance Exchange here as it is one of the largest crypto exchanges that accept fiat deposits. Once you finished the KYC process. You will be asked to add a payment method. Here you can either choose to provide a credit/debit card or use a bank transfer, and buy one of the major cryptocurrencies, usually either Bitcoin (BTC), Ethereum (ETH), Tether (USDT), Binance (BNB)… ☞ SIGN UP ON BINANCE Step by Step Guide : What is Binance | How to Create an account on Binance (Updated 2021) Next step You need a wallet address to Connect to Pancakeswap Decentralized Exchange, we use Metamask wallet If you don’t have a Metamask wallet, read this article and follow the steps ☞What is Metamask wallet | How to Create a wallet and Use Transfer $BNB to your new Metamask wallet from your existing wallet Next step Connect Metamask Wallet to Pancakeswap Decentralized Exchange and Buy, Swap FNX token Contract: 0x3F6d17676a2896D80F4a33c412eC04025679a48F Read more: What is Pancakeswap | Beginner’s Guide on How to Use Pancakeswap The top exchange for trading in FNX token is currently PancakeSwap (V2) Find more information FeeNix ☞ Website 🔺DISCLAIMER: The Information in the post isn’t financial advice, is intended FOR GENERAL INFORMATION PURPOSES ONLY. Trading Cryptocurrency is VERY risky. Make sure you understand these risks and that you are responsible for what you do with your money.

https://medium.com/@feenixtoken/what-is-feenix-fnx-token-d8c4b028b80b

[]

2021-12-20 13:11:58.095000+00:00

['Bsc', 'Binance']

Title FeeNixFNX TokenContent FeeNixFNX Token article we’ll discus information FeeNix project FNX token FeeNix hyperdeflationary token reward investor holding token long term also incorporating Buyback approach currently present stock market FeeNix one first cryptocurrencies ever include automatic Buyback Buyback particular stock low value potential perform better future often company announce buyback stock open market company announce buyback investor gain confidence purchase hold stock well Additionally demand increase company start buying stock ultimately drive stock raise FeeNix chose apply Buyback concept cryptocurrency encourage investor hold token invest FeeNix FeeNix token holder benefited static reward also BuyBack process contract part BuyBack process contract take care buying back token burn whenever sell happens What’s Great 3 advantage 1 Raise Value ○ token Liquidity pool bought new BNB amount added pool amount token reduced result increase price 2 Free BNB ○ token burnt like adding free BNB pool token sell future 3 Trust Reliability ○ Investors relentlessly hesitant often get spooked bearish market Owners ready renounce ownership use thing need changed Bonus Holder Advantages ● 2 reward redistributed every transaction ● Join trusted network investor confident BuyBack contract understand potential growth implementing concept ● investor know contract always buy every sell feel confident raise price continue holding Tax Breakdown ➔ 3 reward holder ➔ 4 marketing tax ➔ 3 BuyBack tax ➔ Slippage 114 Tokenomics 1000000000 1 BILLION INITIAL SUPPLY DEV WALLETS 5 MARKETING PROMOTIONS WALLET 5 FUTURE EXCHANGE LISTINGS 15 AIRDROPS10 LIQUIDITY 35 INITIAL BURN 30 TAXES 3 REWARDS HOLDERS 4 MARKETING TAX 3 BUYBACK TAX 114 SLIPPAGE utilized keep price token check buying back token burning Buy FNX token FeeNix token live Binance mainnet token address FeeNix 0x3F6d17676a2896D80F4a33c412eC04025679a48F cautious purchase token smart contract different one easily faked strongly advise vigilant stay safe throughout launch Don’t let excitement get best sure enough BNB wallet cover transaction fee Join Get BNB Binance Coin ☞ CLICK first buy one major cryptocurrencies usually either Bitcoin BTC Ethereum ETH Tether USDT Binance BNB… use Binance Exchange one largest crypto exchange accept fiat deposit finished KYC process asked add payment method either choose provide creditdebit card use bank transfer buy one major cryptocurrencies usually either Bitcoin BTC Ethereum ETH Tether USDT Binance BNB… ☞ SIGN BINANCE Step Step Guide Binance Create account Binance Updated 2021 Next step need wallet address Connect Pancakeswap Decentralized Exchange use Metamask wallet don’t Metamask wallet read article follow step ☞What Metamask wallet Create wallet Use Transfer BNB new Metamask wallet existing wallet Next step Connect Metamask Wallet Pancakeswap Decentralized Exchange Buy Swap FNX token Contract 0x3F6d17676a2896D80F4a33c412eC04025679a48F Read Pancakeswap Beginner’s Guide Use Pancakeswap top exchange trading FNX token currently PancakeSwap V2 Find information FeeNix ☞ Website 🔺DISCLAIMER Information post isn’t financial advice intended GENERAL INFORMATION PURPOSES Trading Cryptocurrency risky Make sure understand risk responsible moneyTags Bsc Binance

About Bt Miracles — Meeting diversity for the first time

As a token in Bt Miracles, how can BM be diversified? How to go from Play to earn to co-creating IP? In the process of creating BM, while committed to creating high-quality games, the project team has been seeking to create more meaningful things beyond the game itself. so as to create A platform that combines virtual and reality for more BMers. As a play to earn game, Bt Miracles has received some attention since it was launch.and has also received many high-quality suggestions from friends. It’s about game playing methods, game art pictures, game story background, etc. When discussing BMer’s future with these consensuses, One of the consensuses agrees with the idea of the project team, he believes that BM which is divergent and scalable.it has very good potential. As an online author, he wants to enrich the background story of the game from the novel, to turn BM from a single game token into a bridge which connecting novels and games. After discussion by the project team, we reached a consensus — We wish BM can carry more meaning of BMer. Build BM into a co-creation IP in the future. Diversify BM IP, It means that the project team plans to let BM enter real life from the chain in the future. This will be a new idea: the background story of game is loved by players. Why not let the story go on in the form of novels? This is one of the diversified development. The novel is the first step for Bt Miracles to move towards real life. In the future, we will have the opportunity to find more consensuses based on novels and games and create multiple IP products together: such as comics, animation, handmade toys, dolls, etc. It also has the opportunity to set up a series of restaurants jointly with Bt Miracles. This is not only a blueprint, the full picture of SKU mainland will be revealed due to the official move. In the future, when more writers participate in our fan-fiction of Bt Miracles, they will form a way to obtain benefits different from the game: for example, writers serialize novels on a platform, while readers can use BM payment to unlock subsequent chapters in advance. Of course, this is only a small part of the beginning of diversification. We welcome more writers, musicians and comic artists to create BM IP. At the same time, the project team constantly optimizes the game interface, game experience, etc.will also adds more interesting and profitable playing methods, and makes relative adjustments to the character image as much as possible to make everyone’s game character different. Of course, you can also contact us if you have good suggestions. This is our contact information: https://t.me/BtMiraclesOfficial_New Your good suggestions will make us better. let’s look forward that BM from the token of an entertainment game to everyone’s common living currency.

https://medium.com/@btmiracles/about-bt-miracles-meeting-diversity-for-the-first-time-880a598a5570

[]

2021-12-29 16:59:13.756000+00:00

['Blockchain', 'Gamefi', 'Bsc', 'Metaverse']

Title Bt Miracles — Meeting diversity first timeContent token Bt Miracles BM diversified go Play earn cocreating IP process creating BM committed creating highquality game project team seeking create meaningful thing beyond game create platform combine virtual reality BMers play earn game Bt Miracles received attention since launchand also received many highquality suggestion friend It’s game playing method game art picture game story background etc discussing BMer’s future consensus One consensus agrees idea project team belief BM divergent scalableit good potential online author want enrich background story game novel turn BM single game token bridge connecting novel game discussion project team reached consensus — wish BM carry meaning BMer Build BM cocreation IP future Diversify BM IP mean project team plan let BM enter real life chain future new idea background story game loved player let story go form novel one diversified development novel first step Bt Miracles move towards real life future opportunity find consensus based novel game create multiple IP product together comic animation handmade toy doll etc also opportunity set series restaurant jointly Bt Miracles blueprint full picture SKU mainland revealed due official move future writer participate fanfiction Bt Miracles form way obtain benefit different game example writer serialize novel platform reader use BM payment unlock subsequent chapter advance course small part beginning diversification welcome writer musician comic artist create BM IP time project team constantly optimizes game interface game experience etcwill also add interesting profitable playing method make relative adjustment character image much possible make everyone’s game character different course also contact u good suggestion contact information httpstmeBtMiraclesOfficialNew good suggestion make u better let’s look forward BM token entertainment game everyone’s common living currencyTags Blockchain Gamefi Bsc Metaverse

Socialogue - Merging booming digital space - NFT, Metaverse, Blockchain

Socialogue - Merging booming digital space - NFT, Metaverse, Blockchain Hello everyone... Here I will inform you by writing a review to introduce a very unique new project called Socialogue so for that, have a look at the article I created below to give you a very good overview of the project, then Benefits what do they give everyone? Let's go straight to the discussion below. INTRODUCTION NFT stands for non-fungible token, a unit of data stored on the blockchain that certifies a digital asset as unique and non-replicable. The first NFT project was launched back in 2015, but it's 2021 when the market really takes off. In fact, saying it "takes off" is an understatement. Compared to the second and third quarters of 2021, NFT trading volume increased by 704%. Three months is the time it takes for such growth. With more and more companies launching their own NFT, celebrities, crypto, finance and other experts are backing it, and all the advantages that technology has - NFT will remain. But when the industry is still in its early stages and moving very fast, there is a lot to improve. Right there, Socialogue will shine. Socialogue combines all the fast-growing spaces: NFT, blockchain, Metaverse and social media. All combined into one platform. It is built by taking industry best practices and making them even better. And of course, overcome the shortcomings. IDENTIFYING PROBLEMS “The NEW DIGITAL ECONOMY IS GREAT, BUT THERE ARE LESSONS TO IMPROVE. LACK OF DIRECT COMMUNICATION: There are many ways to build an NFT community. Channels like Discord or Twitter make it possible to develop the following. But building community doesn't mean building relationships. Many talented creators and curious collectors miss opportunities to collaborate due to a lack of direct contact. HIGH ETHEREUM GAS COSTS: Ethereum is the most popular blockchain that businesses are investigating and incorporating into their operations today. Statistics show that the Ethereum blockchain is used by twenty-four of the fifty listed companies. Despite being an excellent technology, Ethereum has a drawback, which significantly affects the NFT space - this is the cost of fuel. On August 5, 2021, the London Upgrade was implemented to make Ethereum transactions more predictable, but gas fees still stop many individuals from participating in the space. SOLUTION SAFETY ISSUE: Following the former, the lack of live communication and multiple channels at play can cause individuals to lose money. The NFT space, like everything else, has a black and white side. The sad truth is that some unscrupulous people use social engineering and other tricks to get someone off the line into a replicated NFT store. The all-in-one platform is a much more secure and convenient solution. NO OPTIONS TO SHAPE THE FUTURE: With the industry growing, NFT and Metaverse are the future. It's very user experience based. Community members have many ways to express their opinions but no option to influence change directly. CLIMATE CONTROVERS: Both cryptocurrencies and NFTs have come under criticism for their impact on energy consumption and climate impacts. This problem is real and widespread. An alternative way of using technology is a must. SOCIALOGUE PLATFORM By collaborating with Immutable X, Socialogue ensures trading in an open, decentralized ecosystem, secured by Ethereum, along with other features: ALL IN ONE As a complete platform, Socialogue provides an extra edge for security and experience. Everything within reach of the platform - social connections, marketplaces, game metaverse, and more. Everything today's NFT fans need in one place. Socialogue observed that NFT room participants had to rely on multiple platforms for information, communication, printing and other purposes. And it is self-evident that using one platform instead of multiple platforms will serve the industry and its users. NFT SOCIAL PLATFORM Socialogue NFT Social Platform brings all social media influence to the NFT space. The importance of social features within the platform is game-changing. It overcomes the shortcomings of the industry and provides unlimited opportunities to the community. Socialogue members can write posts, like, share, comment or send direct messages to users of any platform. By actively participating in the community, a member can create their own followers and get rewarded. The opportunities with having a following in the digital economy have never been greater. Socialogue values ​​transparency. Setting up a profile that other community members can see is easy. This empowers creators, collectors or other members to tell their stories and even showcase the collected NFTs (Fig. 2). Strict verification for content creators is also required to keep the community safe. Socialogue has all the features of a social platform. The ability to communicate within the platform creates extra security and closer relationships. For new opportunities and more confidence. NFTOMICS ROYALTIES: The platform uses royalties to buy floor NFTs mainly for two reasons - to reward honored users and provide stability for the community. RECOGNITION: On the platform, Socialogue appreciates every NFT holder. To praise them, every NFT owner gets a senator member badge. They get recognized among other users as DAO Senate members, who can vote and decide the Socialogue future. DAO: A unique DAO structure redefines community involvement. Every Socialogue NFT holder becomes a member of the DAO Senate. The goal is to have as many senate members who will shape the future of Socialogue and the whole NFT space. Senate members participate in major Socialogue decisions. TOKEN: Token Launch will take place in Q1 of 2022. Socialogue will reward every NFT holder. EARN: Holding Socialogue NFT and being part of the community opens multiple ways to get real economics. Participation in the community, taking decisions in the DAO Senate, and other activities are rewarding. SOCIALOGFUE NFT TOKENS METAVERSE: Socialogue offers a thrilling experience on the Metaverse. One of the exclusive parts of the Metaverse is the DAO Senate, where the gatherings, votings, discussions, and other activities occur. PRIVATE: As a close and unique community, NFT holders who are Senate members have a private group to discuss upcoming changes, decisions, and the future of the platform. SUPPORT: Like one big family, Socialogue offers support and help to its members. Socialogue Senate has direct contact with platform admins as additional support and attention. NFT TOKENS The NFT collection allows Socialogue to add even more uniqueness to the platform and user experience. Users can use tokens for various purposes. Again, mainly for a better customer experience, increased loyalty, and stability of the platform. The stability of the platform is also an important indicator. A part of Socialogue tokens is not sold or given away as rewards. It is important to have tools and resources to keep the platform stable and working if anything unexpected happens. Socialogue has a promising future, but it is always better to have a plan B than have none. ROADMAP 2021 Q1-Q3img Conducting deep market research. Settling the legal matters. Designing Socialogue platform. Implementing the experience of top-notch advisors. 2021 Q4img The release of NFTs collection and launch of Socialogue (Beta). Integration of blockchain into the platform. NFT airdrop. Establishment of DAO Senate. 2022 Q1-Q2img Launching the Socialogue token, DAO Senate Metaverse, Socialogue Metaverse and a full version of the platform. Integration of token stake and tips functionalities. 2022 Q3-Q4 The launch of Socialogue app for iOS and Android. Advancing the community functionality - introducing group chats, private groups and members recognition via smart contract. Contact Information Website Whitepaper Twitter Facebook Telegram Instagram Discord Medium Author Bitcointalk username: Arie07 Bircointalk profile: https://bitcointalk.org/index.php?action=profile;u=2346804 Bsc wallet address: 0x1EA625cC96682BAB3855820cd871b41B81cb7e78

https://medium.com/@rezaateng27/socialogue-merging-booming-digital-space-nft-metaverse-blockchain-87f184486269

[]

2021-12-26 23:09:34.345000+00:00

['Bitcoin', 'Blockchain', 'Cryptocurrency', 'ICO', 'Bsc']

Title Socialogue Merging booming digital space NFT Metaverse BlockchainContent Socialogue Merging booming digital space NFT Metaverse Blockchain Hello everyone inform writing review introduce unique new project called Socialogue look article created give good overview project Benefits give everyone Lets go straight discussion INTRODUCTION NFT stand nonfungible token unit data stored blockchain certifies digital asset unique nonreplicable first NFT project launched back 2015 2021 market really take fact saying take understatement Compared second third quarter 2021 NFT trading volume increased 704 Three month time take growth company launching NFT celebrity crypto finance expert backing advantage technology NFT remain industry still early stage moving fast lot improve Right Socialogue shine Socialogue combine fastgrowing space NFT blockchain Metaverse social medium combined one platform built taking industry best practice making even better course overcome shortcoming IDENTIFYING PROBLEMS “The NEW DIGITAL ECONOMY GREAT LESSONS IMPROVE LACK DIRECT COMMUNICATION many way build NFT community Channels like Discord Twitter make possible develop following building community doesnt mean building relationship Many talented creator curious collector miss opportunity collaborate due lack direct contact HIGH ETHEREUM GAS COSTS Ethereum popular blockchain business investigating incorporating operation today Statistics show Ethereum blockchain used twentyfour fifty listed company Despite excellent technology Ethereum drawback significantly affect NFT space cost fuel August 5 2021 London Upgrade implemented make Ethereum transaction predictable gas fee still stop many individual participating space SOLUTION SAFETY ISSUE Following former lack live communication multiple channel play cause individual lose money NFT space like everything else black white side sad truth unscrupulous people use social engineering trick get someone line replicated NFT store allinone platform much secure convenient solution OPTIONS SHAPE FUTURE industry growing NFT Metaverse future user experience based Community member many way express opinion option influence change directly CLIMATE CONTROVERS cryptocurrencies NFTs come criticism impact energy consumption climate impact problem real widespread alternative way using technology must SOCIALOGUE PLATFORM collaborating Immutable X Socialogue ensures trading open decentralized ecosystem secured Ethereum along feature ONE complete platform Socialogue provides extra edge security experience Everything within reach platform social connection marketplace game metaverse Everything today NFT fan need one place Socialogue observed NFT room participant rely multiple platform information communication printing purpose selfevident using one platform instead multiple platform serve industry user NFT SOCIAL PLATFORM Socialogue NFT Social Platform brings social medium influence NFT space importance social feature within platform gamechanging overcomes shortcoming industry provides unlimited opportunity community Socialogue member write post like share comment send direct message user platform actively participating community member create follower get rewarded opportunity following digital economy never greater Socialogue value ​​transparency Setting profile community member see easy empowers creator collector member tell story even showcase collected NFTs Fig 2 Strict verification content creator also required keep community safe Socialogue feature social platform ability communicate within platform creates extra security closer relationship new opportunity confidence NFTOMICS ROYALTIES platform us royalty buy floor NFTs mainly two reason reward honored user provide stability community RECOGNITION platform Socialogue appreciates every NFT holder praise every NFT owner get senator member badge get recognized among user DAO Senate member vote decide Socialogue future DAO unique DAO structure redefines community involvement Every Socialogue NFT holder becomes member DAO Senate goal many senate member shape future Socialogue whole NFT space Senate member participate major Socialogue decision TOKEN Token Launch take place Q1 2022 Socialogue reward every NFT holder EARN Holding Socialogue NFT part community open multiple way get real economics Participation community taking decision DAO Senate activity rewarding SOCIALOGFUE NFT TOKENS METAVERSE Socialogue offer thrilling experience Metaverse One exclusive part Metaverse DAO Senate gathering voting discussion activity occur PRIVATE close unique community NFT holder Senate member private group discus upcoming change decision future platform SUPPORT Like one big family Socialogue offer support help member Socialogue Senate direct contact platform admins additional support attention NFT TOKENS NFT collection allows Socialogue add even uniqueness platform user experience Users use token various purpose mainly better customer experience increased loyalty stability platform stability platform also important indicator part Socialogue token sold given away reward important tool resource keep platform stable working anything unexpected happens Socialogue promising future always better plan B none ROADMAP 2021 Q1Q3img Conducting deep market research Settling legal matter Designing Socialogue platform Implementing experience topnotch advisor 2021 Q4img release NFTs collection launch Socialogue Beta Integration blockchain platform NFT airdrop Establishment DAO Senate 2022 Q1Q2img Launching Socialogue token DAO Senate Metaverse Socialogue Metaverse full version platform Integration token stake tip functionality 2022 Q3Q4 launch Socialogue app iOS Android Advancing community functionality introducing group chat private group member recognition via smart contract Contact Information Website Whitepaper Twitter Facebook Telegram Instagram Discord Medium Author Bitcointalk username Arie07 Bircointalk profile httpsbitcointalkorgindexphpactionprofileu2346804 Bsc wallet address 0x1EA625cC96682BAB3855820cd871b41B81cb7e78Tags Bitcoin Blockchain Cryptocurrency ICO Bsc

Financo Token

Financo Token INTRODUCTION:- Unsatisfactory Financial Empowerment Packages in Financial Institutions and Exchanges The need to engage in profitable financial ventures such as investment of funds, trading and other financial activities cannot be overemphasised in the current financial world. Investment of funds is one unique and easy way of generating income so long as the investment is carried out on a trusted platform. Basically, investors look out for platforms where they can easily and profitably invest their funds. They look out for genuine and trusted platforms that is easily accessible and secure as well as affordable investment packages. Most financial institutions lack wealth building techniques. The available financial opportunities are exclusively reserved for the wealthy and very few privileged individuals and institutions. The present financial system is faced with numerous problems, including too many middle men, lack of transparency, insufficient liquidity, strong effect of external variables, lack of modern financial investment tools and inequality. Most exchanges have little or no packages that will help its users to earn income. This limited feature makes investors hop from one exchange to another in search of exchanges or platforms that will offer the desired substantial rewards and profit. These limited features in most exchanges leaves users unsatisfied to make desired choices for profitable investment on the platform. Financio Providing Innovative:- Solution to Numerous Financial Problems Financio aims to change the landscape by offering numerous features that will benefit users in their platform. The mission of Financio is to facilitate its consumers and users through creating DeFi solutions. These solutions will help users make good earnings and get rewards in cryptocurrency. Financio platform is a cryptocurrency and reward based marketplace provided by decentralised smart contracts. The platform is a large scale initiative committed to supporting economies where technology is lacking or technical backwardness makes development difficult. The platform will promote a financial revolution by utilising blockchain technology, which will leave everyone more financially empowered, socially engaged, and able to gain maximum profit on the platform. The mission of Financio is to enhance security and transparency. In a nut-shell, Financio is a compact solution-based ecosystem. Financio aims at making wealth building opportunities available to everyone, thereby, restoring peoples control over their finances. Financio Decentralised Financing is one of the modern systems that provide different financial solutions. The decentralised exchange runs on Binance Smart Chain (BSC). The platform is equipped with numerous features that enable you to earn substantial rewards and passive income. Financio has a world-wide ecosystem of people and ideas that offers the required speed and direction to assist the world’s best innovations in bringing the future of online cryptocurrency investment to perfection. Financio will feature a lot of income incentives such as:- staking, farming, crypto exchange through liquidity, IFO, lotteries and collectibles. It will also provide some other possible crypto lending options and token-burning processes to the people. The platform will promote financial revolution by utilising blockchain technology which will leave everyone more financially and socially engaged, empowered and able to gain maximum rewards by engaging in numerous ways. Financio Innovative Products The following are financial products on Financio platform that will enable users earn profitably. Crypto Exchange:- Financio exchange is Binance Smart Chain based exchange that functions as an Automated Market Maker (AMM). The exchange enables users to exchange two tokens immediately. Yield Farming and Staking Income: You can deposit and share Liquidity Pool (LP) tokens to Financio pools and earn passive income. This is a simple way to earn many times with Financio (main FIN/BNB pool, lotteries, IFO collectibles and more). Lottery Ticket Opportunity: With your Financio tokens (FIN) you can buy lottery tickets and stand the chance to win big crypto jackpot when your numbers match with winning ticket. Foreign Currency Exchange Rate Tracking:- All transactions using any foreign currency will be listed on the platform. In order to track and record the exchange rate used, you can refer to the Currency Rate and Date indicated on the platform. The Mission of Financio: Financio has a mission to assist its consumers and users through building Defi solutions. These solutions are aimed at generating profitable earnings to users. Users are then rewarded in cryptocurrency. Additionally, Financio supports committed and well-meaning users through Staking, Farming, Crypto exchange through liquidity, IFO, Lotteries, and Collectibles. Crypto lending and token-burning are other financial enhancing activities that will be available on the platform. The Vision of Financio:- Financio has a vision to ensure that cryptocurrency is part of everyone’s portfolio. Financio anticipate seeing a society in which wealth-building methods that were formerly solely accessible to the affluent are made open to the public, thereby, restoring people’s control over our financial establishments. FINANCIO will establish a new ecosystem to bring more people into digital assets, allowing them to generate a passive income through redistribution/reflection while retaining their privacy, security, authority, and autonomy. Furthermore, with the Lift currency digital asset, we want to establish an economy based on good monetary laws and a robust and solid decentralized basis. OUR ECOSYSTEM FINANCIO coin is an exclusive token that requires various cryptocurrencies activities to earn. It is a new bitcoin that demands a considerable participation from you to accumulate. We have an international standard blockchain that possess the required velocity, speed and directions to lead the best innovators by offering new form of staking, lotteries, farming and cryptocurrency exchange into perfection. DEFI SOLUTIONS Decentralized finance is a system of providing various financial services to people through smart contracts. DeFi options offers people with major banking services at a very low cost. They are all surrounding in nature, with a fit cutting edge technological capacities that are customizable, transparent, scalable and unchangeable. The normal traditional banking system is currently face with many obstacles, such as too many middleman in the marketplace, lack of accountability, inadequate liquidity, inequality, etc. OTHER QUALITIES Defi Yeild Farming Development This is a system of involving our users to invest their digital assets which will be held for a certain period of time in exchange for a higher return. Defi Staking Platform Development Here in our ecosystem, we will encourage our users to stake their digital assets in exchange system. Defi Lottery System Development You stand a chance of generate additional revenue by commiting your wealth in FINANCIO and earning interest on a regular basis. We ensure no one enjoys absolute control of the entire quantity pooled capital, maintaining pure decentralization. LIQUIDITY POOL Liquidity pool token are earned by those who distributed liquidity. Customers mainly their balance on decentralized exchange, which will then transfer to liquidity providers. This is always determined or calculated by quality or percentage of pool they have individually. FARMING This also explains yet another method you can earn additional incentives and rewards as a keeping hold of number of digital coins. Such as when you invest or contributes in this kind of investment you are entitled to a certain return on investment as a REASONS FOR FINANCIO TOKEN:- Transparency And Immutability: With FINANCIO, every documented steps on a transaction details are carefully(audit trail) trace to determine the origin of the token each time there is exchange of crypto recorded on the Binance digital ledger. This process security and prevention of fraud in exchange market. Lower Fees: Fees charged for FINANCIO transaction are significantly lower than the traditional Banker's Automated Clearing System payments and as well debit and credit cards. Easy To Access: FINANCIO is considered a valuable approach because of its easy to use nature. All you ever required is a smartphone and internet connection to become an independent payment and money transfer system. SUMMARIZATION FINANCIO is a decentralized bitcoin that is Binance Smart Chain (BEP20) based. That is created to enable users by providing available means to assist them generate additional revenue effortlessly, through farming, staking, liquidity pool, lotteries, etc by investing and holding a cryptocurrency in exchange marketplace. #Financio #Financiofinance #Farming #Exchange #BSC #Crypto Related Links: Website: http://www.financio.io/ Telegram: https://t.me/FinancioToken Twitter: https://twitter.com/FinancioToken Telegram Ann: https://t.me/FinancioTokenChannel AUTHOR:- Bitcointalk Username: @shiva Bitcointalk Profile Link: https://bitcointalk.org/index.php?action=profile;u=2015378 POA Link: https://bitcointalk.org/index.php?topic=5376894.msg58825946#msg58825946 Telegram Username: @shivamaster1 Beep20 Address: 0xF20b56a82Ea6f6ebf4B841a9ABd99d9023207273

https://medium.com/@shivagautam307/financo-token-9a6cf63a4086

['Shiva Gautam']

2021-12-26 17:08:32.951000+00:00

['Financio', 'Bsc', 'Cryptocurrency', 'Defi', 'Bounty Campaign']

Title Financo TokenContent Financo Token INTRODUCTION Unsatisfactory Financial Empowerment Packages Financial Institutions Exchanges need engage profitable financial venture investment fund trading financial activity cannot overemphasised current financial world Investment fund one unique easy way generating income long investment carried trusted platform Basically investor look platform easily profitably invest fund look genuine trusted platform easily accessible secure well affordable investment package financial institution lack wealth building technique available financial opportunity exclusively reserved wealthy privileged individual institution present financial system faced numerous problem including many middle men lack transparency insufficient liquidity strong effect external variable lack modern financial investment tool inequality exchange little package help user earn income limited feature make investor hop one exchange another search exchange platform offer desired substantial reward profit limited feature exchange leaf user unsatisfied make desired choice profitable investment platform Financio Providing Innovative Solution Numerous Financial Problems Financio aim change landscape offering numerous feature benefit user platform mission Financio facilitate consumer user creating DeFi solution solution help user make good earnings get reward cryptocurrency Financio platform cryptocurrency reward based marketplace provided decentralised smart contract platform large scale initiative committed supporting economy technology lacking technical backwardness make development difficult platform promote financial revolution utilising blockchain technology leave everyone financially empowered socially engaged able gain maximum profit platform mission Financio enhance security transparency nutshell Financio compact solutionbased ecosystem Financio aim making wealth building opportunity available everyone thereby restoring people control finance Financio Decentralised Financing one modern system provide different financial solution decentralised exchange run Binance Smart Chain BSC platform equipped numerous feature enable earn substantial reward passive income Financio worldwide ecosystem people idea offer required speed direction assist world’s best innovation bringing future online cryptocurrency investment perfection Financio feature lot income incentive staking farming crypto exchange liquidity IFO lottery collectible also provide possible crypto lending option tokenburning process people platform promote financial revolution utilising blockchain technology leave everyone financially socially engaged empowered able gain maximum reward engaging numerous way Financio Innovative Products following financial product Financio platform enable user earn profitably Crypto Exchange Financio exchange Binance Smart Chain based exchange function Automated Market Maker AMM exchange enables user exchange two token immediately Yield Farming Staking Income deposit share Liquidity Pool LP token Financio pool earn passive income simple way earn many time Financio main FINBNB pool lottery IFO collectible Lottery Ticket Opportunity Financio token FIN buy lottery ticket stand chance win big crypto jackpot number match winning ticket Foreign Currency Exchange Rate Tracking transaction using foreign currency listed platform order track record exchange rate used refer Currency Rate Date indicated platform Mission Financio Financio mission assist consumer user building Defi solution solution aimed generating profitable earnings user Users rewarded cryptocurrency Additionally Financio support committed wellmeaning user Staking Farming Crypto exchange liquidity IFO Lotteries Collectibles Crypto lending tokenburning financial enhancing activity available platform Vision Financio Financio vision ensure cryptocurrency part everyone’s portfolio Financio anticipate seeing society wealthbuilding method formerly solely accessible affluent made open public thereby restoring people’s control financial establishment FINANCIO establish new ecosystem bring people digital asset allowing generate passive income redistributionreflection retaining privacy security authority autonomy Furthermore Lift currency digital asset want establish economy based good monetary law robust solid decentralized basis ECOSYSTEM FINANCIO coin exclusive token requires various cryptocurrencies activity earn new bitcoin demand considerable participation accumulate international standard blockchain posse required velocity speed direction lead best innovator offering new form staking lottery farming cryptocurrency exchange perfection DEFI SOLUTIONS Decentralized finance system providing various financial service people smart contract DeFi option offer people major banking service low cost surrounding nature fit cutting edge technological capacity customizable transparent scalable unchangeable normal traditional banking system currently face many obstacle many middleman marketplace lack accountability inadequate liquidity inequality etc QUALITIES Defi Yeild Farming Development system involving user invest digital asset held certain period time exchange higher return Defi Staking Platform Development ecosystem encourage user stake digital asset exchange system Defi Lottery System Development stand chance generate additional revenue commiting wealth FINANCIO earning interest regular basis ensure one enjoys absolute control entire quantity pooled capital maintaining pure decentralization LIQUIDITY POOL Liquidity pool token earned distributed liquidity Customers mainly balance decentralized exchange transfer liquidity provider always determined calculated quality percentage pool individually FARMING also explains yet another method earn additional incentive reward keeping hold number digital coin invest contributes kind investment entitled certain return investment REASONS FINANCIO TOKEN Transparency Immutability FINANCIO every documented step transaction detail carefullyaudit trail trace determine origin token time exchange crypto recorded Binance digital ledger process security prevention fraud exchange market Lower Fees Fees charged FINANCIO transaction significantly lower traditional Bankers Automated Clearing System payment well debit credit card Easy Access FINANCIO considered valuable approach easy use nature ever required smartphone internet connection become independent payment money transfer system SUMMARIZATION FINANCIO decentralized bitcoin Binance Smart Chain BEP20 based created enable user providing available mean assist generate additional revenue effortlessly farming staking liquidity pool lottery etc investing holding cryptocurrency exchange marketplace Financio Financiofinance Farming Exchange BSC Crypto Related Links Website httpwwwfinancioio Telegram httpstmeFinancioToken Twitter httpstwittercomFinancioToken Telegram Ann httpstmeFinancioTokenChannel AUTHOR Bitcointalk Username shiva Bitcointalk Profile Link httpsbitcointalkorgindexphpactionprofileu2015378 POA Link httpsbitcointalkorgindexphptopic5376894msg58825946msg58825946 Telegram Username shivamaster1 Beep20 Address 0xF20b56a82Ea6f6ebf4B841a9ABd99d9023207273Tags Financio Bsc Cryptocurrency Defi Bounty Campaign

Kikswap.com is thrilled to announced meme NFTs farming

Kikswap.com is thrilled to announced meme NFTs farming Kikswap is not just meme token, A cross chain multi staking and spot trading platform on BSC Network If you are alive and have a sound internet, then probably you are well aware of NFTs! Unless you live in an isolated island somewhere in Indian ocean like the Sentinelese. Well if you are here and reading this through your screen you are nothing like them, instead you do know something about NFTs. Well here I am about to add something in your knowledge, so stay tuned. The amalgamation of DeFi and crypto has given rise to fascinating technologies. We almost every day here about new innovations popping out. It’s really been just 8 months since Jordan Lyall’s ‘degenerator’ tweet got viral. This silly viral tweet, was the beginning of a new era in DeFi. This viral meme tweet initiated the concept of meme NFTs, a new way of collecting digital art via NFT farming. The concept of NFT farming itself has been around for quite some time now. However, meme NFTs farming is a relatively newer concept in the industry. And it has surprisingly helped people make a fortune out of itself. Many people who have become meme or created memes are now selling them for millions of dollars. For instance, Zoe Roth, commonly known as the disaster girl became a meme when her father photographed her in front of a burning house. The photograph appeared as zoe roth smiling infornt of the burning house, and quickly went viral on the internet as a symbol of wittiness. The disaster girl image has now been sold for $500,000 dollars at auction Another meme Doge became increasingly popular to a point that a cryptocurrency was created out of it. The image of that meme was later sold for four million worth of Ethereum. An estimation regarding the adaptability and craze for meme NFTs can be made from this figures. The announcement To facilitate this huge chunk of crypto users, Kikswap has introduced a meme NFT farming feature on their platform. Launching on the end of this month. Since its inception, it has emerged into new position of innovation where community members, influencers and respective communities can come altogether to interact in a fun way and collect rare digital art. The Kikswap team is proud to finally introduce a newly built NFT discovery and farming platform called meme NFT protocol MN.2. Lots of blood, and sweat make our new platform today and mark the beginning of a new chapter in the history of MEMES. It is remarkable and joyful to state kikswap’s milestones during its first quarter of launch. 30+ Artists and Authors 6,700 unique NFT holders 17,300 Twitter followers 6000+ on Telegram/Discord $100,000 + Donate to charity $150,000 Community Prize USD 25,000,000 on kikswap platform 4,500 bsc (US $9.5 million) in the secondary market New release features Rebuilding from a platform from scratch We listened to you. To meet the growing demands of the platform, we have implemented the necessary front-end and back-end changes that enable all of this. Backend flexibility The improvements we have made give us great flexibility to adapt to future iterations and innovations. There are many ideas I can’t wait to implement that wouldn’t have been possible without these fundamental changes implemented today. Content and drops Content is no longer tied to developer resources and can now perform tasks that used to take hours to drop in minutes. That means more art, more artists, more drops! UI / UX improvements This will continue to improve over time, but we believe the new design is a new canvas and will continue to work on it. Social Links: Website: https://kikswap.com/ Application: https://app.kikswap.com/ Whitepaper: https://kikswap.com/whitepaper.pdf Medium: https://kiktoken.medium.com/ Github: https://github.com/kiktoken Telegram: t.me/kiktoken Twitter: https://twitter.com/kiktoken Facebook: https://www.facebook.com/Kiktoken YouTube: https://www.youtube.com/channel/UCS-KTygQptMhtnlFVEyFJng Reddit: https://www.reddit.com/user/kiktoken Discord: https://discord.gg/CRRK3yPq Media: https://finance.yahoo.com/news/kikswap-com-not-another-meme-000000828.html

https://medium.com/@kiktoken/kikswap-com-is-thrilled-to-announced-meme-nfts-farming-bf9328c58d49

['Kikswap', 'Official']

2021-12-26 09:30:53.800000+00:00

['Marketplaces', 'Bsc', 'Binance', 'Bnb', 'Presales']

Title Kikswapcom thrilled announced meme NFTs farmingContent Kikswapcom thrilled announced meme NFTs farming Kikswap meme token cross chain multi staking spot trading platform BSC Network alive sound internet probably well aware NFTs Unless live isolated island somewhere Indian ocean like Sentinelese Well reading screen nothing like instead know something NFTs Well add something knowledge stay tuned amalgamation DeFi crypto given rise fascinating technology almost every day new innovation popping It’s really 8 month since Jordan Lyall’s ‘degenerator’ tweet got viral silly viral tweet beginning new era DeFi viral meme tweet initiated concept meme NFTs new way collecting digital art via NFT farming concept NFT farming around quite time However meme NFTs farming relatively newer concept industry surprisingly helped people make fortune Many people become meme created meme selling million dollar instance Zoe Roth commonly known disaster girl became meme father photographed front burning house photograph appeared zoe roth smiling infornt burning house quickly went viral internet symbol wittiness disaster girl image sold 500000 dollar auction Another meme Doge became increasingly popular point cryptocurrency created image meme later sold four million worth Ethereum estimation regarding adaptability craze meme NFTs made figure announcement facilitate huge chunk crypto user Kikswap introduced meme NFT farming feature platform Launching end month Since inception emerged new position innovation community member influencers respective community come altogether interact fun way collect rare digital art Kikswap team proud finally introduce newly built NFT discovery farming platform called meme NFT protocol MN2 Lots blood sweat make new platform today mark beginning new chapter history MEMES remarkable joyful state kikswap’s milestone first quarter launch 30 Artists Authors 6700 unique NFT holder 17300 Twitter follower 6000 TelegramDiscord 100000 Donate charity 150000 Community Prize USD 25000000 kikswap platform 4500 bsc US 95 million secondary market New release feature Rebuilding platform scratch listened meet growing demand platform implemented necessary frontend backend change enable Backend flexibility improvement made give u great flexibility adapt future iteration innovation many idea can’t wait implement wouldn’t possible without fundamental change implemented today Content drop Content longer tied developer resource perform task used take hour drop minute mean art artist drop UI UX improvement continue improve time believe new design new canvas continue work Social Links Website httpskikswapcom Application httpsappkikswapcom Whitepaper httpskikswapcomwhitepaperpdf Medium httpskiktokenmediumcom Github httpsgithubcomkiktoken Telegram tmekiktoken Twitter httpstwittercomkiktoken Facebook httpswwwfacebookcomKiktoken YouTube httpswwwyoutubecomchannelUCSKTygQptMhtnlFVEyFJng Reddit httpswwwredditcomuserkiktoken Discord httpsdiscordggCRRK3yPq Media httpsfinanceyahoocomnewskikswapcomnotanothermeme000000828htmlTags Marketplaces Bsc Binance Bnb Presales

#YearnNFT Finance presale is Running!

#YearnNFT Finance presale is Running! Hello Friends Biggest YearnNFT Presale Is Live Now ! YearnNFT is all new BSC based NFT marketplace to trace and mint NFT’s with ease. Hurry Up! Buy #YFNFT from YearnNFT Finance up things to make it 300X #YFNFT to moon 🚀🚀 Lowest Supply : 73332 Presale Live : https://yearnnft.finance/Presale 🔔 𝐓𝐨𝐤𝐞𝐧𝐨𝐦𝐢𝐜𝐬 𝐚𝐧𝐝 𝐃𝐢𝐬𝐭𝐫𝐢𝐛𝐮𝐭𝐢𝐨𝐧 🔔 Token Name: YearnNFT Symbol : YFNFT Network : Binance Smart Chain(BSC) Features : Digital Art🌄 NFT, Governance, Fees, Rewards , Payments and Trade Presale link : https://yearnnft.finance/Presale 𝐃𝐢𝐬𝐭𝐫𝐢𝐛𝐮𝐭𝐢𝐨𝐧 Total Supply : 73332 YFNFT Available Supply : 73332 YFNFT Presale : 40% ( 29332.8) Liquidity : 35% ( 25666.20 ) Registration Bounty 4% ( 2933.28) Referral Bounty 4% ( 2933.28) Listing : After Presale #Pancakeswap & #Apeswap $YFNFT is a #BSC Based #NFT Marketplace Powered by YearnNFT , the low Supply Token. Website : https://yearnnft.finance/ Follow us on twitter : https://twitter.com/YearnNft Telegram : https://t.me/YearnNFT Medium: https://medium.com/@yearnnft Reddit : https://www.reddit.com/user/YearnNFT/ #YearnNFT #Bsc #Bnb #Binance #BSCGems #NFT #Blockchain

https://medium.com/@zaynalewis01/yearnnft-finance-presale-is-running-27b9e21c6bb6

[]

2021-12-18 10:06:16.313000+00:00

['Bnb', 'Bsc', 'Nft', 'Binance']

Title YearnNFT Finance presale RunningContent YearnNFT Finance presale Running Hello Friends Biggest YearnNFT Presale Live YearnNFT new BSC based NFT marketplace trace mint NFT’s ease Hurry Buy YFNFT YearnNFT Finance thing make 300X YFNFT moon 🚀🚀 Lowest Supply 73332 Presale Live httpsyearnnftfinancePresale 🔔 𝐓𝐨𝐤𝐞𝐧𝐨𝐦𝐢𝐜𝐬 𝐚𝐧𝐝 𝐃𝐢𝐬𝐭𝐫𝐢𝐛𝐮𝐭𝐢𝐨𝐧 🔔 Token Name YearnNFT Symbol YFNFT Network Binance Smart ChainBSC Features Digital Art🌄 NFT Governance Fees Rewards Payments Trade Presale link httpsyearnnftfinancePresale 𝐃𝐢𝐬𝐭𝐫𝐢𝐛𝐮𝐭𝐢𝐨𝐧 Total Supply 73332 YFNFT Available Supply 73332 YFNFT Presale 40 293328 Liquidity 35 2566620 Registration Bounty 4 293328 Referral Bounty 4 293328 Listing Presale Pancakeswap Apeswap YFNFT BSC Based NFT Marketplace Powered YearnNFT low Supply Token Website httpsyearnnftfinance Follow u twitter httpstwittercomYearnNft Telegram httpstmeYearnNFT Medium httpsmediumcomyearnnft Reddit httpswwwredditcomuserYearnNFT YearnNFT Bsc Bnb Binance BSCGems NFT BlockchainTags Bnb Bsc Nft Binance

New Year, New Partnership - Welcome To The Family Zam.io

Happy new year and Merry Christmas Delorians, One after the other we keep on adding strategic partners and widening our network. This time we are happy to tell you all about our partnership with the brilliant team of Zam.io Since day 1 of Revault’s journey we understood that in order to change the way people DeFi, we will have to create a consortium of organizations thinking alike and dedicated to our target. Our mission statement remains still to be the gateway for new DeFi users and the go-to platform for those already there. As a promising young crypto project, we are constantly bombarded with collaboration inquiries and are lucky enough to be able to choose the best from the pile those we believe their counterparty has the same ambitions and goals in mind. We met with Zam’s team a few weeks ago and instantaneously clicked with everyone on the call seeing the potential and common ground between our two projects. Like Revault, Zam is also aiming to become the gateway to DeFi and crypto, with their main focus being on the connection between people and capital from traditional finance to DeFi. Although relatively a young company (2018) Zam was able to release several products including among others, ZamWallet & ZamWallet exchange, Zam.me a remittance platform, zMorgan an on-chain platform for stablecoin loans secured by stocks as collateral, and the Zam Academy a hub for beginners to learn their first steps in the crypto blue ocean. The quality of Zam’s team together with their execution level, passion, and connections to over 10,000 individuals both crypto and traditional capital players, made it clear to us this is an opportunity we can’t miss. Since there are many verticals to explore together, we took a joint decision to focus on only a few to start with. These will include adding $REVA to ZamWallet and Zam Academy where Zam’s users can learn about Revault and use our yield maximizing protocol with their base assets. In addition, we will advise Zam on creating their own vaults using $ZAM and other big cap assets, and add them to our protocol. We would like to take this opportunity and welcome our friends from Zam.io to the Revault family and say we are lucky to have you with us on this amazing journey To the future!

https://medium.com/@revaultnetwork/new-year-new-partnership-welcome-to-the-family-zam-io-73a503583860

[]

2021-12-26 20:05:39.536000+00:00

['Defi', 'Bsc', 'Yield Farming', 'Crypto', 'Ethereum']

Title New Year New Partnership Welcome Family ZamioContent Happy new year Merry Christmas Delorians One keep adding strategic partner widening network time happy tell partnership brilliant team Zamio Since day 1 Revault’s journey understood order change way people DeFi create consortium organization thinking alike dedicated target mission statement remains still gateway new DeFi user goto platform already promising young crypto project constantly bombarded collaboration inquiry lucky enough able choose best pile believe counterparty ambition goal mind met Zam’s team week ago instantaneously clicked everyone call seeing potential common ground two project Like Revault Zam also aiming become gateway DeFi crypto main focus connection people capital traditional finance DeFi Although relatively young company 2018 Zam able release several product including among others ZamWallet ZamWallet exchange Zamme remittance platform zMorgan onchain platform stablecoin loan secured stock collateral Zam Academy hub beginner learn first step crypto blue ocean quality Zam’s team together execution level passion connection 10000 individual crypto traditional capital player made clear u opportunity can’t miss Since many vertical explore together took joint decision focus start include adding REVA ZamWallet Zam Academy Zam’s user learn Revault use yield maximizing protocol base asset addition advise Zam creating vault using ZAM big cap asset add protocol would like take opportunity welcome friend Zamio Revault family say lucky u amazing journey futureTags Defi Bsc Yield Farming Crypto Ethereum

Bitto tech & Definity Studios has released a new NFT play to earn DeFI game that creates new value…

Bitto tech & Definity Studios has released a new NFT play to earn DeFI game that creates new value & life in NFT arts. At the moment, blockchain technology is developing strongly, so many NFT game projects developed on blockchain technology were born. Typically an NFT game developed on blockchain technology that is gradually leading in the market is the game Axie Infinity , a game that is both entertaining and can earn money from collecting NFT items to deliver. trading in the market. Because of seeing the potential of the NFT game industry, the Definity Legend game project was born. So how is the Definity Legend game project, let’s learn about Definity Legend in detail. Definity Legend is a Turn-Based Strategy RPG with a blockchain economy. Players engage in battles with monsters and other players using a team of heroes in a fantasy setting. As players progress through the game, they will acquire better equipment, heroes, guardians and have access to other features such as Bowels of Tartarus, where fearsome boss fights await! Main Gameplay Features: Command a team of heroes against bloodthirsty monsters in a gripping campaign or battle other players in PvP contests. Don’t fight alone! Form a guild with other players and wage wars against other guilds to conquer lands! Acquire and Upgrade heroes to form the best battle squad that you can. Earn NFT rewards that can be used to get even stronger or traded for BITTO potions. Overcome the most difficult challenges Olympus has to offer by defeating the biggest bosses in Definity Legends universe, to earn even better rewards. All NFT items can be traded in DLD marketplace! Blockchain NFT assets (heroes,guardians,equipment, pets, artifacts, etc) will be under BEP-721. Data’s will be stored using InterPlanetary File System (IPFS). DLD will be using Immutable X on ethereum blockchain (for non game related sponsored NFT) which features Zero gas costs for peer to peer trading. No custodial risk; users keep their private keys. Handles up to 9,000 transactions per second. Not a centralized sidechain. Supports ERC-20 and ERC-721 Instant settlement, no reverts. Gaming NFT’s will then be migrated cross chain to BSC to be convereted to in-game playable characters on BSC. This is only for opensea.io and ethereum based NFT that crosses over $30,000 in value. DefinityLegend will be built using the UNITY platform and is currently available only on PC. An integration to a mobile game will be available via the Apple and Google Appstores in the near future. #definitylegend #blockchain #defi #DLD #metaverse Utilities of DLD Coin DLD Coins is the utility currency that can be used to trade for a variety of items in game. The most common use is acquiring new heroes, equipment and guardians. Treasure Chests Treasure ChestsThere will be a limited amount of new releases of equipment and weapons every week and are only obtainable through Treasure chests. Guild In Nation Wars Guild In Nation Warsbidding to participate in Nation Wars, which allow guilds to contest for lands, are done with DLD coins. Limited Edition Heroes & Guardians Limited Edition Heroes & GuardiansChances to obtain limited edition partnership & collaboration sets, stronger heroes, guardian’s or Artefacts! Billboards advertising shared to owners of lands Billboard RentalAdvert Billboard can be rented out for placing ad images, by interested Advertisers and/or Publishers. Our Contributors BITTO and DeFinity Studio present a combined experience of more than 20 years of gaming experience and 10 years of experience within cryptocurrency and blockchain creating a powerful synergistic team combination. Koh Jun Ming Junior Game Artist Previous Vincent Chia Game Tester Lee Jun Teck Junior Game Artist BITTO Dev Team Mashpy Rahman Lead Dev Server & Security Analyst A.B Siddik Full Stack Developer Nic Chin Co-Founder & Blockchain Director Lawliet Liaw 2D Concept Artist Alexandre Wolkmer 2D Animation Artist Cally Cheok Senior Illustrator Artist Atos Bergmann 2D Animation Artist Gandhi Gultom 2D Concept Illustrator Nguyen Hien 2D Character Concept Artist Marketplace Bring your NFT to life within the DLD world by selling it on the DLD marketplace. If it’s popular and if it aligns with our style, we will put it in as a seasonal character! Buy & Sell DLD land. Play To Earn as you sell DLD NFT assets. Safe, secure and transparent transactions. Visit Market Heroes & Guardians Collection Visit Your Private DLD Collection Our Partners Read more: Website: https://www.definitylegend.com/ Telegram: https://t.me/definitylegend twitter: https://twitter.com/definitylegend Facebook: https://www.facebook.com/definitylegend Author Bitcointalk username: cryptopico Bitcointalk profile: https://bitcointalk.org/index.php?action=profile;u=2645700 Bsc wallet address: 0x63247fdf63C07db36EDaFa527bc61abF194fE2AF

https://medium.com/@maem33023/bitto-tech-definity-studios-has-released-a-new-nft-play-to-earn-defi-game-that-creates-new-value-f080965ce2d8

[]

2021-12-29 17:16:04.881000+00:00

['Bitcoin', 'Blockchain', 'Cryptocurrency', 'ICO', 'Bsc']

Title Bitto tech Definity Studios released new NFT play earn DeFI game creates new value…Content Bitto tech Definity Studios released new NFT play earn DeFI game creates new value life NFT art moment blockchain technology developing strongly many NFT game project developed blockchain technology born Typically NFT game developed blockchain technology gradually leading market game Axie Infinity game entertaining earn money collecting NFT item deliver trading market seeing potential NFT game industry Definity Legend game project born Definity Legend game project let’s learn Definity Legend detail Definity Legend TurnBased Strategy RPG blockchain economy Players engage battle monster player using team hero fantasy setting player progress game acquire better equipment hero guardian access feature Bowels Tartarus fearsome bos fight await Main Gameplay Features Command team hero bloodthirsty monster gripping campaign battle player PvP contest Don’t fight alone Form guild player wage war guild conquer land Acquire Upgrade hero form best battle squad Earn NFT reward used get even stronger traded BITTO potion Overcome difficult challenge Olympus offer defeating biggest boss Definity Legends universe earn even better reward NFT item traded DLD marketplace Blockchain NFT asset heroesguardiansequipment pet artifact etc BEP721 Data’s stored using InterPlanetary File System IPFS DLD using Immutable X ethereum blockchain non game related sponsored NFT feature Zero gas cost peer peer trading custodial risk user keep private key Handles 9000 transaction per second centralized sidechain Supports ERC20 ERC721 Instant settlement reverts Gaming NFT’s migrated cross chain BSC convereted ingame playable character BSC openseaio ethereum based NFT cross 30000 value DefinityLegend built using UNITY platform currently available PC integration mobile game available via Apple Google Appstores near future definitylegend blockchain defi DLD metaverse Utilities DLD Coin DLD Coins utility currency used trade variety item game common use acquiring new hero equipment guardian Treasure Chests Treasure ChestsThere limited amount new release equipment weapon every week obtainable Treasure chest Guild Nation Wars Guild Nation Warsbidding participate Nation Wars allow guild contest land done DLD coin Limited Edition Heroes Guardians Limited Edition Heroes GuardiansChances obtain limited edition partnership collaboration set stronger hero guardian’s Artefacts Billboards advertising shared owner land Billboard RentalAdvert Billboard rented placing ad image interested Advertisers andor Publishers Contributors BITTO DeFinity Studio present combined experience 20 year gaming experience 10 year experience within cryptocurrency blockchain creating powerful synergistic team combination Koh Jun Ming Junior Game Artist Previous Vincent Chia Game Tester Lee Jun Teck Junior Game Artist BITTO Dev Team Mashpy Rahman Lead Dev Server Security Analyst AB Siddik Full Stack Developer Nic Chin CoFounder Blockchain Director Lawliet Liaw 2D Concept Artist Alexandre Wolkmer 2D Animation Artist Cally Cheok Senior Illustrator Artist Atos Bergmann 2D Animation Artist Gandhi Gultom 2D Concept Illustrator Nguyen Hien 2D Character Concept Artist Marketplace Bring NFT life within DLD world selling DLD marketplace it’s popular aligns style put seasonal character Buy Sell DLD land Play Earn sell DLD NFT asset Safe secure transparent transaction Visit Market Heroes Guardians Collection Visit Private DLD Collection Partners Read Website httpswwwdefinitylegendcom Telegram httpstmedefinitylegend twitter httpstwittercomdefinitylegend Facebook httpswwwfacebookcomdefinitylegend Author Bitcointalk username cryptopico Bitcointalk profile httpsbitcointalkorgindexphpactionprofileu2645700 Bsc wallet address 0x63247fdf63C07db36EDaFa527bc61abF194fE2AFTags Bitcoin Blockchain Cryptocurrency ICO Bsc

EoC AMA

Q1. What is the background of yourself and the EOC team? Hello everyone, I’m Paul from EOC ,and I have been in the gaming industry for almost 15 years. Now I’m one of the game producers of Era of Civilization: Ancient World (EOC). It’s an honor to be here today to share our GameFi project with everyone in the community. I hope that through today’s AMA, more people will know what we have done at EOC. This is the situation of other members of our game production team: The entire EOC technical team has 5–10 years of experience in game development and has cooperated for many years. Whether it is H5 games, consoles or mobile games, they are all at the top level in the UK. Our art team has 2 master-level game artists, working with our UI designers and special effects designers with 5–8 years of game experience. The art team undertook the outsourcing of large-scale foreign game projects in the early years, and has very rich experience in providing 3D large-scale project services. Our sound effects engineers have many years of working experience in major domestic and foreign film companies, including Sony Pictures and Columbia Film Group. They mainly focus on sound effects production and editing. They have mature technology and aesthetics, and their works are in line with mainstream players. Q2. What are the ambitions or purposes that EOC is try to achieve? What EOC wants to bring to our players is an element of fun. We firmly believe that those existing Gamefi projects cannot be called “games”. Gaming is an entertainment service industry, and in essence it still needs to bring people some entertainment. If a player plays a game just to make money, it may not be called a “game”. It can even be said that these people are working for game companies. We also believe that we will see countless games based on the concept of meta-universe. You might say that your virtual products in those existing Gamefi projects are valuable in the game, but in fact, the so-called value is ultimately diluted infinitely. The usual GameFi sells scarcity and uniqueness. But in fact, scarcity and uniqueness have nothing except the concept of NFT. So in the world of EOC, we spent a lot of time designing different game elements. EOC allows players to develop different strategies in medieval battles. In EOC, players can continuously collect heroes of different attributes and levels by opening blind boxes. Heroes can participate in adventures, participate in alliance war games, explore adventures, complete different daily tasks, or participate in country building in the game through farm work. Different combinations of strategies are allowed between different tasks, resulting in different game results. We have learned from the combination of many strategy games, which greatly increased the diversity of the game ecology. The above is just the basic situation of EOC, but the content of this game is very rich and complicated. I may not be able to express its essence in a few words. It is recommended that everyone can participate in the game and explore this wonderful world together. Enjoy the fun of playing. Q3. It is understood that game players can obtain income in various ways in the EOC world. Can you tell us more about the detail of the methods to obtain income in the game? The EOC team strives to guarantee the earning of the EOC players. As a GameFi project, we do our best to provide all participants with the best tokenomic model to maintain the entire ecological value for our players and ultimately allow anyone to earn EOC Coins (EOCC) through proficient game skills. Since all in-game items in EOC are digitized as NFT, players can easily complete the transfer and transaction of NFT assets through the EOC game market at any time. The difference between EOC and the usual play-to-earn GameFi models of all other blockchain games is the realistic reward system in EOC. This game will truly make all EOC players rich by rewarding players with a series of mainstream crypto assets, including Bitcoin, which has never been seen in other games. Therefore, players can enjoy a higher level of fun through the most advanced GameFi reward mode in EOC. The key concept of EOC is play-to-live (P2L), which has given many players-starting from poor players in rural realities, and now gaining the ability to make money through playing games in the virtual world. We can call it the leisure economy. Now it cannot be said that players are working for the EOC company, because we have given players valuable third-party assets, so game players don’t have to worry about being unable to get back their investment in the game when the price of GameFi project tokens drops in the secondary market. Q4. What are the functions that MMR and EOCC tokens have in the EOC game setting? MMR is a platform token that supports the decentralized computing power trading platform Make Me Rich, which naturally combines traditional Filcoin mining with mainstream DeFi game settings through a unique Staking protocol. Since the Make Me Rich platform is one of our main investors, in addition to consuming BNB tokens as gas on Binance Smart Chain, EOC also consumes EOCC and MMR. Users with MMR not only can draw blind boxes at the beginning stage of the EOC to gain rare in-game items, at the same time the platform will also feed users back with multiple benefits: ◇ The earned MMR 50% will go into the game union pool to increase the income of players which build the game union; ◇ The earned MMR 10% will be collected by the foundation to provide incentives for future community governance, etc; ◇ The earned MMR 20% will be used to contribute liquidity to MMR and EOCC to maintain the game economic system. And EOCC, as the currency in the game, EOCC exists in every corner of the game and has an initial price 1EOCC=0.0001U. The specific usage scenarios of EOCC include buying blind box, creating game unions, triggering union wars and hero leasing. EOCC integrate organically with different parts of the game. The more EOCC you have, the more advantageous it is to complete with other players. Q5. There have been many very successful GameFi projects around. What innovations has EOC made in terms of functions and gameplay setting to get more attention and participation from players? I think EOC has the following advantages: First, even players who have not participated in the closed beta can see from our official promotional video that our game is beautifully made, has strong playability, excellent music and art, and great combat special effects; Second, because it has borrowed from the current mature economic model, it has a complete investment-earning-return mechanism so it can adapt to the same type of GameFi player group to the greatest extent; Third, we have shorter profit cycle of playing EOC, combined with the mainstream crypto asset reward system, which allows our players to achieve low investment and high return; Fourth, EOC meets the various needs of users. Many GameFi projects are just simple web game products. EOC supports a variety of scenarios such as web version, PC version, Android version, IOS version, etc., allowing users to play our games anytime, anywhere. Q6. Where did the inspiration come from? Why did you choose BSC? Our team believes that there is no doubt that BSC is the biggest winner in this round of GameFi boom. According to the latest statistics, 20 of the top 50 most active GameFis run on BSC, accounting for 40% of the total. The remaining 30 GameFis are distributed in infrastructure such as Ethereum, Flow, Tron, Solana, and Avalanche. Games such as Wizardium, Fortified, and Universe Island on BSC still maintain high popularity. This is why we choose BSC as our supporting blockchain. Q7. What is the status of your product development? Describe more detailed information about the EOC project roadmap. Popularity is crucial for GameFi project. The EOC whitelist entry officially starts on December 20, which caused quite a stir at the blockchain game circle abroad. it takes only a week for EOC to attract 150,000 daily active followers on all the social media of EOC, including Telegram, Twitter, Medium, and Discord. The total subscribers of the EOC channel exceed 1.3 million. Let me introduce more about our project route. ◇ 2021/11 EOC official website is online; ◇ 2021/12 EOC officially launched the rare blind box draw event on December 20; ◇ 2022/1 EOC will complete the underlying design and battle calculus DEMO development; define the hero prototype, combat skill design and world background design; ◇ 2022/2 EOC will be officially launched, including the first blood challenge system; ◇ More forms of EOC competitions will be launched in the middle of 2022/2, including in-game union battles; ◇ The next development roadmap for the MMR platform and EOC will be announced in late February 2022. ◇ We will also launch a beta version of the NFT game market soon. In addition, I can’t help but want to spoil everyone here. EOC will launch a cross-chain gameplay soon, and there will be surprises for participation. Anyone who interested can first follow our official website https://www.eocryptoken.com/, and we will post the latest news on the official website. Thank you. Live questions: Q1. What is the minimum capital required to start playing with EOC, when can we start playing? The starting point for playing EOC is that the player has at least one hero (to take different game challenges), so the minimum cost of the EOC player is to spend 20USDT to draw a primary blind box to obtain a hero. Q2. How to get EOC token, or just play this game we get EOC token? Yes, an easy way to get EOC tokens (EOCC) is to participate in daily challenges in the game. Another way is through the farming system in the game. You can find more details in the official white paper of EOC. Q3. Why you choose BSC network? I think if we need gas fee to transaction, HECO is better. As we said, the most important element for GameFis is popularity. No one wants to play a game without other players interacting with them, so the number of potential players is the first priority of our development team. I think this is why the EOC team, like many other game development teams, chose BSC as the game medium. Even HECO can achieve a lower price. Q4. The guild system in the game is very powerful, but building guilds need a lot of money, can we reduce the cost to attract more guilds? An important mechanism in our game is that we use DAO to let players vote to rewrite unbalanced game content. The DAO mechanism will become an important part of the EOC ecosystem. This information will be available on our official website soon. Q5. And also what mechanism does your game have to balance small funding players and “whale” players? We spent a lot of time on EOC to balance the advantages of small players and big players. Big players can bring them huge profits through mechanisms such as guild wars; but small players can still gain their own unique advantages through the blind box mechanism and the hero lending system. Communication and cooperation between players, instead of competition, is the most important part of our game. About EoC: EOC is a blockchain game that can develop different strategies while fighting in the Middle Ages. If you are looking for realistic medieval battles and ready to embark on a dangerous path to glory and wealth, then this game is for you. Participants can enjoy a higher level of fun through the advanced Play To Earn (P2E) GameFi model. This game will truly make you rich by rewarding users with a series of mainstream crypto assets including Bitcoin. It features multiplayer GvG tournaments, blind box draws, first blood challenges, and ruthless battles in the arena of the stunning and grim medieval era. Website|Twitter|Discord|Telegram

https://medium.com/@EraofCivilization/eoc-ama-abc1596cc6e8

['Era Of Civilization', 'The Ancient World']

2021-12-26 13:12:10.064000+00:00

['Ama', 'Report', 'Bsc', 'Gamefi']

Title EoC AMAContent Q1 background EOC team Hello everyone I’m Paul EOC gaming industry almost 15 year I’m one game producer Era Civilization Ancient World EOC It’s honor today share GameFi project everyone community hope today’s AMA people know done EOC situation member game production team entire EOC technical team 5–10 year experience game development cooperated many year Whether H5 game console mobile game top level UK art team 2 masterlevel game artist working UI designer special effect designer 5–8 year game experience art team undertook outsourcing largescale foreign game project early year rich experience providing 3D largescale project service sound effect engineer many year working experience major domestic foreign film company including Sony Pictures Columbia Film Group mainly focus sound effect production editing mature technology aesthetic work line mainstream player Q2 ambition purpose EOC try achieve EOC want bring player element fun firmly believe existing Gamefi project cannot called “games” Gaming entertainment service industry essence still need bring people entertainment player play game make money may called “game” even said people working game company also believe see countless game based concept metauniverse might say virtual product existing Gamefi project valuable game fact socalled value ultimately diluted infinitely usual GameFi sell scarcity uniqueness fact scarcity uniqueness nothing except concept NFT world EOC spent lot time designing different game element EOC allows player develop different strategy medieval battle EOC player continuously collect hero different attribute level opening blind box Heroes participate adventure participate alliance war game explore adventure complete different daily task participate country building game farm work Different combination strategy allowed different task resulting different game result learned combination many strategy game greatly increased diversity game ecology basic situation EOC content game rich complicated may able express essence word recommended everyone participate game explore wonderful world together Enjoy fun playing Q3 understood game player obtain income various way EOC world tell u detail method obtain income game EOC team strives guarantee earning EOC player GameFi project best provide participant best tokenomic model maintain entire ecological value player ultimately allow anyone earn EOC Coins EOCC proficient game skill Since ingame item EOC digitized NFT player easily complete transfer transaction NFT asset EOC game market time difference EOC usual playtoearn GameFi model blockchain game realistic reward system EOC game truly make EOC player rich rewarding player series mainstream crypto asset including Bitcoin never seen game Therefore player enjoy higher level fun advanced GameFi reward mode EOC key concept EOC playtolive P2L given many playersstarting poor player rural reality gaining ability make money playing game virtual world call leisure economy cannot said player working EOC company given player valuable thirdparty asset game player don’t worry unable get back investment game price GameFi project token drop secondary market Q4 function MMR EOCC token EOC game setting MMR platform token support decentralized computing power trading platform Make Rich naturally combine traditional Filcoin mining mainstream DeFi game setting unique Staking protocol Since Make Rich platform one main investor addition consuming BNB token gas Binance Smart Chain EOC also consumes EOCC MMR Users MMR draw blind box beginning stage EOC gain rare ingame item time platform also feed user back multiple benefit ◇ earned MMR 50 go game union pool increase income player build game union ◇ earned MMR 10 collected foundation provide incentive future community governance etc ◇ earned MMR 20 used contribute liquidity MMR EOCC maintain game economic system EOCC currency game EOCC exists every corner game initial price 1EOCC00001U specific usage scenario EOCC include buying blind box creating game union triggering union war hero leasing EOCC integrate organically different part game EOCC advantageous complete player Q5 many successful GameFi project around innovation EOC made term function gameplay setting get attention participation player think EOC following advantage First even player participated closed beta see official promotional video game beautifully made strong playability excellent music art great combat special effect Second borrowed current mature economic model complete investmentearningreturn mechanism adapt type GameFi player group greatest extent Third shorter profit cycle playing EOC combined mainstream crypto asset reward system allows player achieve low investment high return Fourth EOC meet various need user Many GameFi project simple web game product EOC support variety scenario web version PC version Android version IOS version etc allowing user play game anytime anywhere Q6 inspiration come choose BSC team belief doubt BSC biggest winner round GameFi boom According latest statistic 20 top 50 active GameFis run BSC accounting 40 total remaining 30 GameFis distributed infrastructure Ethereum Flow Tron Solana Avalanche Games Wizardium Fortified Universe Island BSC still maintain high popularity choose BSC supporting blockchain Q7 status product development Describe detailed information EOC project roadmap Popularity crucial GameFi project EOC whitelist entry officially start December 20 caused quite stir blockchain game circle abroad take week EOC attract 150000 daily active follower social medium EOC including Telegram Twitter Medium Discord total subscriber EOC channel exceed 13 million Let introduce project route ◇ 202111 EOC official website online ◇ 202112 EOC officially launched rare blind box draw event December 20 ◇ 20221 EOC complete underlying design battle calculus DEMO development define hero prototype combat skill design world background design ◇ 20222 EOC officially launched including first blood challenge system ◇ form EOC competition launched middle 20222 including ingame union battle ◇ next development roadmap MMR platform EOC announced late February 2022 ◇ also launch beta version NFT game market soon addition can’t help want spoil everyone EOC launch crosschain gameplay soon surprise participation Anyone interested first follow official website httpswwweocryptokencom post latest news official website Thank Live question Q1 minimum capital required start playing EOC start playing starting point playing EOC player least one hero take different game challenge minimum cost EOC player spend 20USDT draw primary blind box obtain hero Q2 get EOC token play game get EOC token Yes easy way get EOC token EOCC participate daily challenge game Another way farming system game find detail official white paper EOC Q3 choose BSC network think need gas fee transaction HECO better said important element GameFis popularity one want play game without player interacting number potential player first priority development team think EOC team like many game development team chose BSC game medium Even HECO achieve lower price Q4 guild system game powerful building guild need lot money reduce cost attract guild important mechanism game use DAO let player vote rewrite unbalanced game content DAO mechanism become important part EOC ecosystem information available official website soon Q5 also mechanism game balance small funding player “whale” player spent lot time EOC balance advantage small player big player Big player bring huge profit mechanism guild war small player still gain unique advantage blind box mechanism hero lending system Communication cooperation player instead competition important part game EoC EOC blockchain game develop different strategy fighting Middle Ages looking realistic medieval battle ready embark dangerous path glory wealth game Participants enjoy higher level fun advanced Play Earn P2E GameFi model game truly make rich rewarding user series mainstream crypto asset including Bitcoin feature multiplayer GvG tournament blind box draw first blood challenge ruthless battle arena stunning grim medieval era WebsiteTwitterDiscordTelegramTags Ama Report Bsc Gamefi

Official CatBonk NFT Collection

Official CatBonk NFT Collection The CatBonk team is excited to announce what we have been working on behind the scenes! Coming early 2022 will be 7,999 completely unique CatBonk NFTs! These cats are equipped with the finest of bats and they are certainly ready to bonk! All NFTs are original artworks and to-be minted on the Binance Smart Chain alongside our native CABO token. The CatBonk community is ready to break into the NFT market! CatBonk NFT Launch Plan: What to expect in the coming weeks Trait Teasers We are very excited to reveal bits and pieces of what make our NFTs special, starting with some hyper rare traits like the Diamond Bat or the Hero Gauntlet! First Edition CatBonk NFT Roadmap We will release our NFT Roadmap which will be separate from the community roadmap in order to better delineate our specific plans and goals for the CatBonk NFT. Building a Dynamic and Diverse Discord community As important as Telegram is, we believe a healthy future for the CatBonk community necessitates an active and engaged Discord. We believe Discord allows for more constructive discourse and enables more organized discussion. CatBonk NFT Launch We firmly stand by everyone having the right to mint their very own CatBonk NFT, whether you’re a Small Cat or a King Cat. To ensure this, CatBonk NFTs will be available for 0.1 BNB per mint at a limit of 20 per transaction. Once ready for launch, we will have a page on our website dedicated to the minting process. Simply connect your wallet and select the amount of NFTs you would like to mint. After confirming the transaction your completely unique CatBonk NFTs will be delivered directly to your connected wallet! Rewards and Incentives Holders of CABO are the heart of the CatBonk community and as such our first 1000 NFTs are reserved for CABO holders. Expect these rewards to come in the form of airdrops, raffles, and contests as we aim to give back to CABO holders every step of the way! (Airdrop qualifications to be announced) Mint Milestones There are many opportunities to reward our holders at each major mint milestone including, but not limited to serial NFT raffles for CABO holders, using revenue to donate to philanthropic organizations (eg, endangered big cat initiatives, cat shelters, etc.), allocating mint revenue toward marketing endeavors for the CatBonk community and CABO token, instituting large-scale token buy-and-burns and/or token buy-backs with mint revenue, and more! Stay tuned for additional information and updates as we begin this very exciting journey! Be sure to follow our socials and become a member of the CatBonk family! https://catbonk.com https://twitter.com/CatBonk1 https://discord.gg/Jm3sfuktWq

https://medium.com/@catbonk/official-catbonk-nft-collection-64899a6336c0

[]

2021-12-18 17:14:26.228000+00:00

['Nft', 'Bsc', 'Cats', 'Memes']

Title Official CatBonk NFT CollectionContent Official CatBonk NFT Collection CatBonk team excited announce working behind scene Coming early 2022 7999 completely unique CatBonk NFTs cat equipped finest bat certainly ready bonk NFTs original artwork tobe minted Binance Smart Chain alongside native CABO token CatBonk community ready break NFT market CatBonk NFT Launch Plan expect coming week Trait Teasers excited reveal bit piece make NFTs special starting hyper rare trait like Diamond Bat Hero Gauntlet First Edition CatBonk NFT Roadmap release NFT Roadmap separate community roadmap order better delineate specific plan goal CatBonk NFT Building Dynamic Diverse Discord community important Telegram believe healthy future CatBonk community necessitates active engaged Discord believe Discord allows constructive discourse enables organized discussion CatBonk NFT Launch firmly stand everyone right mint CatBonk NFT whether you’re Small Cat King Cat ensure CatBonk NFTs available 01 BNB per mint limit 20 per transaction ready launch page website dedicated minting process Simply connect wallet select amount NFTs would like mint confirming transaction completely unique CatBonk NFTs delivered directly connected wallet Rewards Incentives Holders CABO heart CatBonk community first 1000 NFTs reserved CABO holder Expect reward come form airdrop raffle contest aim give back CABO holder every step way Airdrop qualification announced Mint Milestones many opportunity reward holder major mint milestone including limited serial NFT raffle CABO holder using revenue donate philanthropic organization eg endangered big cat initiative cat shelter etc allocating mint revenue toward marketing endeavor CatBonk community CABO token instituting largescale token buyandburns andor token buyback mint revenue Stay tuned additional information update begin exciting journey sure follow social become member CatBonk family httpscatbonkcom httpstwittercomCatBonk1 httpsdiscordggJm3sfuktWqTags Nft Bsc Cats Memes

BitWell * GoldMiner — Spotlight on GoldMiner’s Game launch

On December 17, BitWell initial listed the popular GameFi project GoldMiner (GM), opened GM/USDT spot trading, launched deposit and trading tournament. The same day, GoldMiner CTO Victor was a guest of BitWell community, bringing users a project sharing. The following is a complete review of the content of this sharing. Host: Catherine, VP of BitWell Overseas Market Catherine：First, please briefly introduce your career, self-introduction and Gold Miner, what kind of project it is？ Victor：I am one of the principals of Gold Miner, working for a well-known game company in Southeast Asia. GoldMiner aims to build an open and decentralized meta-universe and eliminate the centralized platform of traditional game distribution. Therefore, the ecosystem is very important to protect the interests of all participants and maintain the balance of the economic system’s ecosystem. In order to achieve this goal, the ecosystem design has been carefully considered from three aspects: 1. Ensure that the value of gold tokens continues to increase. 2. Build a complete closed loop of economic ecology. 3. Establish a highly decentralized autonomous organization (DAO) to allow both groups and individuals to win. GoldMiner is a high user, designed to let you gain wealth while enjoying puzzle games. GoldMiner is a classic third-person shooter NFT game, and its condition is that anyone can start playing without paying expensive upfront payments. In addition, “Gold Miner” uses the Play-to-Earn model to provide players with tokens and equipment by participating in dynamic games and PvP tournaments. By seamlessly combining DeFi and P2E models in this way, GoldMiner provides players with the opportunity to play games and get rewards at the same time. In order to create a relaxing environment for players who are not familiar with the cryptocurrency market and NFT, we have added a mechanism called crypto battle to the gameplay to encourage these players to conduct their own research and understand the market. Catherine：How many members do you have in your team since the beginning of its development? Did you have any differences while implementing some plans, and how to resolve them? Victor：Due to the needs of project development, the team initially only had about 20 people, but it has now grown to hundreds. Regarding the issue of anti-robots, we have two internal solutions. After repeated discussions among our internal members and listening to a large number of feedback from real users, we finally decided to sanction these robots. Catherine：Next, please introduce the economic model in the game. How do users make money through this game? Victor：1. Players can start the game and purchase NFT heroes through tutorials to obtain various rare equipment. 2. Play the game in PvE or PvP mode. 3. Players can sell these items on the market and get $GM tokens. 4. You can mint powerful NFTs and use GM tokens to auction them or directly trade with other players. 5. Players can participate in regular tournaments and activities held by the Gold Medal Game Studio to win prizes and rewards. 6. You can bet with other players in PvP mode to get more tokens. Catherine：Can you tell us in detail about the token repurchase and destruction? Victor：We carried out repurchase burns on December 15th, December 8th and November 17th. The cumulative number of burned tokens exceeded 2 billion. This is an amazing number. The detailed information can be found on our Twitter. See, everything is fair and transparent. Catherine：What is your team’s short-term planning for this project? Victor：We will focus on two aspects in the short term. One is marketing. We will find more influential people and exchanges in the cryptocurrency field for deeper cooperation. On the other hand, the focus is on the project itself. The official server of the game is not long after it is online, and there are many areas that need to be optimized. We will give priority to solving this problem and unlock more gameplay in the future. Catherine: Thank you Victor for your answer, let’s take a look at the questions from the community and Victor will pick 5 questions to answer. 1.The game is equipped with an anti-script program, and the processing of scripts is strict. We know that most of their games currently occupy studios, and at the same time borrow some scripts to handle a large number of accounts. If the use of scripts is prohibited, will it affect the game data? Victor：Yes, we have always disliked cheating robots. We are also communicating with many game studios to establish a cooperative relationship without affecting the balance of the game. We will make a formal statement on how to ban robots, and we will also Guarantee the income of normal users, please pay attention to our Twitter. 2.How will the GM project carry out an in-depth cooperation with Pancake? can you give us more details? Victor：This is an explosive news, and we will announce specific information at the right time. Please be patient and will not disappoint users. 3.To appreciate a Play-to-Earn Project,they must have the FUN(in Playing) and of course, the (EARNING). Does @DeFiGoldMiner have all of these Characteristics? Can we,players,have both FUN and EARNINGS in your Platform? Many games have been adjusted according to market conditions since they were launched. Does GM have a backup economic model? My question is about your long term marketing plans. How, or through which big partnerships do you plan on utilising to pass your product onto the normal -especially non-crypto people? What’s the most ambitious goal of your project? What is the ultimate vision that Your project? Victor：For the adjustment of the economic model, we also have some new ideas, but we are not a dictator. Before updating the economic model, we will initiate a vote to allow our users to govern our tokens and communities together. Judging from the current market situation, our decision will be related to the market situation, but our ultimate goal is definitely to launch the world’s largest exchange. I believe this is also the expectation of all users. For those who don’t have cryptocurrency, we will launch a free downloadable version of the game, so that they can try it for free on their computer or mobile phone, but this version does not make them money, it will only make them like this Games and want to learn more. 4.User experience is a very important issue. Especially for new users, what efforts have the project side made? Victor：We will release new game strategies as soon as possible, and will let volunteers in various countries translate, to make the game easier to play and easier to understand. We have been working hard to optimize the game, and we will do better and better to adopt more users’ opinions.

https://medium.com/@bitwellglobal/ama-recap-bitwell-goldminer-spotlight-on-goldminers-game-launch-2f1e0d81ebf5

[]

2021-12-18 07:15:09.642000+00:00

['Gamefi', 'GM', 'Bsc']

Title BitWell GoldMiner — Spotlight GoldMiner’s Game launchContent December 17 BitWell initial listed popular GameFi project GoldMiner GM opened GMUSDT spot trading launched deposit trading tournament day GoldMiner CTO Victor guest BitWell community bringing user project sharing following complete review content sharing Host Catherine VP BitWell Overseas Market Catherine：First please briefly introduce career selfintroduction Gold Miner kind project is？ Victor：I one principal Gold Miner working wellknown game company Southeast Asia GoldMiner aim build open decentralized metauniverse eliminate centralized platform traditional game distribution Therefore ecosystem important protect interest participant maintain balance economic system’s ecosystem order achieve goal ecosystem design carefully considered three aspect 1 Ensure value gold token continues increase 2 Build complete closed loop economic ecology 3 Establish highly decentralized autonomous organization DAO allow group individual win GoldMiner high user designed let gain wealth enjoying puzzle game GoldMiner classic thirdperson shooter NFT game condition anyone start playing without paying expensive upfront payment addition “Gold Miner” us PlaytoEarn model provide player token equipment participating dynamic game PvP tournament seamlessly combining DeFi P2E model way GoldMiner provides player opportunity play game get reward time order create relaxing environment player familiar cryptocurrency market NFT added mechanism called crypto battle gameplay encourage player conduct research understand market Catherine：How many member team since beginning development difference implementing plan resolve Victor：Due need project development team initially 20 people grown hundred Regarding issue antirobots two internal solution repeated discussion among internal member listening large number feedback real user finally decided sanction robot Catherine：Next please introduce economic model game user make money game Victor：1 Players start game purchase NFT hero tutorial obtain various rare equipment 2 Play game PvE PvP mode 3 Players sell item market get GM token 4 mint powerful NFTs use GM token auction directly trade player 5 Players participate regular tournament activity held Gold Medal Game Studio win prize reward 6 bet player PvP mode get token Catherine：Can tell u detail token repurchase destruction Victor：We carried repurchase burn December 15th December 8th November 17th cumulative number burned token exceeded 2 billion amazing number detailed information found Twitter See everything fair transparent Catherine：What team’s shortterm planning project Victor：We focus two aspect short term One marketing find influential people exchange cryptocurrency field deeper cooperation hand focus project official server game long online many area need optimized give priority solving problem unlock gameplay future Catherine Thank Victor answer let’s take look question community Victor pick 5 question answer 1The game equipped antiscript program processing script strict know game currently occupy studio time borrow script handle large number account use script prohibited affect game data Victor：Yes always disliked cheating robot also communicating many game studio establish cooperative relationship without affecting balance game make formal statement ban robot also Guarantee income normal user please pay attention Twitter 2How GM project carry indepth cooperation Pancake give u detail Victor：This explosive news announce specific information right time Please patient disappoint user 3To appreciate PlaytoEarn Projectthey must FUNin Playing course EARNING DeFiGoldMiner Characteristics weplayershave FUN EARNINGS Platform Many game adjusted according market condition since launched GM backup economic model question long term marketing plan big partnership plan utilising pas product onto normal especially noncrypto people What’s ambitious goal project ultimate vision project Victor：For adjustment economic model also new idea dictator updating economic model initiate vote allow user govern token community together Judging current market situation decision related market situation ultimate goal definitely launch world’s largest exchange believe also expectation user don’t cryptocurrency launch free downloadable version game try free computer mobile phone version make money make like Games want learn 4User experience important issue Especially new user effort project side made Victor：We release new game strategy soon possible let volunteer various country translate make game easier play easier understand working hard optimize game better better adopt users’ opinionsTags Gamefi GM Bsc

Metaplace.finance Raised $150k in Private Sale Round!!

Metaplace.finance Raised $150k in Private Sale Round!! We are pleased to announce that the Private Sale Round was finished today with great success. Thank You for participating, the limited number of interested investors venture capitalists exceeded our expectations. We are happy our system works perfectly and is super transparent according to our community. Summarizing the results obtained from the private sale on our platform, we closed the sale in just few hours: Private Sale Insights: From the first round of raised funds we have sold 5% of total supply to venture capitalists and private investors. For all the user’s average buy 285 BNB which is approx $156750. Private sale was close @ 18th Dec 16:00 UTC 2021. Raised funds securely saved in contract owner wallet here. Total supply: 100,000,000,000 Circulation Supply: 35,000,000,000 (initial market) Private sale price 1 BNB = 17,325,000 (5% of total supply) Presale price 1 BNB = 16,500,000 (30% of total supply) Public listing price 1 BNB = 14,850,000 Tokens will be distributed among private sale participants after market is initilized on pancakeswap, team $MPC will ensure price stability using buyback and staking pool utility. Further development will be made according to roadmap. Tokenization BSC Contract Address: 0xd6bb010019c9d3ea177e6d2e9af7938c6e53da55 Total Supply： 100 Billions 5%: Private Sale 30%: Presale 20%: Liquidity (locked for 20 years) 10%: CEX listing (Provide liquidity to Centralized exchange gate.io/binance) 2%: ILO fee 20%: Staking pool (3 months reward duration) 5%: Strategic partnership & Airdrop (locked for 6 months) 6% Marketing & Development (locked for 6 months) 2% Team tokens (locked for 1 year) Funds Usage: Funds used for metaverse development, production and partnership with other projects. Also smart contract audit report is obtained by renowned firm (CERTIK). Moreover team Metaplace is committed to deliver marketing results Featured on well know platform yahoo/benzinga/marketwatch and other social media platform. Staking platform is ready to go live after market initilization similarly metaverse first beta version will be release according to roadmap. What Metaplace offers? Metaplace is a decentralized all-in-one online marketplace with integrated feature of metaverse, enabling buyers to physically examine goods through virtual reality. It’s fair, secure and innovative all the way. It helps in taking control of your shopping now, with virtual reality experience examine your goods before making a purchase. Already Achieved ✔️ Yahoo Finance Coverage ✔️ Benzinga Coverage ✔️ Market Watche ✔️ Contract base Certik & Solidproof Audit ✔️ Twitter 32k, ✔️ Telegram 30k ✔️ Discord 12k ✔️ Staking Platform: staking.metaplace.finance ✔️ Governance Platform ✔️ Partnership with Chainlist.finance 📌 CEX Listing (binance/gate.io/kucoin) 📌 Banner Ads ( BSCScan, PooCoin, DEXTools) Possible Exchanges: KuCoin Binance.com Huobi Gate.io Hotbit Xt.com Zb.com Social Links: Website: http://metaplace.finance/ Application: https://app.metaplace.finance/ Whitepaper: http://metaplace.finance/whitepaper.pdf Medium: https://metaplacebsc.medium.com/ Github: https://github.com/metaplacebsc Telegram: https://t.me/metaplacebsc Twitter: https://twitter.com/metaplacebsc Instagram: https://www.instagram.com/metaplacebsc/ Facebook: https://www.facebook.com/metaplacebsc YouTube: https://www.youtube.com/channel/UClWF4GacAbidx_r9iZUItiw Reddit: https://www.reddit.com/user/metaplacebsc

https://medium.com/@metaplacebsc/metaplace-finance-raised-150k-in-private-sale-round-6bed36e69fe2

[]

2021-12-21 07:53:17.727000+00:00

['Presales', 'Private Sale', 'Bsc', 'Binance', 'Metaverse']

Title Metaplacefinance Raised 150k Private Sale RoundContent Metaplacefinance Raised 150k Private Sale Round pleased announce Private Sale Round finished today great success Thank participating limited number interested investor venture capitalist exceeded expectation happy system work perfectly super transparent according community Summarizing result obtained private sale platform closed sale hour Private Sale Insights first round raised fund sold 5 total supply venture capitalist private investor user’s average buy 285 BNB approx 156750 Private sale close 18th Dec 1600 UTC 2021 Raised fund securely saved contract owner wallet Total supply 100000000000 Circulation Supply 35000000000 initial market Private sale price 1 BNB 17325000 5 total supply Presale price 1 BNB 16500000 30 total supply Public listing price 1 BNB 14850000 Tokens distributed among private sale participant market initilized pancakeswap team MPC ensure price stability using buyback staking pool utility development made according roadmap Tokenization BSC Contract Address 0xd6bb010019c9d3ea177e6d2e9af7938c6e53da55 Total Supply： 100 Billions 5 Private Sale 30 Presale 20 Liquidity locked 20 year 10 CEX listing Provide liquidity Centralized exchange gateiobinance 2 ILO fee 20 Staking pool 3 month reward duration 5 Strategic partnership Airdrop locked 6 month 6 Marketing Development locked 6 month 2 Team token locked 1 year Funds Usage Funds used metaverse development production partnership project Also smart contract audit report obtained renowned firm CERTIK Moreover team Metaplace committed deliver marketing result Featured well know platform yahoobenzingamarketwatch social medium platform Staking platform ready go live market initilization similarly metaverse first beta version release according roadmap Metaplace offer Metaplace decentralized allinone online marketplace integrated feature metaverse enabling buyer physically examine good virtual reality It’s fair secure innovative way help taking control shopping virtual reality experience examine good making purchase Already Achieved ✔️ Yahoo Finance Coverage ✔️ Benzinga Coverage ✔️ Market Watche ✔️ Contract base Certik Solidproof Audit ✔️ Twitter 32k ✔️ Telegram 30k ✔️ Discord 12k ✔️ Staking Platform stakingmetaplacefinance ✔️ Governance Platform ✔️ Partnership Chainlistfinance 📌 CEX Listing binancegateiokucoin 📌 Banner Ads BSCScan PooCoin DEXTools Possible Exchanges KuCoin Binancecom Huobi Gateio Hotbit Xtcom Zbcom Social Links Website httpmetaplacefinance Application httpsappmetaplacefinance Whitepaper httpmetaplacefinancewhitepaperpdf Medium httpsmetaplacebscmediumcom Github httpsgithubcommetaplacebsc Telegram httpstmemetaplacebsc Twitter httpstwittercommetaplacebsc Instagram httpswwwinstagramcommetaplacebsc Facebook httpswwwfacebookcommetaplacebsc YouTube httpswwwyoutubecomchannelUClWF4GacAbidxr9iZUItiw Reddit httpswwwredditcomusermetaplacebscTags Presales Private Sale Bsc Binance Metaverse

🔥 #YearnNFT Finance #Presale live now 🔥

🔥 #YearnNFT Finance #Presale live now 🔥 Hurry up until it’s to late! Buy #YFNFT Big $gems Lowest Supply 300X Moon NFT Token #Presale Is Live 🚀🚀🚀 YearnNFT is all new BSC based NFT marketplace to trace and mint NFT’s with ease. Hurry Up! Buy #YFNFT from YearnNFT Finance up things to make it 300X #YFNFT to moon 🚀🚀 Lowest Supply : 73332 Presale Live : https://yearnnft.finance/Presale 🔔 𝐓𝐨𝐤𝐞𝐧𝐨𝐦𝐢𝐜𝐬 𝐚𝐧𝐝 𝐃𝐢𝐬𝐭𝐫𝐢𝐛𝐮𝐭𝐢𝐨𝐧 🔔 Token Name: YearnNFT Symbol : YFNFT Network : Binance Smart Chain(BSC) Features : Digital Art🌄 NFT, Governance, Fees, Rewards , Payments and Trade Presale link : https://yearnnft.finance/Presale 𝐃𝐢𝐬𝐭𝐫𝐢𝐛𝐮𝐭𝐢𝐨𝐧 Total Supply : 73332 YFNFT Available Supply : 73332 YFNFT Presale : 40% ( 29332.8) Liquidity : 35% ( 25666.20 ) Registration Bounty 4% ( 2933.28) Referral Bounty 4% ( 2933.28) Listing : After Presale #Pancakeswap & #Apeswap 🏞️🎇🌠🎆🌇🏙️🌌🌃🌁 🏄🏻🏄🏻🏄🏻🏄🏻🚀🚀🚀🚀 $YFNFT is a #BSC Based #NFT Marketplace Powered by YearnNFT , the low Supply Token. 💹💹💹💹💹 Website : https://yearnnft.finance/ Follow us on twitter : https://twitter.com/YearnNft Telegram : https://t.me/YearnNFT Medium: https://medium.com/@yearnnft Reddit : https://www.reddit.com/user/YearnNFT/ #Crypto #Cryptocurrency #Blockchain #Yearnnft #pancakeswap #Bnb #Binance #NFT #Nfts #Nftart

https://medium.com/@Cryptodiana/yearnnft-finance-presale-live-now-51d7ac584437

['Crypto Diana']

2021-12-18 07:53:25.082000+00:00

['Presales', 'Pancakeswap', 'Binance', 'Bsc']

Title 🔥 YearnNFT Finance Presale live 🔥Content 🔥 YearnNFT Finance Presale live 🔥 Hurry it’s late Buy YFNFT Big gem Lowest Supply 300X Moon NFT Token Presale Live 🚀🚀🚀 YearnNFT new BSC based NFT marketplace trace mint NFT’s ease Hurry Buy YFNFT YearnNFT Finance thing make 300X YFNFT moon 🚀🚀 Lowest Supply 73332 Presale Live httpsyearnnftfinancePresale 🔔 𝐓𝐨𝐤𝐞𝐧𝐨𝐦𝐢𝐜𝐬 𝐚𝐧𝐝 𝐃𝐢𝐬𝐭𝐫𝐢𝐛𝐮𝐭𝐢𝐨𝐧 🔔 Token Name YearnNFT Symbol YFNFT Network Binance Smart ChainBSC Features Digital Art🌄 NFT Governance Fees Rewards Payments Trade Presale link httpsyearnnftfinancePresale 𝐃𝐢𝐬𝐭𝐫𝐢𝐛𝐮𝐭𝐢𝐨𝐧 Total Supply 73332 YFNFT Available Supply 73332 YFNFT Presale 40 293328 Liquidity 35 2566620 Registration Bounty 4 293328 Referral Bounty 4 293328 Listing Presale Pancakeswap Apeswap 🏞️🎇🌠🎆🌇🏙️🌌🌃🌁 🏄🏻🏄🏻🏄🏻🏄🏻🚀🚀🚀🚀 YFNFT BSC Based NFT Marketplace Powered YearnNFT low Supply Token 💹💹💹💹💹 Website httpsyearnnftfinance Follow u twitter httpstwittercomYearnNft Telegram httpstmeYearnNFT Medium httpsmediumcomyearnnft Reddit httpswwwredditcomuserYearnNFT Crypto Cryptocurrency Blockchain Yearnnft pancakeswap Bnb Binance NFT Nfts NftartTags Presales Pancakeswap Binance Bsc

Multichain partnership with Singular

Multichain partnership with Singular An extraordinary partnership that will bring amazing benefits for DeFi Launch community on multiple chains As a multichain incubator and launchpad, DeFi Launch is continuously nurturing its ecosystem to build a great network of resources. All these resources are used to strengthen the protocols of every project we incubate and launch. A key part is the DeFi Partners section of our Incubation Program, where we connect newborn projects we successful DeFi projects, that are simply not available to most unknown projects that just launched on the DeFi landscape. Singular is a yield farming protocol that initially launched on BSC and quickly went over to Polygon, Fantom and Avalanche. This provides us with the unique opportunity to add a strategic partner to our Incubation Program, opening partnership opportunities in 4 different chains. So, what’s coming next? As part of our Incubation Program, we’ll facilitate a connection between Singular and Bikini Finance, and we’ll build a bridge with all the upcoming projects that we are currently incubating and will launch soon. But that’s not all, new farms and pools opportunities are being explored and will be announced shortly involving $DLAUNCH (at BSC) and $fDLAUNCH (at Fantom), and $SING.

https://medium.com/@defilaunch/multichain-partnership-with-singular-9d4471ed319

['Defi Launch Incubator']

2021-12-26 19:47:26.792000+00:00

['Bsc', 'Fantom', 'Binance', 'Binance Smart Chain', 'Defi']

Title Multichain partnership SingularContent Multichain partnership Singular extraordinary partnership bring amazing benefit DeFi Launch community multiple chain multichain incubator launchpad DeFi Launch continuously nurturing ecosystem build great network resource resource used strengthen protocol every project incubate launch key part DeFi Partners section Incubation Program connect newborn project successful DeFi project simply available unknown project launched DeFi landscape Singular yield farming protocol initially launched BSC quickly went Polygon Fantom Avalanche provides u unique opportunity add strategic partner Incubation Program opening partnership opportunity 4 different chain what’s coming next part Incubation Program we’ll facilitate connection Singular Bikini Finance we’ll build bridge upcoming project currently incubating launch soon that’s new farm pool opportunity explored announced shortly involving DLAUNCH BSC fDLAUNCH Fantom SINGTags Bsc Fantom Binance Binance Smart Chain Defi

Win a valuable NFT with Decentralotto and DEXKIT!

Win a valuable NFT with Decentralotto and DEXKIT! In order to continue providing its investors and the crypto community with Decentralized Finance solutions that adapt to their needs, the DEXKIT team finds a new collaborator on the go. This is the case of Decentralotto, a very innovative DeFi project, with very valuable human capital, which will be discussed a little in the following lines. Decentra team is responsible for developing Smart Contracts in the Binance Smart Chain network in order to build fair lottery systems, in which true randomness is used when selecting the winner in their Solidity developments, this using Chainlink tools, who in turn has provided the DEXKIT team with the same tools to develop their innovations. In addition to the fact that the Decentra team has its GitHub repository, where you will find all the lines of code for Smart Contracts. What is the NFT contest about? The DEXKIT team, through innovative alliances, tries to fund their ideas and, in turn, wants to do it fairly, giving back to the community a little of how much they have received. This is why the team has arranged an NFT Champion from its famous Coin League game to be raffled off by purchasing a decentralized lottery ticket produced by Decentralotto. If you are interested in helping the DEXKIT team to continue financing their DeFi innovations and in turn you want to have the real probability of winning this NFT, enter this site that the partner has arranged for the project, where you can get your ticket very easily through $ BNB. We will explain the steps you must take to buy yours, below: Enter with your web3 browser (Trust Wallet or Metamask) in the DEXKIT’s site within the Decentralotto app. Connect your wallet in the upper right corner of the screen and make sure you are on the Binance Smart Chain network. 2. When you are connected, you will be able to view the complete profile, where you will be able to choose the number of tickets to buy and view the details of the system at user level. Press ‘Buy Tickets’ when you make your choice, confirm with your wallet and congratulations! You are already in the draw! The more tickets you buy, the more chances you will have to earn the raffle. As it is all automatic, the winner will be chosen by the Chainlink Verifiable Random Function (VRF) and the winner will receive their brand new NFT in their wallet. We appreciate you taking the time to read this article and we invite you to help us continue to provide you with free DeFi solutions!

https://medium.com/@dexkit/win-a-valuable-nft-with-decentralotto-and-dexkit-b20c7bc9aba3

[]

2021-12-18 21:40:20.129000+00:00

['Blockchain', 'Defi', 'Binance Smart Chain', 'Lottery', 'Bsc']

Title Win valuable NFT Decentralotto DEXKITContent Win valuable NFT Decentralotto DEXKIT order continue providing investor crypto community Decentralized Finance solution adapt need DEXKIT team find new collaborator go case Decentralotto innovative DeFi project valuable human capital discussed little following line Decentra team responsible developing Smart Contracts Binance Smart Chain network order build fair lottery system true randomness used selecting winner Solidity development using Chainlink tool turn provided DEXKIT team tool develop innovation addition fact Decentra team GitHub repository find line code Smart Contracts NFT contest DEXKIT team innovative alliance try fund idea turn want fairly giving back community little much received team arranged NFT Champion famous Coin League game raffled purchasing decentralized lottery ticket produced Decentralotto interested helping DEXKIT team continue financing DeFi innovation turn want real probability winning NFT enter site partner arranged project get ticket easily BNB explain step must take buy Enter web3 browser Trust Wallet Metamask DEXKIT’s site within Decentralotto app Connect wallet upper right corner screen make sure Binance Smart Chain network 2 connected able view complete profile able choose number ticket buy view detail system user level Press ‘Buy Tickets’ make choice confirm wallet congratulation already draw ticket buy chance earn raffle automatic winner chosen Chainlink Verifiable Random Function VRF winner receive brand new NFT wallet appreciate taking time read article invite help u continue provide free DeFi solutionsTags Blockchain Defi Binance Smart Chain Lottery Bsc

Arctic Dogs (2019) [F-u-l-l M-o-v-i-e]

Arctic Dogs (2019) [F-u-l-l M-o-v-i-e] Arctic Dogs (2019) Full Movie Online WATCH HERE ►► http://watch.pickmovi.com/movie/416153/arctic-dogs WATCH HERE ►► http://watch.pickmovi.com/movie/416153/arctic-dogs MOVIE INFO Swifty the Arctic Fox (Jeremy Renner) works in the mailroom of the Arctic Blast Delivery Service, but he has much bigger dreams. He yearns to become a Top Dog, the Arctic’s star husky couriers. To prove he can do it, he commandeers one of the sleds and delivers a mysterious package to a secret location. Once there, he stumbles on a hidden fortress overseen by the nefarious Otto Von Walrus (John Cleese). The blubbery evil genius commands an army of oddly polite puffin henchmen. Swifty discovers Otto Von Walrus’ villainous plan to drill beneath the snow-packed surface to unleash masses of ancient gas to melt the Arctic and become the world’s supreme ruler. To stop this sinister scheme, Swifty enlists the help of his friends: PB (Alec Baldwin), a neurotic polar bear, Lemmy (James Franco), a scatterbrained albatross, Jade Fox (Heidi Klum), a brainy engineer, Leopold (Omar Sy) and Bertha (Heidi Klum), two conspiracy theorist otters and Magda (Anjelica Huston), his curmudgeonly boss. Show More Rating:PG (for some mild action and rude humor) Genre:Action & Adventure, Animation, Comedy, Kids & Family Directed By:Aaron Woodley Written By:Bob Barlen, Cal Brunker, Aaron Woodley In Theaters:Nov 1, 2019 Wide Runtime:93 minutes Studio:Entertainment Studios Motion Pictures Stars : James Franco, Jeremy Renner, Alec Baldwin, Anjelica Huston, Michael Madsen, Heidi Klum Movie Synopsis Plot. Swifty the Arctic Fox (Jeremy Renner) works in the mailroom of the Arctic Blast Delivery Service, but he has much bigger dreams. He yearns to become a Top Dog, the Arctic’s star husky couriers. To prove he can do it, he commandeers one of the sleds and delivers a mysterious package to a secret location. WATCH HERE ►► http://watch.pickmovi.com/movie/416153/arctic-dogs Title Generate Arctic Dogs (2019) Full Movie, Arctic Dogs (2019) Full Movie , Arctic Dogs (2019) Full Movie Online, Arctic Dogs (2019) Full Movie, Watch Arctic Dogs (2019) Full Movie, Arctic Dogs (2019) Full Movie Download, Arctic Dogs (2019) Full Movie Streaming, Watch Arctic Dogs (2019) Full Movie, Watch Arctic Dogs (2019) Full Movie, Watch Arctic Dogs (2019) Full Movie , Arctic Dogs (2019) Full Movie Free, Arctic Dogs (2019) Full Movie HD 720p, Arctic Dogs (2019) Full Movie HD 1080p Quality, Streaming Arctic Dogs (2019) Full Movie, Arctic Dogs (2019) Full Movie, Watch Arctic Dogs (2019) Full Movie Online Free, Watch Arctic Dogs (2019) 2017 Movie Online, Download Arctic Dogs (2019) Full Movie, Watch Arctic Dogs (2019) Online Full HD, Watch Arctic Dogs (2019) Movie Free Online 123Movies Megashare Viooz.

https://medium.com/@kopih1489/arctic-dogs-2019-f-u-l-l-m-o-v-i-e-f861fbd08768

['Arctic Dogs']

2019-10-30 01:00:39.984000+00:00

['Animation', 'Chile', 'Spanish', 'Brasil', 'Argentina']

Title Arctic Dogs 2019 Full MovieContent Arctic Dogs 2019 Full Movie Arctic Dogs 2019 Full Movie Online WATCH ►► httpwatchpickmovicommovie416153arcticdogs WATCH ►► httpwatchpickmovicommovie416153arcticdogs MOVIE INFO Swifty Arctic Fox Jeremy Renner work mailroom Arctic Blast Delivery Service much bigger dream yearns become Top Dog Arctic’s star husky courier prove commandeers one sled delivers mysterious package secret location stumble hidden fortress overseen nefarious Otto Von Walrus John Cleese blubbery evil genius command army oddly polite puffin henchman Swifty discovers Otto Von Walrus’ villainous plan drill beneath snowpacked surface unleash mass ancient gas melt Arctic become world’s supreme ruler stop sinister scheme Swifty enlists help friend PB Alec Baldwin neurotic polar bear Lemmy James Franco scatterbrained albatross Jade Fox Heidi Klum brainy engineer Leopold Omar Sy Bertha Heidi Klum two conspiracy theorist otter Magda Anjelica Huston curmudgeonly bos Show RatingPG mild action rude humor GenreAction Adventure Animation Comedy Kids Family Directed ByAaron Woodley Written ByBob Barlen Cal Brunker Aaron Woodley TheatersNov 1 2019 Wide Runtime93 minute StudioEntertainment Studios Motion Pictures Stars James Franco Jeremy Renner Alec Baldwin Anjelica Huston Michael Madsen Heidi Klum Movie Synopsis Plot Swifty Arctic Fox Jeremy Renner work mailroom Arctic Blast Delivery Service much bigger dream yearns become Top Dog Arctic’s star husky courier prove commandeers one sled delivers mysterious package secret location WATCH ►► httpwatchpickmovicommovie416153arcticdogs Title Generate Arctic Dogs 2019 Full Movie Arctic Dogs 2019 Full Movie Arctic Dogs 2019 Full Movie Online Arctic Dogs 2019 Full Movie Watch Arctic Dogs 2019 Full Movie Arctic Dogs 2019 Full Movie Download Arctic Dogs 2019 Full Movie Streaming Watch Arctic Dogs 2019 Full Movie Watch Arctic Dogs 2019 Full Movie Watch Arctic Dogs 2019 Full Movie Arctic Dogs 2019 Full Movie Free Arctic Dogs 2019 Full Movie HD 720p Arctic Dogs 2019 Full Movie HD 1080p Quality Streaming Arctic Dogs 2019 Full Movie Arctic Dogs 2019 Full Movie Watch Arctic Dogs 2019 Full Movie Online Free Watch Arctic Dogs 2019 2017 Movie Online Download Arctic Dogs 2019 Full Movie Watch Arctic Dogs 2019 Online Full HD Watch Arctic Dogs 2019 Movie Free Online 123Movies Megashare VioozTags Animation Chile Spanish Brasil Argentina

WatcH Argentina vs Peru Live Stream Soccer

WATCH Live Streaming Argentina vs Peru Live FIFA World Cup Qualifying — CONMEBOL Full HD Soccer [ULTRAᴴᴰ1080p] Argentina vs. Peru 2020| Live Stream,. Argentina vs. Peru broadcast free all around the world. Visit here to get up-to-the-minute sports news coverage, scores…t.c Argentina vs. Peru Watch Live Streaming: “ Argentina vs. Peru: CONMEBOL WCQ live stream, TV channel, how to watch online, news, odds, start time VISIT HERE>>> https://tinyurl.com/y5bwmsj3 MATCH INFO Start date: 18 Nov 2020 06:30 Location: Lima Venue: Estadio Nacional Referee: Wilmar Roldan, Colombia Livestreaming, what’s in it for us? Technology has advanced significantly since the first internet livestream but we still turn to video for almost everything. Let’s take a brief look at why livestreaming has been held back so far, and what tech innovations will propel livestreaming to the forefront of internet culture. Right now livestreaming is limited to just a few applications for mass public use and the rest are targeted towards businesses. Livestreaming is to today what home computers were in the early 1980s. The world of livestreaming is waiting for a metaphorical VIC-20, a very popular product that will make live streaming as popular as video through iterations and competition. Image for post Shared Video Do you remember when YouTube wasn’t the YouTube you know today? In 2005, when Steve Chen, Chad Hurley, and Jawed Karim activated the domain “” they had a vision. Inspired by the lack of easily accessible video clips online, the creators of YouTube saw a world where people could instantly access videos on the internet without having to download files or search for hours for the right clip. Allegedly inspired by the site “Hot or Not”, YouTube originally began as a dating site (think 80s video dating), but without a large ingress of dating videos, they opted to accept any video submission. And as we all know, that fateful decision changed all of our lives forever. Because of YouTube, the world that YouTube was born in no longer exists. The ability to share videos on the scale permitted by YouTube has brought us closer to the “global village” than I’d wager anyone thought realistically possible. And now with technologies like Starlink, we are moving closer and closer to that eventuality. Although the shared video will never become a legacy technology, before long it will truly have to share the stage with its sibling, livestreaming. Although livestreaming is over 20 years old, it hasn’t gained the incredible worldwide adoption YouTube has. This is largely due to infrastructure issues such as latency, quality, and cost. Latency is a priority when it comes to livestreams. Latency is the time it takes for a video to be captured and point a, and viewed at point b. In livestreaming this is done through an encoder-decoder function. Video and audio are captured and turned into code, the code specifies which colours display, when, for how long, and how bright. The code is then sent to the destination, such as a streaming site, where it is decoded into colours and audio again and then displayed on a device like a cell phone. The delay between the image being captured, the code being generated, transmitted, decoded, and played is consistently decreasing. It is now possible to stream content reliably with less than 3 seconds of latency. Sub-second latency is also common and within the next 20 or so years we may witness the last cable broadcast (or perhaps cable will be relegated to the niche market of CB radios, landlines, and AM transmissions). On average, the latency associated with a cable broadcast is about 6 seconds. This is mainly due to limitations on broadcasts coming from the FCC or another similar organization in the interests of censorship. In terms of real-life, however, a 6 second delay on a broadcast is not that big of a deal. In all honesty a few hours’ delay wouldn’t spell the doom of mankind. But for certain types of broadcasts such as election results or sporting events, latency must be kept at a minimum to maximize the viability of the broadcast. Sensitive Content is Hard to Monitor Advances in AI technologies like computer vision have changed the landscape of internet broadcasting. Before too long, algorithms will be better able to prevent sensitive and inappropriate content from being broadcast across the internet on livestreaming platforms. Due to the sheer volume of streams it is much harder to monitor and contain internet broadcasts than it is cable, but we are very near a point where the ability to reliably detect and interrupt inappropriate broadcasts instantaneously. Currently, the majority of content is monitored by humans. And as we’ve learned over the last 50 or so years, computers and machines are much more reliable and consistent than humans could ever be. Everything is moving to an automated space and content moderation is not far behind. We simply don’t have the human resources to monitor every livestream, but with AI we won’t need it. Video Quality In the last decade we have seen video quality move from 720p to 1080p to 4K and beyond. I can personally remember a time when 480p was standard and 720p was considered a luxury reserved for only the most well funded YouTube videos. But times have changed and people expect video quality of at least 720p. Live streaming has always had issues meeting the demands of video quality. When watching streams on platforms like Twitch, the video can cut out, lag, drop in quality, and stutter all within about 45 seconds. Of course this isn’t as rampant now as it once was, however, sudden drops in quality will likely be a thorn in the side of live streams for years to come. Internet Speeds Perhaps the most common issue one needs to tackle when watching a live stream is their internet speed. Drops in video quality and connection are often due to the quality of the internet connection between the streamer and the viewer. Depending on the location of the parties involved, their distance from the server, and allocated connection speed the stream may experience some errors. And that’s just annoying. Here is a list of the recommended connection speeds for 3 of the most popular streaming applications: Facebook Live recommends a max bit rate of 4,000 kbps, plus a max audio bit rate of 128 kbps. YouTube Live recommends a range between 1,500 and 4,000 kbps for video, plus 128 kbps for audio. Twitch recommends a range between 2,500 and 4,000 kbps for video, plus up to 160 kbps for audio. Live streams are typically available for those of us with good internet. Every day more people are enjoying high quality speeds provided by fibre optic lines, but it will be a while until these lines can truly penetrate rural and less populated areas. Perhaps when that day comes we will see an upsurge of streaming coming from these areas. Language Barrier You can pause and rewind a video if you didn’t understand or hear something, and many video sharing platforms provide the option for subtitles. But you don’t really get that with a live stream. Pausing and rewinding an ongoing stream defeats the purpose of watching a stream. However, the day is soon approaching where we will be able to watch streams, in our own native language with subtitles, even if the streamer speaks something else. Microsoft Azure’s Cognitive Speech Services can give livestreaming platforms an edge in the future as it allows for speech to be automatically translated from language to language. The ability to watch a livestream in real time, with the added benefit of accurate subtitles in one’s own language, will also assist language learners in deciphering spontaneous speech. Monetization One of the most damning features of a live stream is the inherent difficulty in monetizing it. As mentioned before, videos can be paused and ads inserted. In videos, sponsored segments can be bought where the creators of the video read lines provided to them. Ads can run before videos etc. But in the case of a spontaneous live stream sponsored content will stick out. In the case of platforms like YouTube there are ways around ads. Ad blockers, the skip ad button, the deplorable premium account, and fast forwarding through sponsored segments all work together to limit the insane amount of ads we see every day. But in the case of a live stream, ads are a bit more difficult. Live streaming platforms could implement sponsored overlays and borders or a similar graphical method of advertising, but the inclusion of screen shrinking add-ons like that may cause issues on smaller devices where screen size is already limited. Monthly subscriptions are already the norm, but in the case of a live streaming platform (Twitch Prime not withstanding), it may be difficult for consumers to see the benefit in paying for a service that is by nature unscheduled and unpredictable. Live streams are great for quick entertainment, but as they can go on for hours at a time, re-watching streamed content is inherently time consuming. For this reason, many streamers cut their recorded streams down and upload them to platforms like YouTube where they are monetized through a partnership program. It is likely that for other streaming platforms to really take off, they would need to partner with a larger company and offer services similar to Amazon and Twitch. What Might the Future of Livestreaming Look Like? It is difficult to say, as it is with any speculation about the future. Technologies change and advance beyond the scope of our imaginations virtually every decade. But one thing that is almost a certainty is the continued advancement in our communications infrastructure. Fibre optic lines are being run to smaller towns and cities. Services like Google Fiber, which is now only available at 1 gigabit per second, have shown the current capabilities of our internet infrastructure. As services like this expand we can expect to see a large increase in the number of users seeking streams as the service they expect to interact with will be more stable than it currently is now. Livestreaming, at the moment, is used frequently by gamers and Esports and hasn’t yet seen the mass commercial expansion that is coming. The future of live streaming is on its way. For clues for how it may be in North America we can look to Asia (taobao). Currently, livestreaming is quite popular in the East in terms of a phenomenon that hasn’t quite taken hold on us Westerners, Live Commerce. With retail stores closing left and right, we can’t expect Amazon to pick up all of the slack (as much as I’m sure they would like to). …

https://medium.com/@messivsperuliveon/watch-argentina-vs-peru-live-stream-soccer-f1375bcbb03e

['Argentina Vs Peru Live Tv']

2020-11-18 00:20:34.736000+00:00

['Technology', 'Live Streaming', 'Social Media', 'Sports', 'Argentina']

Title WatcH Argentina v Peru Live Stream SoccerContent WATCH Live Streaming Argentina v Peru Live FIFA World Cup Qualifying — CONMEBOL Full HD Soccer ULTRAᴴᴰ1080p Argentina v Peru 2020 Live Stream Argentina v Peru broadcast free around world Visit get uptotheminute sport news coverage scores…tc Argentina v Peru Watch Live Streaming “ Argentina v Peru CONMEBOL WCQ live stream TV channel watch online news odds start time VISIT httpstinyurlcomy5bwmsj3 MATCH INFO Start date 18 Nov 2020 0630 Location Lima Venue Estadio Nacional Referee Wilmar Roldan Colombia Livestreaming what’s u Technology advanced significantly since first internet livestream still turn video almost everything Let’s take brief look livestreaming held back far tech innovation propel livestreaming forefront internet culture Right livestreaming limited application mass public use rest targeted towards business Livestreaming today home computer early 1980s world livestreaming waiting metaphorical VIC20 popular product make live streaming popular video iteration competition Image post Shared Video remember YouTube wasn’t YouTube know today 2005 Steve Chen Chad Hurley Jawed Karim activated domain “” vision Inspired lack easily accessible video clip online creator YouTube saw world people could instantly access video internet without download file search hour right clip Allegedly inspired site “Hot Not” YouTube originally began dating site think 80 video dating without large ingres dating video opted accept video submission know fateful decision changed life forever YouTube world YouTube born longer exists ability share video scale permitted YouTube brought u closer “global village” I’d wager anyone thought realistically possible technology like Starlink moving closer closer eventuality Although shared video never become legacy technology long truly share stage sibling livestreaming Although livestreaming 20 year old hasn’t gained incredible worldwide adoption YouTube largely due infrastructure issue latency quality cost Latency priority come livestreams Latency time take video captured point viewed point b livestreaming done encoderdecoder function Video audio captured turned code code specifies colour display long bright code sent destination streaming site decoded colour audio displayed device like cell phone delay image captured code generated transmitted decoded played consistently decreasing possible stream content reliably le 3 second latency Subsecond latency also common within next 20 year may witness last cable broadcast perhaps cable relegated niche market CB radio landline transmission average latency associated cable broadcast 6 second mainly due limitation broadcast coming FCC another similar organization interest censorship term reallife however 6 second delay broadcast big deal honesty hours’ delay wouldn’t spell doom mankind certain type broadcast election result sporting event latency must kept minimum maximize viability broadcast Sensitive Content Hard Monitor Advances AI technology like computer vision changed landscape internet broadcasting long algorithm better able prevent sensitive inappropriate content broadcast across internet livestreaming platform Due sheer volume stream much harder monitor contain internet broadcast cable near point ability reliably detect interrupt inappropriate broadcast instantaneously Currently majority content monitored human we’ve learned last 50 year computer machine much reliable consistent human could ever Everything moving automated space content moderation far behind simply don’t human resource monitor every livestream AI won’t need Video Quality last decade seen video quality move 720p 1080p 4K beyond personally remember time 480p standard 720p considered luxury reserved well funded YouTube video time changed people expect video quality least 720p Live streaming always issue meeting demand video quality watching stream platform like Twitch video cut lag drop quality stutter within 45 second course isn’t rampant however sudden drop quality likely thorn side live stream year come Internet Speeds Perhaps common issue one need tackle watching live stream internet speed Drops video quality connection often due quality internet connection streamer viewer Depending location party involved distance server allocated connection speed stream may experience error that’s annoying list recommended connection speed 3 popular streaming application Facebook Live recommends max bit rate 4000 kbps plus max audio bit rate 128 kbps YouTube Live recommends range 1500 4000 kbps video plus 128 kbps audio Twitch recommends range 2500 4000 kbps video plus 160 kbps audio Live stream typically available u good internet Every day people enjoying high quality speed provided fibre optic line line truly penetrate rural le populated area Perhaps day come see upsurge streaming coming area Language Barrier pause rewind video didn’t understand hear something many video sharing platform provide option subtitle don’t really get live stream Pausing rewinding ongoing stream defeat purpose watching stream However day soon approaching able watch stream native language subtitle even streamer speaks something else Microsoft Azure’s Cognitive Speech Services give livestreaming platform edge future allows speech automatically translated language language ability watch livestream real time added benefit accurate subtitle one’s language also assist language learner deciphering spontaneous speech Monetization One damning feature live stream inherent difficulty monetizing mentioned video paused ad inserted video sponsored segment bought creator video read line provided Ads run video etc case spontaneous live stream sponsored content stick case platform like YouTube way around ad Ad blocker skip ad button deplorable premium account fast forwarding sponsored segment work together limit insane amount ad see every day case live stream ad bit difficult Live streaming platform could implement sponsored overlay border similar graphical method advertising inclusion screen shrinking addons like may cause issue smaller device screen size already limited Monthly subscription already norm case live streaming platform Twitch Prime withstanding may difficult consumer see benefit paying service nature unscheduled unpredictable Live stream great quick entertainment go hour time rewatching streamed content inherently time consuming reason many streamer cut recorded stream upload platform like YouTube monetized partnership program likely streaming platform really take would need partner larger company offer service similar Amazon Twitch Might Future Livestreaming Look Like difficult say speculation future Technologies change advance beyond scope imagination virtually every decade one thing almost certainty continued advancement communication infrastructure Fibre optic line run smaller town city Services like Google Fiber available 1 gigabit per second shown current capability internet infrastructure service like expand expect see large increase number user seeking stream service expect interact stable currently Livestreaming moment used frequently gamers Esports hasn’t yet seen mass commercial expansion coming future live streaming way clue may North America look Asia taobao Currently livestreaming quite popular East term phenomenon hasn’t quite taken hold u Westerners Live Commerce retail store closing left right can’t expect Amazon pick slack much I’m sure would like …Tags Technology Live Streaming Social Media Sports Argentina

Argentina, wine country: you stole our hearts

Argentina, wine country: you stole our hearts Salta, Cafayate, Mendoza, Uco Valley We got to Salta on a gloriously sunny day with high expectations for Argentina. Expectations exceeded. Salta is a very European city, in the north of the country. It was pretty great after months of (albeit wonderful) Andean environments. On the first night we went to a ‘pena’ — or a traditional folk party — with some Argentine girls we met at the hostel. It was in a great restaurant called La Casona del Molino and there was singing, dancing, clapping and all round locals having a fantastic time. There was a slight awkward moment when the oldest (but younger than us!) Argentine lady said she wanted the Falklands back. Now, this is a bit uncomfortable, because obviously neither Rachel or Matt really care about the Falklands, but Matt was buggered if he was going to let an Argentine say they belonged to them. But Matt doesn’t really like fighting. So Matt just asked why the woman liked sheep farming, but she said she didn’t like sheep farming, so Matt asked why she wanted the Falkland islands, and she said that wasn’t the point. Luckily the conversation moved on. Matt, happy. The next day we had our first proper steaks. And they were amazing. Matt was in his spiritual home, inasmuch as any religion worships raw cow flesh. We made it until 2am, when the locals were just getting started, but decided not to go clubbing after consuming our body weight in food and wine (Matt was later to spend some time working out if in the last two weeks we have ACTUALLY consumed our body weight in food and wine, Rachel thinks it is a metaphor.) (But Matt takes over here.) So it’s a bottle and a half each a day, and maybe a quarter pound of beef a day. Therefore, at the time of writing it has been 20kg total, which is good, and to be honest, it is starting to show, but it’s not our body weight. Still, two more weeks left! Rachel, happy. We decided to go on a little adventure and headed to the magical little suburb of San Lorenzo. We hadn’t known what to expect, but it wasn’t the little woodland adventure that we ended up having. It was delightful. We met a man running a vineyard business where you can buy your own plot for £35k, if you happen to have the cash. …talking of vineyards, it was time to pack up and head into wine country proper. Rachel loves, loves, loves this guy, she also likes Matt So to Cafayate, also in the north, where they make high-altitude wines. Delicious, delicious, high altitude wines (if at any point the wine descriptions get boring just imagine a shepherd’s crook yanking Matt off the stage and skip ahead). Our first day was spent in a hostel, and we went on a mini tour of wineries in the area, accompanied by a dog friend we met on the way. Matt was taking notes on the wines for Rachel’s next Metro article, so we could, arguably, call this “work.” (We tried about 15 wines, which Rachel thought was a lot, and Matt thought was “a good start.”) This blog could well have been titled “Argentina… or the one in which we enjoy the perks of travel journalism”. For the next two days we stayed at a hotel Rachel is reviewing, and because we want to keep our readers (and friends), the less we say is probably the better (the private hot tub alone would get us into a lot of trouble). But it looked a little like this. (Normally Matt is the only one to look this smug, but Rachel has clearly been taking notes.) “Posh” Rachel on her umpteenth horse ride, Matt on his second (WINE: Nanni Tannat 2017; 7.5/10, rich liquorice notes and — urk [shepherd’s crook]) However, Rachel is happy to report Matt has now been on his second horse. He managed to get the naughty one again, who spent the hour ride trying to nibble everything in sight. Matt eventually got the hang of controlling him, claiming “he knows who the boss is.” Rachel knows who the boss is. Logo design by Matt, who is pictured, as a Rat We also made our own wine, which was very fun, blending different wines and grapes and styles. Rachel more or less just let Matt enjoy himself (a lot), getting all worked up over which percentage of which grape ought to go together (40% Malbec, 40% Cabernet Sauvignon, 20% Tannat). It was undeniably delicious in the end — turns out idiots abroad can actually made a decent bottle of vino. It was time to move on (it wasn’t we went to lots more wineries, but this is essentially boring to read about, needless to say, we drank loads of wines, Matt started to become bloated), and another 24 hours journey (literally 24 hours on a smelly, expensive bus) took us to Mendoza. Mendoza is in central Argentina and is its most famous wine region. Buy a steak and you should buy a Mendoza Malbec. Uco Valley, near Mendoza — just LOOK at it Continuing our flashpacking run, we had a lovely couple of days in the south of Mendoza staying at a family-run hotel called Finca Adalgisa. We used their bikes to explore the area, visiting various wineries (Matt: “I’m getting nose fatigue”. Which is a thing, sometimes there’s only so many wines you can try. If any ex-Laithwaites people read this they will be able to back me up — Rachel: Matt was now rapidly developing gout, so its best he slowed down.) We even had a bath in wine, but you can read all about that in Rachel’s upcoming article (we didn’t take pictures, you’ll be pleased to hear.) Then, to the Uco Valley, 70 miles south of Mendoza, to get there we rented a motorbike. Our steed, 1000cc, should have killed us Matt, happy. Matt having not driven a manual in many years (since a memorable occasion in the woods when he was 15 on a bike Tony (remember him mum?) probably stole), there were several false starts. We got a nervous message from the owner saying “everything ok?” when we got there, to which he responded with no less than 10 clapping emojis. So we made it, and it was bloody gorgeous. RESPETO MI BANDERA So to more vineyard tours and tastings, at the point where Matt decided we probably had consumed our combined body weight in food and wine (we hadn’t, as discussed….yet). We had an interesting lunch at a restaurant/bodega(winery) called La Azul, where our host was wearing their official t-shirt… which said… RESPECT MY FLAG overlaid on the Falkland islands. This is Matt, not arguing about the Falklands Matt doesn’t want to get into this, because Rachel won’t let him, but he will. But Argentine hasn’t got, and never has had, any claim to the Falkland islands and it is super weird how much they care about these essentially worthless islands. They really care, and it would be adorably weird had loads of people not died for it. If you really hate yourself you can read this wikipedia page but the bottom line is the inhabitants don’t want to be Argentine and that’s that. However, Matt hasn’t got into a proper row about it yet, because he’s scared of getting beaten up. He has been a bit sarcastic, so chalk that up for improving Argentine-British relations. Anyway, Rachel is back — our fancy double life was over, we’d had six nights of utter luxury, and it was time to head back to a hostel in Mendoza (and a 6 bed dorm) where we are going to spend Christmas. So, taking off our fancy-pants, we will leave this here.

https://medium.com/the-ratt-race/argentina-wine-country-you-stole-our-hearts-8cef68bb9bca

['Rachel Anderson']

2017-12-23 22:34:30.471000+00:00

['Wine', 'Argentina']

Title Argentina wine country stole heartsContent Argentina wine country stole heart Salta Cafayate Mendoza Uco Valley got Salta gloriously sunny day high expectation Argentina Expectations exceeded Salta European city north country pretty great month albeit wonderful Andean environment first night went ‘pena’ — traditional folk party — Argentine girl met hostel great restaurant called La Casona del Molino singing dancing clapping round local fantastic time slight awkward moment oldest younger u Argentine lady said wanted Falklands back bit uncomfortable obviously neither Rachel Matt really care Falklands Matt buggered going let Argentine say belonged Matt doesn’t really like fighting Matt asked woman liked sheep farming said didn’t like sheep farming Matt asked wanted Falkland island said wasn’t point Luckily conversation moved Matt happy next day first proper steak amazing Matt spiritual home inasmuch religion worship raw cow flesh made 2am local getting started decided go clubbing consuming body weight food wine Matt later spend time working last two week ACTUALLY consumed body weight food wine Rachel think metaphor Matt take it’s bottle half day maybe quarter pound beef day Therefore time writing 20kg total good honest starting show it’s body weight Still two week left Rachel happy decided go little adventure headed magical little suburb San Lorenzo hadn’t known expect wasn’t little woodland adventure ended delightful met man running vineyard business buy plot £35k happen cash …talking vineyard time pack head wine country proper Rachel love love love guy also like Matt Cafayate also north make highaltitude wine Delicious delicious high altitude wine point wine description get boring imagine shepherd’s crook yanking Matt stage skip ahead first day spent hostel went mini tour winery area accompanied dog friend met way Matt taking note wine Rachel’s next Metro article could arguably call “work” tried 15 wine Rachel thought lot Matt thought “a good start” blog could well titled “Argentina… one enjoy perk travel journalism” next two day stayed hotel Rachel reviewing want keep reader friend le say probably better private hot tub alone would get u lot trouble looked little like Normally Matt one look smug Rachel clearly taking note “Posh” Rachel umpteenth horse ride Matt second WINE Nanni Tannat 2017 7510 rich liquorice note — urk shepherd’s crook However Rachel happy report Matt second horse managed get naughty one spent hour ride trying nibble everything sight Matt eventually got hang controlling claiming “he know bos is” Rachel know bos Logo design Matt pictured Rat also made wine fun blending different wine grape style Rachel le let Matt enjoy lot getting worked percentage grape ought go together 40 Malbec 40 Cabernet Sauvignon 20 Tannat undeniably delicious end — turn idiot abroad actually made decent bottle vino time move wasn’t went lot winery essentially boring read needle say drank load wine Matt started become bloated another 24 hour journey literally 24 hour smelly expensive bus took u Mendoza Mendoza central Argentina famous wine region Buy steak buy Mendoza Malbec Uco Valley near Mendoza — LOOK Continuing flashpacking run lovely couple day south Mendoza staying familyrun hotel called Finca Adalgisa used bike explore area visiting various winery Matt “I’m getting nose fatigue” thing sometimes there’s many wine try exLaithwaites people read able back — Rachel Matt rapidly developing gout best slowed even bath wine read Rachel’s upcoming article didn’t take picture you’ll pleased hear Uco Valley 70 mile south Mendoza get rented motorbike steed 1000cc killed u Matt happy Matt driven manual many year since memorable occasion wood 15 bike Tony remember mum probably stole several false start got nervous message owner saying “everything ok” got responded le 10 clapping emojis made bloody gorgeous RESPETO MI BANDERA vineyard tour tasting point Matt decided probably consumed combined body weight food wine hadn’t discussed…yet interesting lunch restaurantbodegawinery called La Azul host wearing official tshirt… said… RESPECT FLAG overlaid Falkland island Matt arguing Falklands Matt doesn’t want get Rachel won’t let Argentine hasn’t got never claim Falkland island super weird much care essentially worthless island really care would adorably weird load people died really hate read wikipedia page bottom line inhabitant don’t want Argentine that’s However Matt hasn’t got proper row yet he’s scared getting beaten bit sarcastic chalk improving ArgentineBritish relation Anyway Rachel back — fancy double life we’d six night utter luxury time head back hostel Mendoza 6 bed dorm going spend Christmas taking fancypants leave hereTags Wine Argentina

Prospective Swansea coach Marcelo Bielsa excited to not have methods understood in whole new league

Prospective Swansea coach Marcelo Bielsa excited to not have methods understood in whole new league TBN Sport Dec 15, 2015·1 min read As speculation heats up after the sacking of Garry Monk, prospective Swansea City coach Marcelo Bielsa has expressed excitement at not having his methods fully understood in a whole new league. The odds on the Argentinian taking over at the Liberty City stadium were slashed on Monday after it was revealed that chairman Huw Jenkins had flown out to meet him. Speaking to media today, he revealed his giddiness at having his meticulous methods misunderstood and interpreted in a different footballing landscape. “It’s very exciting. I’ve coached in a lot of places but the Premier League is different. If I’m honest, I’ve always dreamed of having all of my methods questioned by staff and media in England,” said the former Athletic Bilbao coach, adding that he relished the challenge of having a completely different style of footballer revolt against his tactics and methodology roughly six months into his proposed reign. “Football is a universal language that everyone understands. I have no doubt that if I take this job, my players will quickly learn to adapt to and then disregard my ideas fully.” Share and follow TBN on Twitter.

https://medium.com/@TBNSport/prospective-swansea-coach-marcelo-bielsa-excited-to-not-have-methods-understood-in-whole-new-league-992aacb0b4a3

['Tbn Sport']

2017-11-16 12:22:59.393000+00:00

['Football', 'La Liga', 'England', 'Argentina']

Title Prospective Swansea coach Marcelo Bielsa excited method understood whole new leagueContent Prospective Swansea coach Marcelo Bielsa excited method understood whole new league TBN Sport Dec 15 2015·1 min read speculation heat sacking Garry Monk prospective Swansea City coach Marcelo Bielsa expressed excitement method fully understood whole new league odds Argentinian taking Liberty City stadium slashed Monday revealed chairman Huw Jenkins flown meet Speaking medium today revealed giddiness meticulous method misunderstood interpreted different footballing landscape “It’s exciting I’ve coached lot place Premier League different I’m honest I’ve always dreamed method questioned staff medium England” said former Athletic Bilbao coach adding relished challenge completely different style footballer revolt tactic methodology roughly six month proposed reign “Football universal language everyone understands doubt take job player quickly learn adapt disregard idea fully” Share follow TBN TwitterTags Football La Liga England Argentina

Across Patagonia

The cover of Lady Flo’s book: Thankfully, I kept crossing rivers on horseback to a minimum. I spent the month of January in Buenos Aires, Argentina. Ostensibly to complete a short-term exchange and get some study credit during the holidays, but mostly just to go on an extended holiday to an exotic new continent. I think little nail-pulling is needed to reveal something similar as the honest collective motive of most Uni students who undertake various study trips or exchanges. I stocked up on 36mm film — rationalising that I’d be more likely to treasure a few rolls of 24 exposures than the infinite contents of my iPhone camera roll — and ramped up the Spanish on DuoLingo. My travel reading of choice was Lady Florence Dixie’s 1880 memoir, Across Patagonia. Somewhat obscure, I’d ordered it online a few weeks in advance of my departure date. I’m glad I chose such an old book. I’m also glad it didn’t have a plot, because I wasn’t anxious about ‘feeling something’ super strong by the end of it. The pressure of falling in love with a bestseller (the way in which everybody else has done so, thus making it a bestseller) can be suffocating. Instead, this memoir was more like a personalised time capsule of research rather than narrative. Since I didn’t get to go to Patagonia (OS-HELP will take you far, but not that far), I liked reading about it. For context, Dixie wrote Across Patagonia ‘for’ the future King Edward VII. Not many people had been to South America yet, which meant her recounts were decently useful information. That also meant she included some pretty painful (i.e. racist) descriptions of the indigenous people. But what I couldn’t help noticing was that it meant she showed off a lot when describing various events along the road. If something is beautiful, its stunning. If the horses wander from the camp, they stray miles away. If they shoot a guanaco for dinner, its only after a long and dramatic chase. Even if her stories are true and I’m not just pathetically cynical, even if she’s not over-exaggerating the prairie fire or whatever it may be, she still gets to pick and choose the stories she includes. And that’s where I found the most similarity between my own trip and Dixie’s, more so than being in the same country or eating the same food. Those finite film photos I painstakingly develop, only to upload them straight to Instagram, represent a calculated, glorified, and filtered version of my trip. The steak is only ever ridiculously delicious (never mind the below-average one from the first night), and the streets are only ever perfectly quaint (never mind parts of the city that just… well, look like Brisbane). When something is bad, it’s disastrous (thank you to the night-long blackout and freaky classmates for that content). Both Dixie and I are taking the opportunity to filter our travels before we share it with people whose opinions we care about. And perhaps that blunts the significance of what we do share. I’m not trying to depress, or polarise, or cry woe-is-us, the social media generation. If anything it shows that after all these years we still do the same old shit when telling stories. Nobody’s lives are consistently interesting, but we continue to chase the moments when they are. And that’s not just tolerable, it’s good. It allows us to grasp for relation with this woman who decided to head off to the new world two-months post-partum, returning with a jaguar and some corrections for Charles Darwin regarding observations from his own trip to the region. My own exploits in South America may have not have been quite as dramatic, but it didn’t stop me from trying to get a good story and photo out of it.

https://medium.com/statecraft/across-patagonia-1880725a57d2

['Greer Clarke']

2019-10-17 23:54:27.344000+00:00

['Travel', 'Patagonia', 'Argentina', 'Instagram']

Title Across PatagoniaContent cover Lady Flo’s book Thankfully kept crossing river horseback minimum spent month January Buenos Aires Argentina Ostensibly complete shortterm exchange get study credit holiday mostly go extended holiday exotic new continent think little nailpulling needed reveal something similar honest collective motive Uni student undertake various study trip exchange stocked 36mm film — rationalising I’d likely treasure roll 24 exposure infinite content iPhone camera roll — ramped Spanish DuoLingo travel reading choice Lady Florence Dixie’s 1880 memoir Across Patagonia Somewhat obscure I’d ordered online week advance departure date I’m glad chose old book I’m also glad didn’t plot wasn’t anxious ‘feeling something’ super strong end pressure falling love bestseller way everybody else done thus making bestseller suffocating Instead memoir like personalised time capsule research rather narrative Since didn’t get go Patagonia OSHELP take far far liked reading context Dixie wrote Across Patagonia ‘for’ future King Edward VII many people South America yet meant recount decently useful information also meant included pretty painful ie racist description indigenous people couldn’t help noticing meant showed lot describing various event along road something beautiful stunning horse wander camp stray mile away shoot guanaco dinner long dramatic chase Even story true I’m pathetically cynical even she’s overexaggerating prairie fire whatever may still get pick choose story includes that’s found similarity trip Dixie’s country eating food finite film photo painstakingly develop upload straight Instagram represent calculated glorified filtered version trip steak ever ridiculously delicious never mind belowaverage one first night street ever perfectly quaint never mind part city just… well look like Brisbane something bad it’s disastrous thank nightlong blackout freaky classmate content Dixie taking opportunity filter travel share people whose opinion care perhaps blunts significance share I’m trying depress polarise cry woeisus social medium generation anything show year still old shit telling story Nobody’s life consistently interesting continue chase moment that’s tolerable it’s good allows u grasp relation woman decided head new world twomonths postpartum returning jaguar correction Charles Darwin regarding observation trip region exploit South America may quite dramatic didn’t stop trying get good story photo itTags Travel Patagonia Argentina Instagram

Mercado San Telmo -Buenos Aires. The Mercado San Telmo is a large under…

The Mercado San Telmo is a large under roof market that is located in San Telmo neighborhood of the city of Buenos Aires. The whole neighborhood is packed with great places to eat, fantastic art and design shops, vintage and local designer clothes, and just wandering and looking around is a pleasure with its colorful and vivid streets. The market especially is home to some very delicious food, and even though it conserves old shops and sellers of vegetables and meats, at present it is more like a tourist place and the antique dealers are disappearing. Inside, some part of it still functions as a real market, and the stores are still selling fish, meat, seasonal vegetables and fruits. But anyhow, this place recently has transformed into a gastronomic hub and definitely more popular for the live kitchen bars, parrillas, bakeries and empanada sellers. I think I ate the best empanada of my life here, with spicy paprika salsa 😋 at the corner bar, called . Not to mention the lovely cafés with mouthwatering Alfajores selections. Right next to El Hornero, you can find the lovely Chantal Café… we simply couldn’t resist. The building has an entrance on each side from the surrounding streets, and some of the stores are also having doors from the streets too, including the liquor stores, restaurants and some notable bars: “ San Pedro Telmo”, “ Bar Merci” and “ La Coruña “. On the upper level of the market you can find mainly souvenir shops, postcards and magnet sellers and vintage art sellers. Plus my favorite store of all: Dulce de Leche & Co. We were already after our Uruguayan week, with having the opportunity to eat Dulce de Leche almost for every breakfast in whichever cake variant, alfajores, and so on. Plus, in Hungary we also have a very similar thing, so called tejkaramella available and it’s very popular among kids, so the taste was not that surprisingly new for me. Still, even though it was extremely sweet for my taste, it was reminding me of my childhood, sweet memories. And when I saw this store, besides it looked super cute from the outside, I decided to take a look inside. I didn’t want to buy anything, I swear, 😉 but I ended up buying different kind of spreads, chocolates, dulce de leche cubes, alfajores, whatever souvenirs out of dulce de leche for everyone. 😁 The only limitations I had to keep in mind was the size of my backpack, that was already very well packed. Net-net, the store is super cute, with a wide variety of different types of dulce de leche and the store manager was just so kind, nice and friendly and let us taste almost all desired variants. Highly recommended! 😋

https://medium.com/@besides_the_obvious/mercado-san-telmo-buenos-aires-aac1ec1b1c5b

['Besides The Obvious']

2020-04-01 07:23:55.490000+00:00

['Buenos Aires', 'Argentina', 'Travel']

Title Mercado San Telmo Buenos Aires Mercado San Telmo large under…Content Mercado San Telmo large roof market located San Telmo neighborhood city Buenos Aires whole neighborhood packed great place eat fantastic art design shop vintage local designer clothes wandering looking around pleasure colorful vivid street market especially home delicious food even though conserve old shop seller vegetable meat present like tourist place antique dealer disappearing Inside part still function real market store still selling fish meat seasonal vegetable fruit anyhow place recently transformed gastronomic hub definitely popular live kitchen bar parrillas bakery empanada seller think ate best empanada life spicy paprika salsa 😋 corner bar called mention lovely cafés mouthwatering Alfajores selection Right next El Hornero find lovely Chantal Café… simply couldn’t resist building entrance side surrounding street store also door street including liquor store restaurant notable bar “ San Pedro Telmo” “ Bar Merci” “ La Coruña “ upper level market find mainly souvenir shop postcard magnet seller vintage art seller Plus favorite store Dulce de Leche Co already Uruguayan week opportunity eat Dulce de Leche almost every breakfast whichever cake variant alfajores Plus Hungary also similar thing called tejkaramella available it’s popular among kid taste surprisingly new Still even though extremely sweet taste reminding childhood sweet memory saw store besides looked super cute outside decided take look inside didn’t want buy anything swear 😉 ended buying different kind spread chocolate dulce de leche cube alfajores whatever souvenir dulce de leche everyone 😁 limitation keep mind size backpack already well packed Netnet store super cute wide variety different type dulce de leche store manager kind nice friendly let u taste almost desired variant Highly recommended 😋Tags Buenos Aires Argentina Travel

Argentina travel guide covering Buenos Aires, Mendoza and Iguazú

Argentina travel guide covering Buenos Aires, Mendoza and Iguazú The basics Walk everywhere. Taxis are fairly well-regulated which means that if you’re coming from the UK, they’re also super-cheap. They’re definitely the most convenient airport transfer though make sure you book from inside the airport. The ‘Subte’ or Metro/Subway/Underground is cheaper but it’s coverage is quite limited in Buenos Aires. We barely used it. Buses are even cheaper if you can make sense of them. We tried once and failed. Take all the cash you’ll spend with you because Argentina loves cash but ATMs cost as much as £10 for each withdrawal. We took all our money in USD which you can spend in the more touristy places. You can also get away with Euros or GBP but you can only change these into Argentine (not Argentinian!!) pesos (ARS$) at Banco Nacional at the airport. They don’t accept money with any markings on it e.g. written on in ink. There’ll be a queue but it’s worth waiting. You can also use the street “cambios” but convenience aside, there’s no real reason to do this. When we did, they gave us a worse rate than the bank and you have no safeguards against things like fake currency which seems to be quite a big problem. Starling or Monzo give good rates on card payments if you don’t want to use cash. Cards are accepted in many places but you can’t rely on that. Mobile roaming doesn’t seem to be a thing. I’m on Three which you can use your UK plan on pretty much the entire planet but not in Argentina. Pretty much every bar/restaurant has wi fi though. If you don’t speak Spanish, get on Duo Lingo pronto. The basics will take you a very long way! In restaurants and bars, always tip exactly 10%. In taxis, round up to the nearest ARS$100. Carry your passport everywhere. I got asked for it daily e.g. when paying via card Buenos Aires Suburbs We explored quite a lot of the central bit of Buenos Aires but we stayed away from the outskirts because they look super-ropey. The bits I’ll talk about were lovely though. Belgrano Quite a way from the centre but worth a visit. It’s home to the bizarre but brilliant ‘Holy Land’, and also, to China town which is mostly supermarkets and shops but it also has a couple of nice spots we went to with some BA locals: Puerta Uno — very nice ‘speakeasy’ with reasonably-priced drinks and semi-outdoor space Parrilla EL Pobre Luis — Uruguayian Parrilla (Argentine word for ‘grill’) which does a mean asado (Argentine word for ‘barbecue’). Not super-cheap but very good 👍 Palermo and Palermo Hollywood Very nice, ‘hipster’ neighbourhood which is closer to the center than Belgrano. If you haven’t already booked accommodation, this wouldn’t be a bad shout. It’s nice during the day but it really comes alive at night, especially on weekends. Plenty of great restaurants and bars on Gurruchugha, between Plaza Italia and Plazoletto Julio Cortázar — the former Plaza has easy access to the zoo (closed on Mondays), Gallileo Galilei observatory (ugly but worth a look) and Japanese gardens; the latter has lots of markets and terrace bars (good for drinks but I wouldn't recommend it for food). Palermo is also home to what’s arguably Buenos Aires’ most famous restaurant, Dom Julio’s. It’s an experience but it’s very expensive/overpriced (£100 for dinner + drinks) and we had to wait for 2 hours to get a table. You can reserve online in advance but on the day walk-ins have to reserve in person. You can put your name down and find a bar around the corner though if you don’t fancy waiting outside and drinking the complimentary glasses of fizz for those in the queue. Other good places include: Clara — craft beer (or birra artesanal bar — oddly, they use the Italian ‘birra’ rather than the more spanish ‘cerveza’) — and it’s a very nice bar which also does a bit of food. I recommend the pork burger. Temple — very similar to Clara but they have outdoor heaters if you go there in the evening and it’s cold outside Sans — lovely little restaurant which local families use as a bit of a Sunday spot. La Panera Rosa — breakfast/brunch place. It’s a chain but it’s great 💯 The walk from Plaza Italia to Retiro is a long one (about 3 miles) but it’s a nice one. Recoletta & Retiro Like London’s Mayfair with embassies, galleries, fashion boutiques like Luis Vuitton, posh hotels and townhouses. Not many young people. This is where you’ll find Recoletta cemetery which is a bit of a must-see as one of the few bona fide tourist attractions in BA. It’s worth at least a 30-minute walk around. It also has a ‘Freddo’ nearby which is a famous chain of Gelattaria’s in BA. Plaza General St Martin is impressive and it’s also where the Retiro subway station is. Don’t go behind the station though. It’s home to BA’s slums (like the favelas of Rio de Janeiro) so it’s not safe. Other stuff to see in this area include: The Avenida 9 de Julio super-wide street which is famous for being… wide. And it’s also the street with the impressive — but ugly — obelisco. The beautiful teatro Colon and Plaza Lavalle (pronouced la-va-zhey — look up ‘yeismo’) Casa Rosada which is the president’s official residence and is on Plaza de Mayo (pronouced ma-zho — look up ‘yeismo’). The Plaza de Mayo is famous for being the venue of a lot of protests. Argentinians love a protest. It’d be a surprise if you spent a week there but managed not to see one For food and drink: The Four Seasons hotel is probably my top recommendation for food in BA. Feels very European so don’t go there if you’re looking for the local experience. I had my best steak of the whole trip at their Elena restaurant. Terrazas is a shopping mall which sounds dull but it has a few outdoor bars. Great for evening drinks if the weather is nice but have your food elsewhere. Food options aren’t great. Posadas has quite a few nice restaurants/bars including Sorrento Recova which has a nice little outdoor space Puerto Madero Newest part of BA with a lot of “after-work” bars and restaurants around the marina. It’s also BA’s central business district with quite a few tall buildings housing the likes of HSBC. It’s a bit like BA’s Canary Wharf. Take some time to walk around the ecological reserve built on reclaimed land. It’ll take about 3–4 hours to walk around. If you’re a birdwatcher, bring your telephoto lens! Otherwise, there are also many nice spots for an outdoor picnic. The Avenida Hernan M. Giralt runs alongside it and is also worth a look. It has a parade of statues featuring Argentina’s most famous sports stars (look out for Messi). Montserrat and La Boca The heart of BA where a lot of people work. Things get a bit ropey as you go further south ‘downtown’ but it’s worth doing if you want to see the Plaza del Congresso (another protest hot spot), the oudoor amphitheatre and the Museu d’art contemporani de Buenos Aires — museum of modern arts. You can also walk all the way past Plaza Constitucion to La Bombonera and El Caminito in La Boca. La Bombonera is where the Boca Juniors play their home games. Their fans are nuts and the stadium itself is quite something to behold. It’s pretty much impossible to get tickets for a home game but if you can, it’s supposed to be incredible. Don’t buy them off touts though; you’re almost certain to be scammed. El Caminito is the super-colourful street pretty much built for tourists. Tonnes of markets for souvenirs and also, lots of lovely restaurants which typically do tango shows as you eat. We went to La Barrica. If you don’t fancy walking all the way back, get a taxi to Constitucion and jump on the Subte. Outside Buenos Aires Uruguay Buequebus runs high-speed catamaran ferries to the historic Colonia del Sacramento in Uruguay which makes it ideal for a day trip. It costs about £50 and takes about an hour. You can either leave at 8am or 12pm, returning at 4pm or 9pm — the later one lets you watch the sunset from one of the seafront restaurants (though technically, it’s an estuary rather than the ocean). Don’t bother with Montevideo the Uruguayian capital; you can also get there from BA but it’s about 3x the price and involves over 6 hours of ferries in one day. Tigre If you don’t mind a train journey, Tigre is worth a visit. It’s small little town with a lot of waterways because it’s built around the river delta. Everyone gets around on water taxis which are probably a better way of getting to know the place than the official tours. For food, Gato Blanco restaurant is basic but good. Mendoza Probably the most enjoyable part of my trip was visiting Mendoza. We flew from the Aeroparque (different airport to the one where we arrived — Ezeiza). Tours are relatively expensive so we only stayed here for about 3 days because there isn’t a huge amount else to do/see. It’s more a city where people live than visit I think. We booked all of our tours through a travel agent in the Sheraton hotel and we found out from someone who joined us that it was half the price of buying online. If you haven’t booked your accom, this in itself is a good reason to stay in a hotel rather than an Airbnb. Tours run everday but weekends have the most options. We did the bike vineyard tour which was awesome and a day trip to The Andes which was a bit of a long day but worthwhile. It gets cold so pack more than shorts & flip flops. Avenida Aristides Villanova is pretty much the only you want to go to for food/drink. Super-busy at the weekend; a tonne of options though my absolute favourite was La Lucia which has a nice outside seating area. Not the cheapest but incredible food. There’s another La Lucia on Plaza Independencia. The square itself is impressive and it’s worth a look as the defacto centre of town. Other recommendations from a local were Chachinga and Beerlin. Iguazú Most people only visit Iguazú for one or two days. It’s super-touristy and there’s nothing much there beyond the waterfalls but my god, they’re breathtaking. The Argentine side does take about 6–8 hours to see so get there early. The Brazillian side takes 2–4 hours and you don’t need a visa. Another reason to get there early when you go and see the Argentine side is so you can get tickets for the boat tour. It’s about US$100 (on top of the US$35 it costs just to get into the park) but definitely worthwhile. If you have a poncho and a dry bag, take them. The boat literally goes underneath a waterfall and you will get drenched. Take a packed lunch if you can be bothered — food options aren’t great — but we survived on Empanadas. Beware the quati though. Not only are they known to bite/scratch but they will also happily nab your food if you don’t keep a close eye on it. There’s a regular shuttle bus from the centre of town to the falls (cataratas) and there’s also a regular shuttle bus from the airport to any hotel. They cost about ARS$250 but we just got taxis everywhere because there were two of us and taxis are ARS$600–700 to pretty much everywhere. I’ve heard Salta, Rosario, Cordoba and Patagonia are also worth a look but couldn’t cram them into our 2 week visit but that’s my guide to Argentina. Enjoy your trip! This map has the places I’ve mentioned and also look at this blog by my pal Helen.

https://medium.com/@simbasagwete/argentina-travel-guide-buenos-aires-mendoza-and-iguaz%C3%BA-9ff09687010d

['Simba Sagwete']

2019-10-27 16:30:49.295000+00:00

['Travel', 'Buenos Aires', 'Argentina']

Title Argentina travel guide covering Buenos Aires Mendoza IguazúContent Argentina travel guide covering Buenos Aires Mendoza Iguazú basic Walk everywhere Taxis fairly wellregulated mean you’re coming UK they’re also supercheap They’re definitely convenient airport transfer though make sure book inside airport ‘Subte’ MetroSubwayUnderground cheaper it’s coverage quite limited Buenos Aires barely used Buses even cheaper make sense tried failed Take cash you’ll spend Argentina love cash ATMs cost much £10 withdrawal took money USD spend touristy place also get away Euros GBP change Argentine Argentinian peso ARS Banco Nacional airport don’t accept money marking eg written ink There’ll queue it’s worth waiting also use street “cambios” convenience aside there’s real reason gave u worse rate bank safeguard thing like fake currency seems quite big problem Starling Monzo give good rate card payment don’t want use cash Cards accepted many place can’t rely Mobile roaming doesn’t seem thing I’m Three use UK plan pretty much entire planet Argentina Pretty much every barrestaurant wi fi though don’t speak Spanish get Duo Lingo pronto basic take long way restaurant bar always tip exactly 10 taxi round nearest ARS100 Carry passport everywhere got asked daily eg paying via card Buenos Aires Suburbs explored quite lot central bit Buenos Aires stayed away outskirt look superropey bit I’ll talk lovely though Belgrano Quite way centre worth visit It’s home bizarre brilliant ‘Holy Land’ also China town mostly supermarket shop also couple nice spot went BA local Puerta Uno — nice ‘speakeasy’ reasonablypriced drink semioutdoor space Parrilla EL Pobre Luis — Uruguayian Parrilla Argentine word ‘grill’ mean asado Argentine word ‘barbecue’ supercheap good 👍 Palermo Palermo Hollywood nice ‘hipster’ neighbourhood closer center Belgrano haven’t already booked accommodation wouldn’t bad shout It’s nice day really come alive night especially weekend Plenty great restaurant bar Gurruchugha Plaza Italia Plazoletto Julio Cortázar — former Plaza easy access zoo closed Mondays Gallileo Galilei observatory ugly worth look Japanese garden latter lot market terrace bar good drink wouldnt recommend food Palermo also home what’s arguably Buenos Aires’ famous restaurant Dom Julio’s It’s experience it’s expensiveoverpriced £100 dinner drink wait 2 hour get table reserve online advance day walkins reserve person put name find bar around corner though don’t fancy waiting outside drinking complimentary glass fizz queue good place include Clara — craft beer birra artesanal bar — oddly use Italian ‘birra’ rather spanish ‘cerveza’ — it’s nice bar also bit food recommend pork burger Temple — similar Clara outdoor heater go evening it’s cold outside Sans — lovely little restaurant local family use bit Sunday spot La Panera Rosa — breakfastbrunch place It’s chain it’s great 💯 walk Plaza Italia Retiro long one 3 mile it’s nice one Recoletta Retiro Like London’s Mayfair embassy gallery fashion boutique like Luis Vuitton posh hotel townhouses many young people you’ll find Recoletta cemetery bit mustsee one bona fide tourist attraction BA It’s worth least 30minute walk around also ‘Freddo’ nearby famous chain Gelattaria’s BA Plaza General St Martin impressive it’s also Retiro subway station Don’t go behind station though It’s home BA’s slum like favelas Rio de Janeiro it’s safe stuff see area include Avenida 9 de Julio superwide street famous being… wide it’s also street impressive — ugly — obelisco beautiful teatro Colon Plaza Lavalle pronouced lavazhey — look ‘yeismo’ Casa Rosada president’s official residence Plaza de Mayo pronouced mazho — look ‘yeismo’ Plaza de Mayo famous venue lot protest Argentinians love protest It’d surprise spent week managed see one food drink Four Seasons hotel probably top recommendation food BA Feels European don’t go you’re looking local experience best steak whole trip Elena restaurant Terrazas shopping mall sound dull outdoor bar Great evening drink weather nice food elsewhere Food option aren’t great Posadas quite nice restaurantsbars including Sorrento Recova nice little outdoor space Puerto Madero Newest part BA lot “afterwork” bar restaurant around marina It’s also BA’s central business district quite tall building housing like HSBC It’s bit like BA’s Canary Wharf Take time walk around ecological reserve built reclaimed land It’ll take 3–4 hour walk around you’re birdwatcher bring telephoto lens Otherwise also many nice spot outdoor picnic Avenida Hernan Giralt run alongside also worth look parade statue featuring Argentina’s famous sport star look Messi Montserrat La Boca heart BA lot people work Things get bit ropey go south ‘downtown’ it’s worth want see Plaza del Congresso another protest hot spot oudoor amphitheatre Museu d’art contemporani de Buenos Aires — museum modern art also walk way past Plaza Constitucion La Bombonera El Caminito La Boca La Bombonera Boca Juniors play home game fan nut stadium quite something behold It’s pretty much impossible get ticket home game it’s supposed incredible Don’t buy tout though you’re almost certain scammed El Caminito supercolourful street pretty much built tourist Tonnes market souvenir also lot lovely restaurant typically tango show eat went La Barrica don’t fancy walking way back get taxi Constitucion jump Subte Outside Buenos Aires Uruguay Buequebus run highspeed catamaran ferry historic Colonia del Sacramento Uruguay make ideal day trip cost £50 take hour either leave 8am 12pm returning 4pm 9pm — later one let watch sunset one seafront restaurant though technically it’s estuary rather ocean Don’t bother Montevideo Uruguayian capital also get BA it’s 3x price involves 6 hour ferry one day Tigre don’t mind train journey Tigre worth visit It’s small little town lot waterway it’s built around river delta Everyone get around water taxi probably better way getting know place official tour food Gato Blanco restaurant basic good Mendoza Probably enjoyable part trip visiting Mendoza flew Aeroparque different airport one arrived — Ezeiza Tours relatively expensive stayed 3 day isn’t huge amount else dosee It’s city people live visit think booked tour travel agent Sheraton hotel found someone joined u half price buying online haven’t booked accom good reason stay hotel rather Airbnb Tours run everday weekend option bike vineyard tour awesome day trip Andes bit long day worthwhile get cold pack short flip flop Avenida Aristides Villanova pretty much want go fooddrink Superbusy weekend tonne option though absolute favourite La Lucia nice outside seating area cheapest incredible food There’s another La Lucia Plaza Independencia square impressive it’s worth look defacto centre town recommendation local Chachinga Beerlin Iguazú people visit Iguazú one two day It’s supertouristy there’s nothing much beyond waterfall god they’re breathtaking Argentine side take 6–8 hour see get early Brazillian side take 2–4 hour don’t need visa Another reason get early go see Argentine side get ticket boat tour It’s US100 top US35 cost get park definitely worthwhile poncho dry bag take boat literally go underneath waterfall get drenched Take packed lunch bothered — food option aren’t great — survived Empanadas Beware quati though known bitescratch also happily nab food don’t keep close eye There’s regular shuttle bus centre town fall cataratas there’s also regular shuttle bus airport hotel cost ARS250 got taxi everywhere two u taxi ARS600–700 pretty much everywhere I’ve heard Salta Rosario Cordoba Patagonia also worth look couldn’t cram 2 week visit that’s guide Argentina Enjoy trip map place I’ve mentioned also look blog pal HelenTags Travel Buenos Aires Argentina

Coming Into Paris One Early Morning

Early in the morning and fifty or so kilometers from Paris, the green fields roll gently in the early morning mist. The sun rises slowly to the east. It’s as if I’m watching a French film, its deliberate meditative pace, through the lozenge window of my tiny black Renault Twingo. In the middle of the green fields, stucco and tile farmhouses interrupt the eye, draw it in and make you wonder about the length of time these places have been here. You feel the age of the land, its harmony. Then the outskirts of Paris ease in — first a neighborhood of mid sized buildings, then corporations that dot the suburbs, big buildings. Until suddenly there it is, the sign “Paris-Centre”. The traffic slows and narrows, though still in 6 lanes. A tunnel — and Paris rises beyond it, the Siene running along the highway urging you on. It was a long way to get here — literally and metaphorically. The day and night before I crossed southern Sweden, a half of Denmark, and a major part of Germany — Hambourg, Hannover, Douseldorf to, finally, Luxemberg where I saw my first grape vines and I smiled because I knew France was near. I began the day by leaving Lund at 7AM and got to about 100kilometers of Paris by midnight or so. The key to my apartment was being held in a café (very French) and I tried frantically to call on my cell but I was doing something wrong and couldn’t get through. I knew they’d be closed by the time I entered France — besides, I didn’t want to tackle streets and things in the dark without the guarantee of a bed to lay my head. So I did what I would have done 30 or years ago — I’m glad I recalled — I slept in a truck stop in my car. I slept through the night and awakened a bit stiff at 5AM, washed up, drank a double espresso and began the journey into Paris. I don’t know, maybe I’m overly romantic, but when I saw “Paris-Centre,” I got emotional. Perhaps it was simply that I was working really hard to erase all images I have of Paris, all of which come from literature and film, and of course, my family, mostly my mother. The emotions escalated when I realized that the entry to Paris, the way I came in, is almost identical to the entrance to Buenos Aires. Even the first signs of the city immediately catapulted me to Buenos Aires. I was in two places at once — a very Borgesian experience; or to put it in the tradition of contemporary French philosophy: since I’m here, I was always who I am, always being the other I find now. I have always been here, though I was seeing it for the very first time. I was seeing myself in this light for the first time. This implies that psychologically I had been ready for this experience and that all my experiences leading to this moment had prepared me for my first visit to Paris. I was always already in Paris. I hugged the Seine and drove ever so slowly. The pay off for sleeping in the car was coming into a city yet to awaken — this awakened me. I drove carefully, deliberately, my eyes on the classic beauty, the barges, the old buildings, the narrow streets — and the street signs and my map. That’s how I did it. I’d go so far, stop and look at my map; memorize routes and street names, calculating how much time I’d travel to get to my next stop. Then do this again. Within ten minutes of being in the city, I found the Restaurant Retirement, which held my keys. Unbelievably, they were cleaning and I had to wait only five minutes for the keys, held by the manager. She gave me an envelop with my name on it and I opened it. In it, the keys and the address — no directions. Very French! This, too, made me feel as if I was in Argentina — same minimalist approach to everything, letting one fend for himself. Argentina and France share a similar aesthetic in that the native wants the tourist to interpret signs, thus moving him or her towards becoming a visitor, one who is not there to merely look at sites, but rather, one who is there to be affected by the place, its people and history. I got some directions, but I knew, between their French-English and my English-French, that I wasn’t being told the entire story. Back to the map. Immediately I found the street on the map, but I had to go through a series of circles, “DO NOT ENTER” circumlocutions until, a half hour later, I found the place. I lived on Rue Mouffetard,a street in the Ve arrondissement, near the Sorbonne. It is a quiet, narrow little area; it’s very neighborly, a real community, which is what I like. I was on the first floor of a beautiful building with a wonderful interior garden — something you read about or find in French movies. Outside, next door, a Creperie, of course; and down the block, about 50 meters, a small grocery store from which I purchased eggs, juice and, yes, bread and wine. And right in front of the little grocery store, a wonderful circle, all cobblestone, lined with cafes. Right around me are streets such as Diderot, Pascal, Descartes. When I arrived at my studio apartment, obtained through Parissimo, specializing in short term rentals, the city was barely awakening. I could hear the voices outside from my opened French balcony windows. I could also hear the birds and the pigeons. It was overcast and cool, so good for walking. Numerous church bells sang, calling. And I felt very, very lucky. Very fortunate, indeed.

https://theuncanny.us/coming-into-paris-one-early-morning-2e3bf8c592c9

['Héctor Vila']

2016-11-16 16:22:24.457000+00:00

['Cultural Studies', 'Argentina', 'Buenos Aires', 'Paris', 'Travel']

Title Coming Paris One Early MorningContent Early morning fifty kilometer Paris green field roll gently early morning mist sun rise slowly east It’s I’m watching French film deliberate meditative pace lozenge window tiny black Renault Twingo middle green field stucco tile farmhouse interrupt eye draw make wonder length time place feel age land harmony outskirt Paris ease — first neighborhood mid sized building corporation dot suburb big building suddenly sign “ParisCentre” traffic slows narrow though still 6 lane tunnel — Paris rise beyond Siene running along highway urging long way get — literally metaphorically day night crossed southern Sweden half Denmark major part Germany — Hambourg Hannover Douseldorf finally Luxemberg saw first grape vine smiled knew France near began day leaving Lund 7AM got 100kilometers Paris midnight key apartment held café French tried frantically call cell something wrong couldn’t get knew they’d closed time entered France — besides didn’t want tackle street thing dark without guarantee bed lay head would done 30 year ago — I’m glad recalled — slept truck stop car slept night awakened bit stiff 5AM washed drank double espresso began journey Paris don’t know maybe I’m overly romantic saw “ParisCentre” got emotional Perhaps simply working really hard erase image Paris come literature film course family mostly mother emotion escalated realized entry Paris way came almost identical entrance Buenos Aires Even first sign city immediately catapulted Buenos Aires two place — Borgesian experience put tradition contemporary French philosophy since I’m always always find always though seeing first time seeing light first time implies psychologically ready experience experience leading moment prepared first visit Paris always already Paris hugged Seine drove ever slowly pay sleeping car coming city yet awaken — awakened drove carefully deliberately eye classic beauty barge old building narrow street — street sign map That’s I’d go far stop look map memorize route street name calculating much time I’d travel get next stop Within ten minute city found Restaurant Retirement held key Unbelievably cleaning wait five minute key held manager gave envelop name opened key address — direction French made feel Argentina — minimalist approach everything letting one fend Argentina France share similar aesthetic native want tourist interpret sign thus moving towards becoming visitor one merely look site rather one affected place people history got direction knew FrenchEnglish EnglishFrench wasn’t told entire story Back map Immediately found street map go series circle “DO ENTER” circumlocution half hour later found place lived Rue Mouffetarda street arrondissement near Sorbonne quiet narrow little area it’s neighborly real community like first floor beautiful building wonderful interior garden — something read find French movie Outside next door Creperie course block 50 meter small grocery store purchased egg juice yes bread wine right front little grocery store wonderful circle cobblestone lined cafe Right around street Diderot Pascal Descartes arrived studio apartment obtained Parissimo specializing short term rental city barely awakening could hear voice outside opened French balcony window could also hear bird pigeon overcast cool good walking Numerous church bell sang calling felt lucky fortunate indeedTags Cultural Studies Argentina Buenos Aires Paris Travel

Tokenomics

Tokenomics $SEED and $TREE $SEED Token Name: SEED Token Symbol: Seed Supply: 800 Max Contract address: 0xc8c2eb145648c37fd5684708b6019a7c24d6b3c0 Private sale price: 450 USD (In payment token) Pre-sale price: 600 USD ( In payment token) Listing price: starting from 1500 USD Liquidity will first be added by the PlantDEx team on Pancakeswap 🍰 Bakeryswap 🍞 Streetswap🏙️ $SEED Allocation Allocation for pre-sale 70% Allocation for private sale 15% Allocation for SEED lottery 3% Allocation for project Dev 7% Allocation for Bounties 5% Funds gotten from $SEED private sale and pre-sale will be used for Dex development and Liquidity adding on various exchanges. $TREE Token Name: TREE Token Symbol: Tree Chain: Binance Smart chain (Bep20) Block rewards: per block 10 TREE (30,000 blocks per day) Total Supply: INFINITE (with burn) Price: Starting price $1 Distribution method: Liquidity Mining and staking No pre-mines no ICO no pre-sale. 70% of $TREE token block rewards will be shared amongst Liquidity miners . 30% of $TREE token block rewards will be shared by $SEED token stakers in the $TREE pool.

https://medium.com/@plantdex/tokenomics-3f08fdaa2d6f

[]

2020-11-29 06:32:12.800000+00:00

['Binance', 'Binance Smart Chain']

Title TokenomicsContent Tokenomics SEED TREE SEED Token Name SEED Token Symbol Seed Supply 800 Max Contract address 0xc8c2eb145648c37fd5684708b6019a7c24d6b3c0 Private sale price 450 USD payment token Presale price 600 USD payment token Listing price starting 1500 USD Liquidity first added PlantDEx team Pancakeswap 🍰 Bakeryswap 🍞 Streetswap🏙️ SEED Allocation Allocation presale 70 Allocation private sale 15 Allocation SEED lottery 3 Allocation project Dev 7 Allocation Bounties 5 Funds gotten SEED private sale presale used Dex development Liquidity adding various exchange TREE Token Name TREE Token Symbol Tree Chain Binance Smart chain Bep20 Block reward per block 10 TREE 30000 block per day Total Supply INFINITE burn Price Starting price 1 Distribution method Liquidity Mining staking premines ICO presale 70 TREE token block reward shared amongst Liquidity miner 30 TREE token block reward shared SEED token stakers TREE poolTags Binance Binance Smart Chain

Ycash Is Coming to Ethereum and Binance Smart Chain

Ycash Is Coming to Ethereum and Binance Smart Chain The Ycash Foundation will launch ERC-20 tokens representing wrapped Ycash on both Ethereum and Binance Smart Chain Ycash Foundation Nov 28, 2020·4 min read James Tissot, “Departure of the prodigal son” (1863). Oil on canvas. Petit Palais, Paris, France. By Howard Loo, Ycash Foundation Announcement I am excited to announce that the Ycash Foundation will launch ERC-20 tokens representing “wrapped” Ycash on both Ethereum and Binance Smart Chain by January 15, 2021. These tokens will enable Ycash holders to use Ycash with Decentralized Finance (DeFi) applications like Uniswap on Ethereum and PancakeSwap on Binance Smart Chain. The tokens will be centrally managed by the Ycash Foundation. Specifically, the Ycash Foundation will handle the minting and burning of the tokens, as well as the custody of the underlying Ycash coins. Information about how to obtain wYEC will be will be provided prior to launch. The Ethereum token and the Binance Smart Chain token will each have their own distinct names and ticker symbols, to be announced at launch. Until then, I will refer to both tokens interchangeably by the placeholder name wYEC. The Ycash Foundation hopes that one day Ycash will be integrated into a more decentralized wrapping protocol like Ren, but we aren’t going to wait around for that to happen. By launching wYEC, we are taking matters into our own hands and delivering DeFi capabilities to Ycash users now. We choose Ethereum because of its preeminence. Ethereum is truly revolutionary, and we want to give Ycash users the opportunity to participate in that revolution. With that said, we are aware that the Ethereum network’s transaction fees have risen to a point that may make some uses of wYEC on Ethereum cost-prohibitive. Although we strongly believe that Ethereum 2.0 will eventually bring down transaction fees significantly, we have listened to the feedback of Ycash users who want to use Ycash with DeFi applications as soon as possible on a network with low transaction fees. To that end, we will also deploy wYEC on Binance Smart Chain. Ycash, like Bitcoin, is sound money: There will never be more than 21 million Ycash coins, and 95% of all future block rewards will be fairly allocated to Ycash users via the free market mining process. These are the sacred promises upon which Ycash was founded, and the Ycash Foundation is the institution that will insure that these sacred promises are honored — forever. wYEC brings the fair, trusted, sound money approach of Ycash to the exciting world of DeFi. Motivations More Ways to Buy and Sell Ycash We have faced difficulties getting Ycash listed on additional centralized exchanges. Many centralized exchanges charge exorbitant listing fees, and the top-tier centralized exchanges that do not charge listing fees are not as eager to list coins with smaller market capitalizations like Ycash as they were in, say, the 2016 and 2017 timeframe. We will continue to work towards getting Ycash listed on more centralized exchanges. But luckily for Ycash users, the world seems to be moving on from centralized exchanges to more permissionless alternatives. Once wYEC is launched, we can immediately list wYEC pairs on automated market makers like Uniswap without asking anyone’s permission. That is beauty and power of a decentralized, permissionless platform. I am particularly interested in fostering pairings between Ycash and popular stable coins . For example, I will work with other Ycash users to create liquid wYEC/USDC and wYEC/BUSD pairings on Uniswap and other automated market makers. More Ways to Use Ycash wYEC has the potential to give Ycash users exciting new ways to use Ycash: By providing wYEC-related liquidity toautomated market makers, Ycash users will be able to use their Ycash for so-called “yield farming” (also known as “liquidity mining”). As DeFi lending markets evolve, wYEC could eventually allow Ycash users to use their Ycash holdings as collateral for loans. Similarly, future DeFi lending markets could eventually allow Ycash users lend out their Ycash and earn interest. As innovators in the Ethereum ecosystem create new uses cases for ERC-20 tokens, wYEC will enable Ycash users to enjoy these new use cases as soon as they are launched. More Users In order for Ycash to reach its full potential, we need A LOT of new Ycash users. By enabling new ways to acquire Ycash and new ways to use Ycash, I believe that wYEC has the potential to bring new users to Ycash (especially users interested in DeFi). Furthermore, once wYEC is launched, anyone with an ERC-20-compatible Ethereum wallet will be able to hold Ycash (via wYEC) without even needing to download a Ycash wallet. This lowers the barriers for any Ethereum user who wants to hold a bit of Ycash. Currently, Ycash users are free to choose between storing Ycash in a transparent way (similar to Bitcoin) or storing Ycash in a shielded pool. With the launch of wYEC, there will now be a third option: storing Ycash as wYEC on Ethereum or Binance Smart Chain. I envision wYEC being a “first-class citizen” in the Ycash ecosystem, with some Ycash users choosing to use wYEC as a long-term store of value. Join Us I invite you to join the ranks of Ycash users in advance of the launch of wYEC. I will be hosting several live discussion sessions leading up to the launch. Follow the YcashFoundation on Twitter to be notified of these sessions.

https://medium.com/@ycash/ycash-is-coming-to-ethereum-and-binance-smart-chain-971321e719f4

['Ycash Foundation']

2020-11-28 08:46:52.011000+00:00

['Ycash', 'Ethereum', 'Binance Smart Chain', 'Cryptocurrency', 'Defi']

Title Ycash Coming Ethereum Binance Smart ChainContent Ycash Coming Ethereum Binance Smart Chain Ycash Foundation launch ERC20 token representing wrapped Ycash Ethereum Binance Smart Chain Ycash Foundation Nov 28 2020·4 min read James Tissot “Departure prodigal son” 1863 Oil canvas Petit Palais Paris France Howard Loo Ycash Foundation Announcement excited announce Ycash Foundation launch ERC20 token representing “wrapped” Ycash Ethereum Binance Smart Chain January 15 2021 token enable Ycash holder use Ycash Decentralized Finance DeFi application like Uniswap Ethereum PancakeSwap Binance Smart Chain token centrally managed Ycash Foundation Specifically Ycash Foundation handle minting burning token well custody underlying Ycash coin Information obtain wYEC provided prior launch Ethereum token Binance Smart Chain token distinct name ticker symbol announced launch refer token interchangeably placeholder name wYEC Ycash Foundation hope one day Ycash integrated decentralized wrapping protocol like Ren aren’t going wait around happen launching wYEC taking matter hand delivering DeFi capability Ycash user choose Ethereum preeminence Ethereum truly revolutionary want give Ycash user opportunity participate revolution said aware Ethereum network’s transaction fee risen point may make us wYEC Ethereum costprohibitive Although strongly believe Ethereum 20 eventually bring transaction fee significantly listened feedback Ycash user want use Ycash DeFi application soon possible network low transaction fee end also deploy wYEC Binance Smart Chain Ycash like Bitcoin sound money never 21 million Ycash coin 95 future block reward fairly allocated Ycash user via free market mining process sacred promise upon Ycash founded Ycash Foundation institution insure sacred promise honored — forever wYEC brings fair trusted sound money approach Ycash exciting world DeFi Motivations Ways Buy Sell Ycash faced difficulty getting Ycash listed additional centralized exchange Many centralized exchange charge exorbitant listing fee toptier centralized exchange charge listing fee eager list coin smaller market capitalization like Ycash say 2016 2017 timeframe continue work towards getting Ycash listed centralized exchange luckily Ycash user world seems moving centralized exchange permissionless alternative wYEC launched immediately list wYEC pair automated market maker like Uniswap without asking anyone’s permission beauty power decentralized permissionless platform particularly interested fostering pairing Ycash popular stable coin example work Ycash user create liquid wYECUSDC wYECBUSD pairing Uniswap automated market maker Ways Use Ycash wYEC potential give Ycash user exciting new way use Ycash providing wYECrelated liquidity toautomated market maker Ycash user able use Ycash socalled “yield farming” also known “liquidity mining” DeFi lending market evolve wYEC could eventually allow Ycash user use Ycash holding collateral loan Similarly future DeFi lending market could eventually allow Ycash user lend Ycash earn interest innovator Ethereum ecosystem create new us case ERC20 token wYEC enable Ycash user enjoy new use case soon launched Users order Ycash reach full potential need LOT new Ycash user enabling new way acquire Ycash new way use Ycash believe wYEC potential bring new user Ycash especially user interested DeFi Furthermore wYEC launched anyone ERC20compatible Ethereum wallet able hold Ycash via wYEC without even needing download Ycash wallet lower barrier Ethereum user want hold bit Ycash Currently Ycash user free choose storing Ycash transparent way similar Bitcoin storing Ycash shielded pool launch wYEC third option storing Ycash wYEC Ethereum Binance Smart Chain envision wYEC “firstclass citizen” Ycash ecosystem Ycash user choosing use wYEC longterm store value Join Us invite join rank Ycash user advance launch wYEC hosting several live discussion session leading launch Follow YcashFoundation Twitter notified sessionsTags Ycash Ethereum Binance Smart Chain Cryptocurrency Defi

STAX Holders VIP Program and Withdrawal Fee Discounts

STAX Holders VIP Program and Withdrawal Fee Discounts As the release of our DEX gets closer we wanted to share some details with you guys regarding the Holders VIP Program and Withdrawal Fee Discounts. Withdrawal fees program Holding a given amount of STAX based on a 30 days average will enable our users to benefits from those VIP tiers and save on withdrawal fees as shown below. This was super important for us in designing this, because we felt that VIP tier programs are not very fair for regular users on centralised exchanges 1. We want every users to have >0 STAX in their wallet, so $600 today would get you all the way to a VIP4 level 2. It’s not transparent on centralised exchanges who gets fee rebates or who got the top vip tiers — there could be insiders who get better rates, etc. Here, everything is onchain, so if one dont maintain the necessary average balance of STAX to reach a tier, one will not be able to get the top rebates. That if one are a high frequency trader, they also know how many other accounts have the same or better fee rebate tier as another, and can adjust their strategies accordingly. This is super super important for attracting the large volume to come over to StableXswap. 3. As always, these parameters are subject to change, but we welcome feedback and input from the community and hope to hear from you guys as we roll this out. VIP 1 1000 STAX = 20% off withdrawal fees VIP 2 2,500 STAX = 30% off withdrawal fees VIP 3 5,000 STAX = 40% off withdrawal fees VIP 4 10,000 STAX = 50% off withdrawal fees VIP 5 50,000 STAX = 60% off withdrawal fees VIP 6 100,000 STAX = 75% off withdrawal Fees VIP 7 250,000 STAX = 88% off withdrawal fees VIP 8 500,000 STAX = 100% off withdrawal fees Why this withdrawal fees program? Simply to incentivize users to stay as Liquidity providers in our new DEX pools, as too many people switching to chase the highest short term yields leads to unstable liquidity for our users. We specifically will structure this as a withdrawal fee, rather than a deposit fee (which is how some other projects do it), because someone who comes in and deposits for one year only pays the fee once, someone that hops in and out of pools 10 or 20 times would face the fee, unless they hold STAX and are a VIP tier that would give the 100% off fees! Trading fees rebates Then those tiers will enable our users to access to trading fees rebates: VIP 4: 5% Fee Rebate VIP 5: 10% Fee Rebate VIP 6: 15% Fee Rebate VIP 7: 20% Fee Rebate VIP 8: 25% Fee Rebate We will continue working on bringing the best positive user experience for traders and liquidity providers. Even though stable pairs lowers drastically impermanent losses we want to do more to attract capitals and making StableXswap the most secure and attractive platform on the Binance Smart Chain. Let’s keep building STAX together! Website | Telegram | Announcements | Twitter | Github

https://medium.com/stablexswap/stax-holders-vip-program-and-withdrawal-fee-discounts-1244b5180c87

[]

2021-01-11 16:37:20.503000+00:00

['Stable Coin', 'Decentralized Exchange', 'Binance Smart Chain']

Title STAX Holders VIP Program Withdrawal Fee DiscountsContent STAX Holders VIP Program Withdrawal Fee Discounts release DEX get closer wanted share detail guy regarding Holders VIP Program Withdrawal Fee Discounts Withdrawal fee program Holding given amount STAX based 30 day average enable user benefit VIP tier save withdrawal fee shown super important u designing felt VIP tier program fair regular user centralised exchange 1 want every user 0 STAX wallet 600 today would get way VIP4 level 2 It’s transparent centralised exchange get fee rebate got top vip tier — could insider get better rate etc everything onchain one dont maintain necessary average balance STAX reach tier one able get top rebate one high frequency trader also know many account better fee rebate tier another adjust strategy accordingly super super important attracting large volume come StableXswap 3 always parameter subject change welcome feedback input community hope hear guy roll VIP 1 1000 STAX 20 withdrawal fee VIP 2 2500 STAX 30 withdrawal fee VIP 3 5000 STAX 40 withdrawal fee VIP 4 10000 STAX 50 withdrawal fee VIP 5 50000 STAX 60 withdrawal fee VIP 6 100000 STAX 75 withdrawal Fees VIP 7 250000 STAX 88 withdrawal fee VIP 8 500000 STAX 100 withdrawal fee withdrawal fee program Simply incentivize user stay Liquidity provider new DEX pool many people switching chase highest short term yield lead unstable liquidity user specifically structure withdrawal fee rather deposit fee project someone come deposit one year pay fee someone hop pool 10 20 time would face fee unless hold STAX VIP tier would give 100 fee Trading fee rebate tier enable user access trading fee rebate VIP 4 5 Fee Rebate VIP 5 10 Fee Rebate VIP 6 15 Fee Rebate VIP 7 20 Fee Rebate VIP 8 25 Fee Rebate continue working bringing best positive user experience trader liquidity provider Even though stable pair lower drastically impermanent loss want attract capital making StableXswap secure attractive platform Binance Smart Chain Let’s keep building STAX together Website Telegram Announcements Twitter GithubTags Stable Coin Decentralized Exchange Binance Smart Chain

SpartanDev: 23/11/20–29/11/20

The ‘Burn’ phase will soon be closed off with the remaining token distribution allocation being shifted to the ‘bond’ program (Roughly ~45M of 100M SPARTA) Please see the below article for a more in-depth look at Bond+Mint V1 through to the current V3: It is important to have deep pools to reduce the amount of slippage on larger trades, therefore the team decided to focus on 3 pools that are most desired by the community. This week the contributors pushed Version3 of Bond+Mint — A community-crafted solution aiming to complete the initial token distribution whilst also bootstrapping TVL (Total Value Locked) into the pools ready for SpartanSwaps, SpartanSynths and other future features. Dismiss GitHub is home to over 50 million developers working together to host and review code, manage projects, and… Dismiss GitHub is home to over 50 million developers working together to host and review code, manage projects, and… On the Swap page, the buttons for 25%, 50%, 75% and All are not functioning as efficiently as possible, with several… Dismiss GitHub is home to over 50 million developers working together to host and review code, manage projects, and… Dismiss GitHub is home to over 50 million developers working together to host and review code, manage projects, and… The BNB gas calc modal currently grabs the input value (before calcs) Let's change it to the value that is handed to… Dismiss GitHub is home to over 50 million developers working together to host and review code, manage projects, and… The Spartan community UI contributors had a quieter week this week, closing off 12 GitHub issues/features on the SpartanPools repo. SpartanSwap — DApp User Interface There was no activity in the ‘SpartanSwap’ repo this week. Focus will shift here probably following Bond+Mint & DAO activation. In the meantime, any community members with some interest and spare time feel free to load up the GitHub and get involved with either developing or adding issues/suggestions. Next Milestone / Sprint Bond+Mint V3 — new features opened up with a proper allocation to begin completing token distribution. — Now Live, more allocations to follow BurnForSparta — The remaining allocations for the BurnForSparta program will be CLOSED and moved to the new Bond+Mint program. — Imminent DAO — Enabling the DAO. With token distribution winding back up and most of the base-level features now coming to mainnet, it seems like a good time to enable the DAO. Bond+Mint V3 now has a feature for the DAO to vote to enable other tokens for the Bond program. SpartanSwap — The ‘UniSwap’ style interface making use of the ROUTER smart contract features; swap from one non-SPARTA asset to another non-SPARTA asset. SpartaSynths — Synthetic assets, lending etc. This is the big feature that most are waiting for, however we must be patient and establish a strong base with deep pools and wide token distribution before this can work in a big way. Road Map Spartan Events Community Contribution SpartanProtocol at is at its core a community driven and led project. In this vein the more contributors the better, there is a great opportunity for community members to contribute by making LP reward analysis tools etc. If you have an idea share it in the community channels. Engage with the community and developers What to find out all the latest updates or suggest improvements — get involved.

https://medium.com/spartanprotocol/spartandev-23-11-20-29-11-20-66da6cbedf49

[]

2020-11-30 05:08:13.639000+00:00

['Binance', 'Binance Smart Chain', 'Defi', 'Metamask']

Title SpartanDev 231120–291120Content ‘Burn’ phase soon closed remaining token distribution allocation shifted ‘bond’ program Roughly 45M 100M SPARTA Please see article indepth look BondMint V1 current V3 important deep pool reduce amount slippage larger trade therefore team decided focus 3 pool desired community week contributor pushed Version3 BondMint — communitycrafted solution aiming complete initial token distribution whilst also bootstrapping TVL Total Value Locked pool ready SpartanSwaps SpartanSynths future feature Dismiss GitHub home 50 million developer working together host review code manage project and… Dismiss GitHub home 50 million developer working together host review code manage project and… Swap page button 25 50 75 functioning efficiently possible several… Dismiss GitHub home 50 million developer working together host review code manage project and… Dismiss GitHub home 50 million developer working together host review code manage project and… BNB gas calc modal currently grab input value calcs Lets change value handed to… Dismiss GitHub home 50 million developer working together host review code manage project and… Spartan community UI contributor quieter week week closing 12 GitHub issuesfeatures SpartanPools repo SpartanSwap — DApp User Interface activity ‘SpartanSwap’ repo week Focus shift probably following BondMint DAO activation meantime community member interest spare time feel free load GitHub get involved either developing adding issuessuggestions Next Milestone Sprint BondMint V3 — new feature opened proper allocation begin completing token distribution — Live allocation follow BurnForSparta — remaining allocation BurnForSparta program CLOSED moved new BondMint program — Imminent DAO — Enabling DAO token distribution winding back baselevel feature coming mainnet seems like good time enable DAO BondMint V3 feature DAO vote enable token Bond program SpartanSwap — ‘UniSwap’ style interface making use ROUTER smart contract feature swap one nonSPARTA asset another nonSPARTA asset SpartaSynths — Synthetic asset lending etc big feature waiting however must patient establish strong base deep pool wide token distribution work big way Road Map Spartan Events Community Contribution SpartanProtocol core community driven led project vein contributor better great opportunity community member contribute making LP reward analysis tool etc idea share community channel Engage community developer find latest update suggest improvement — get involvedTags Binance Binance Smart Chain Defi Metamask

New LP Pools

New LP Pools The current pool incentives are ending in half a day from. With that, we introduce the second batch of the incentivized pools: $NYA Hey, that’s us 🐱 (20x) $BUSD @binance (1x) $USDT @Tether_to (1x) $USDC @coinbase (1x) $QUSD @QIAN_Stablecoin (1x) $DAI @MakerDAO (1x) $ETH @ethereum (1x) $BTCB @Bitcoin (1x) $LTC @litecoin (1x) $BAND @BandProtocol (1x) $EOS @block_one_ (1x) $UNI @UniswapProtocol (1x) Nyanswop welcomes 4 new tokens: $USDC, $QUSD, $LTC, $UNI 🎉 The above 12 pools rewards will start on Nov 14 12PM UTC+0. As usual, you can stake now but the rewards will only start counting from Nov 14 12PM UTC+0 onwards. Do You Need to Do Anything? Yes! You’ll need to unstake from the current pools and stake again in the new pools. This is because our pool contract does not involve the usage of a ‘migrator’. The absence of a migrator concept means that the contract is SAFU. Safe from what? Us! Simply because we don’t have any rights to move any funds in the pool contracts. To note that this is not time specific. There won’t be any issues doing this at any time later. What If I Just Leave It? No issues with that. You funds are still yours, and you still continue to earn the swap fees as long as you are still holding onto the LP token of the pairs. You can still unstake any time. Where’s the Old Pools? I Can’t Find Them! It’s at the bottom of the page, at the ‘Past pools’ section. Scroll down the page nya~ 🚀 Follow us on Twitter and Telegram for the latest updates. Twitter: https://twitter.com/nyanswop Telegram: https://t.me/Nyanswop Telegram (Indonesian): https://t.me/Nyanswop_ID Telegram (Announcements): https://t.me/Nyanswop_ANN

https://medium.com/@nyanswop/new-lp-pools-aec3d1c83e4d

[]

2020-11-14 02:36:04.685000+00:00

['Binance', 'Binance Smart Chain', 'Blockchain', 'Defi', 'Cryptocurrency']

Title New LP PoolsContent New LP Pools current pool incentive ending half day introduce second batch incentivized pool NYA Hey that’s u 🐱 20x BUSD binance 1x USDT Tetherto 1x USDC coinbase 1x QUSD QIANStablecoin 1x DAI MakerDAO 1x ETH ethereum 1x BTCB Bitcoin 1x LTC litecoin 1x BAND BandProtocol 1x EOS blockone 1x UNI UniswapProtocol 1x Nyanswop welcome 4 new token USDC QUSD LTC UNI 🎉 12 pool reward start Nov 14 12PM UTC0 usual stake reward start counting Nov 14 12PM UTC0 onwards Need Anything Yes You’ll need unstake current pool stake new pool pool contract involve usage ‘migrator’ absence migrator concept mean contract SAFU Safe Us Simply don’t right move fund pool contract note time specific won’t issue time later Leave issue fund still still continue earn swap fee long still holding onto LP token pair still unstake time Where’s Old Pools Can’t Find It’s bottom page ‘Past pools’ section Scroll page nya 🚀 Follow u Twitter Telegram latest update Twitter httpstwittercomnyanswop Telegram httpstmeNyanswop Telegram Indonesian httpstmeNyanswopID Telegram Announcements httpstmeNyanswopANNTags Binance Binance Smart Chain Blockchain Defi Cryptocurrency

PlantDEx

PlantDEx Revolutional Yield Farm and AMM on Binance Smart Chain PlantDEx is an innovative community with DeFi project developed by the best minds in the DeFi ecosystem. PlantDEx is adopted on Binance smart Chain, having a limited Governance token $SEED and utility Token $TREE which is unlimited in supply with an effective inflation control mechanism. DeFi is one of the places to be right now as it provides decentralized financial services, that was originally offered by the centralized finance institutions. PlantDEx is one of the latest protocol offering cutting edge DeFi services. The exchange has an automated market maker (AMM) that allows two tokens to be exchanged on the Binance Smart Chain (Bep20), With a Governance token $SEED who’s holders have the right to govern and make decisions concerning the affairs of the PlantDEx ecosystem. $Seed can also be put to work through planting (staking) in the $TREE pool to earn $TREEs and added to a liquidity pool which you also earn $TREE as Reward. $TREE will in future be the ultimate token for purchasing and trading agrobased stock. With $TREE, users will be able to Transplant (fruit pool staking) with ease and confidence and also earn fruit pool tokens (These are tokens from partner or community projects). PlantDEx is here to revolutionalize the general concept of Blockchain farming and staking, through proper analysis of projects before us we are making the good aspects better and correcting the flaws made. Agriculture and Blockchain never sounded better than this!!! Telegram Twitter Facebook

https://medium.com/@plantdex/plantdex-186c896cde22

[]

2020-11-28 19:52:37.218000+00:00

['Binance', 'Defi', 'Binance Smart Chain', 'Binance Chain']

Title PlantDExContent PlantDEx Revolutional Yield Farm AMM Binance Smart Chain PlantDEx innovative community DeFi project developed best mind DeFi ecosystem PlantDEx adopted Binance smart Chain limited Governance token SEED utility Token TREE unlimited supply effective inflation control mechanism DeFi one place right provides decentralized financial service originally offered centralized finance institution PlantDEx one latest protocol offering cutting edge DeFi service exchange automated market maker AMM allows two token exchanged Binance Smart Chain Bep20 Governance token SEED who’s holder right govern make decision concerning affair PlantDEx ecosystem Seed also put work planting staking TREE pool earn TREEs added liquidity pool also earn TREE Reward TREE future ultimate token purchasing trading agrobased stock TREE user able Transplant fruit pool staking ease confidence also earn fruit pool token token partner community project PlantDEx revolutionalize general concept Blockchain farming staking proper analysis project u making good aspect better correcting flaw made Agriculture Blockchain never sounded better Telegram Twitter FacebookTags Binance Defi Binance Smart Chain Binance Chain

Xend Finance - Next generation DeFi Credit Union

Xend Finance - Next generation DeFi Credit Union DeFi has challenged traditional financial institution’s status quo and successfully created its own unique space in the economic ecosystem. However, to make the vision of a decentralized future a reality, numerous technological advancements and innovative projects need to be launched. With the same spirit, a Nigerian Startup, Xend Finance, has launched an evolutionary DeFi platform for credit unions and cooperatives. It is decentralizing savings, lending, borrowing and investment operations of credit unions, and providing multi-level interest returns to members of these unions. Xend Finance is the first protocol to target this over $2.2 Trillion credit union global market. Background Traditional credit unions were created with an aim to offer financial products with low-interest rates and fees. However, their old methods of functioning are limited and outdated in nature. There is a huge gap between traditional financial services and the needs of people today. These credit unions are location and access dependent, provide low returns, have insufficient access to liquidity and give zero insurance cover on deposits. Also, centralized and Fiat savings platforms are always limited by fees and cross border payment regulations that restrict investing in other countries. That’s where Xend Finance steps in. It is a decentralized Credit Union protocol built to optimize, improve, and add value to credit union’s core operations globally. Credit unions and cooperatives worldwide can leverage this DeFi platform and channel capital into savings and earn higher interest in stable currencies. Xend Finance — A stable alternative in Africa Xend Finance is the first platform in Africa to be built on the Binance Smart Chain. Thus, opening limitless opportunities for the African crypto market. Various countries in Africa are witnessing economic and financial issues like high inflation rate, volatile currencies, capital controls, and lack of banking infrastructure. Xend finance will be a turning point in the African economy, laying the foundation of a stable and secure alternative to traditional financial institutions. Xend Finance breaks down the entry barriers with the help of blockchain technology in innumerable ways – It gives credit unions and individuals an opportunity to save their valuable earnings and earn instantly. It provides high annual percentage yields of up to 20%. It offers a trustless and stable alternative to unstable currencies across the world. It enables access to global decentralized financial services such as DeFi savings, DeFi lending and DeFi borrowing. Anyone from anywhere in the world can utilize these financial services. It gives access to decentralized insurance to ensure the protection of deposited assets. Credit unions and Individuals can now easily store their money in foreign and stable digital currencies, earn interest in the foreign stable currencies and also borrow in foreign stable currencies. XendFinance is a Decentralized Autonomous Organization (DAO) governed by $XEND token holders using three different smart parameters: Xend Token Smart Contract, Governance Smart Contract and Time Lock Smart Contract. These smart contracts will allow the XendFinance community to propose features, vote and execute approved proposals. $Xend is the native token that performs multiple operations like rewarding users, protocol fees, and governance voting on the platform. XendFinance smart contract integrates the DeFi lending Protocol smart contracts to enable seamless communication between the protocols. Currently, they have two exemplary apps — Xend and Geena. Xend app has processed over 2 million transactions and has more than 55K active users. It is a one-stop solution for business and personal transactions. Via Xend App, one can transfer money to any Xend account or bank account within Nigeria. Apart from this, one can pay bills, receive payments and make offline payments. Geena enables businesses to make fast sales from one or multiple sales points. One can monitor real-time sales data, generate and send custom receipts. The app provides a network of solutions that help you make informed business decisions and keep track of daily activities. Why Binance Chain? Binance Smart Chain is fully EVM (Ethereum Virtual Machine)-compatible and has support for the majority of the tools used by Ethereum developers such as Metamask, Remix, Truffle, Ganache-CLI, and more. Binance Smart Chain already has support for infrastructures like ChainLink and Band Protocol Oracles. Also, the consensus mechanism used in Binance Smart Chain is Proof of Staked Authority (PoSA), which combines features from Delegated Proof-of-Stake (DPoS) and Proof-of-Authority (PoA). It can produce a block approximately every 3 seconds, which will significantly improve the speed of DeFi protocols built on the Binance Smart Chain. The low fees will drastically reduce the cost of using DeFi protocols and hence improve user adoption. Xend Finance will support multiple currencies across different blockchains as a result of the cross-chain asset transfer feature of the Binance Smart Chain. Their first testnet on Binance Smart Chain is currently scheduled for December. An exceptional team Xend finance’s team is made up of experienced mathematicians, finance, cryptography, and blockchain engineers. The founding team has worked with some of Africa’s largest employers, including KPMG, Chevron, and Stanbic Bank. They have received intensive mentorship from Google’s engineers and leadership team. Latest Updates Recently, Xend Finance secured a $1.5-million investment round from Binance Labs, Google Developers Launchpad, AU21 Capital, Ampifi VC, JUN Capital, TRG Capital, and Matic Co-founder, Sandeep Nailwal, Twin Apex Capital, DeltaHub Capital, and Moon Whale. According to the Xend Finance roadmap, a lot more would be happening in the next few months. Partnership announcements with Credit unions, exchange listings, more App development, and the governance model’s implementation are some of the major upcoming developments and updates on the cards. Conclusion Backed by technological advancements, blockchain has the power to transform the global economy. However, there is still a lot to explore and achieve. Interestingly, developers are coming up with unique and revolutionizing solutions to bridge the gap between traditional financial institutions and blockchain technology. With the launch of a DeFi platform for credit unions and cooperatives, Xend Finance has hit the right spot. It will play a crucial role in enabling credit unions, cooperatives, and individuals worldwide to leverage this superior technology’s benefits, pushing the mainstream adoption of cryptocurrency by mass users. However, this is just the beginning. The platform is new. Therefore, they will need to invest in creating awareness about their platform and establish their own brand identity. They are receiving support from incredible investors. So, that will definitely make a difference. All the best to the team. We will be tracking their progress closely! If you want to know more, join their communities on Telegram and Twitter. Visit the website — https://xend.finance/

https://medium.com/@defimaximalist/xend-finance-next-generation-defi-credit-union-b82964b9645b

['Defi Maximalist']

2020-11-14 04:53:59.488000+00:00

['Decentralized Finance', 'Binance Smart Chain', 'Ethereum', 'Fianance', 'Blockchain']

Title Xend Finance Next generation DeFi Credit UnionContent Xend Finance Next generation DeFi Credit Union DeFi challenged traditional financial institution’s status quo successfully created unique space economic ecosystem However make vision decentralized future reality numerous technological advancement innovative project need launched spirit Nigerian Startup Xend Finance launched evolutionary DeFi platform credit union cooperative decentralizing saving lending borrowing investment operation credit union providing multilevel interest return member union Xend Finance first protocol target 22 Trillion credit union global market Background Traditional credit union created aim offer financial product lowinterest rate fee However old method functioning limited outdated nature huge gap traditional financial service need people today credit union location access dependent provide low return insufficient access liquidity give zero insurance cover deposit Also centralized Fiat saving platform always limited fee cross border payment regulation restrict investing country That’s Xend Finance step decentralized Credit Union protocol built optimize improve add value credit union’s core operation globally Credit union cooperative worldwide leverage DeFi platform channel capital saving earn higher interest stable currency Xend Finance — stable alternative Africa Xend Finance first platform Africa built Binance Smart Chain Thus opening limitless opportunity African crypto market Various country Africa witnessing economic financial issue like high inflation rate volatile currency capital control lack banking infrastructure Xend finance turning point African economy laying foundation stable secure alternative traditional financial institution Xend Finance break entry barrier help blockchain technology innumerable way – give credit union individual opportunity save valuable earnings earn instantly provides high annual percentage yield 20 offer trustless stable alternative unstable currency across world enables access global decentralized financial service DeFi saving DeFi lending DeFi borrowing Anyone anywhere world utilize financial service give access decentralized insurance ensure protection deposited asset Credit union Individuals easily store money foreign stable digital currency earn interest foreign stable currency also borrow foreign stable currency XendFinance Decentralized Autonomous Organization DAO governed XEND token holder using three different smart parameter Xend Token Smart Contract Governance Smart Contract Time Lock Smart Contract smart contract allow XendFinance community propose feature vote execute approved proposal Xend native token performs multiple operation like rewarding user protocol fee governance voting platform XendFinance smart contract integrates DeFi lending Protocol smart contract enable seamless communication protocol Currently two exemplary apps — Xend Geena Xend app processed 2 million transaction 55K active user onestop solution business personal transaction Via Xend App one transfer money Xend account bank account within Nigeria Apart one pay bill receive payment make offline payment Geena enables business make fast sale one multiple sale point One monitor realtime sale data generate send custom receipt app provides network solution help make informed business decision keep track daily activity Binance Chain Binance Smart Chain fully EVM Ethereum Virtual Machinecompatible support majority tool used Ethereum developer Metamask Remix Truffle GanacheCLI Binance Smart Chain already support infrastructure like ChainLink Band Protocol Oracles Also consensus mechanism used Binance Smart Chain Proof Staked Authority PoSA combine feature Delegated ProofofStake DPoS ProofofAuthority PoA produce block approximately every 3 second significantly improve speed DeFi protocol built Binance Smart Chain low fee drastically reduce cost using DeFi protocol hence improve user adoption Xend Finance support multiple currency across different blockchains result crosschain asset transfer feature Binance Smart Chain first testnet Binance Smart Chain currently scheduled December exceptional team Xend finance’s team made experienced mathematician finance cryptography blockchain engineer founding team worked Africa’s largest employer including KPMG Chevron Stanbic Bank received intensive mentorship Google’s engineer leadership team Latest Updates Recently Xend Finance secured 15million investment round Binance Labs Google Developers Launchpad AU21 Capital Ampifi VC JUN Capital TRG Capital Matic Cofounder Sandeep Nailwal Twin Apex Capital DeltaHub Capital Moon Whale According Xend Finance roadmap lot would happening next month Partnership announcement Credit union exchange listing App development governance model’s implementation major upcoming development update card Conclusion Backed technological advancement blockchain power transform global economy However still lot explore achieve Interestingly developer coming unique revolutionizing solution bridge gap traditional financial institution blockchain technology launch DeFi platform credit union cooperative Xend Finance hit right spot play crucial role enabling credit union cooperative individual worldwide leverage superior technology’s benefit pushing mainstream adoption cryptocurrency mass user However beginning platform new Therefore need invest creating awareness platform establish brand identity receiving support incredible investor definitely make difference best team tracking progress closely want know join community Telegram Twitter Visit website — httpsxendfinanceTags Decentralized Finance Binance Smart Chain Ethereum Fianance Blockchain

How to participate in Binance’s $120,000 BNB Reward Pool

TokenPocket Official site: www.tokenpocket.pro Time of the event: 2020/11/27 1:00 PM — 2020/12/27 1:00 PM (UTC)（Original link） Binance, in conjuction with PancakeSwap, launched a $120,000 BNB Reward Pool to further support the growth of Binance Smart Chain. During the time of the event, stake up to 100,000 USD BNB on PancakeSwap through the Binance Smart Chain. Binance will provide 100,000 USD BNB for users who stake CAKE tokens in PancakeSwap’s Syrup Pool. All users who hold BNB and earned CAKE tokens will share 20,000 USD worth BNB from the bonus pool equally. Binance Smart Chain users will also be able to place bets on BNB to earn CAKE tokens from the $120,000 reward pool. How to participate: Create a Binance Smart Chain wallet Deposit BEP20 BNB into your Binance Smart Chain wallet Place bets to earn CAKE tokens (BNB can be unstaked at any time) Notes: Stake limit per Binance user: 10 BNB Users who deliberately create multiple Binance Smart Chain wallets for this event will be blacklisted and will not receive any reward. Step by step guide Open the TP wallet, click [Discover] and then search for the keyword: Pancake. Select [Syrup Pool] to open the application. 2. Pull down to find the mining pool for this event (make sure to choose the correct one). You can directly click the plus (+) sign to set the quantity and deposit it. Note that the maximum supported amount is 10 BNB. 3. Binance Smart Chain fees are very cheap. After authorization is completed, you will see the next features (this also means the operation was successful). Click [Harvest] to withraw the rewards; Click [Unstake BNB] to unstake; Click [+] to deposit more BNB (Max. of 10 BNB) Redeeming BNB is also very simple. After clicking the redemption option, set the amount to be redeemed, and authorize the operation. After that, you can return to the wallet balance and check it. The opinions expressed in the Blog are for general informational purposes only and are not intended to provide specific advice or recommendations for any individual or on any specific security or investment product. It is only intended to provide education about the financial industry. This tutorial is for informational purposes about the operation of a DApp on the wallet only and is not intended to provide any investment. Investment involves risks. You must fully understand the risks and make your own investment decisions.

https://medium.com/@tokenpocket-gm/how-to-participate-in-binances-120-000-bnb-reward-pool-c9f91ea2266e

[]

2020-11-30 04:12:24.376000+00:00

['Blockchain', 'Binance Smart Chain']

Title participate Binance’s 120000 BNB Reward PoolContent TokenPocket Official site wwwtokenpocketpro Time event 20201127 100 PM — 20201227 100 PM UTC（Original link） Binance conjuction PancakeSwap launched 120000 BNB Reward Pool support growth Binance Smart Chain time event stake 100000 USD BNB PancakeSwap Binance Smart Chain Binance provide 100000 USD BNB user stake CAKE token PancakeSwap’s Syrup Pool user hold BNB earned CAKE token share 20000 USD worth BNB bonus pool equally Binance Smart Chain user also able place bet BNB earn CAKE token 120000 reward pool participate Create Binance Smart Chain wallet Deposit BEP20 BNB Binance Smart Chain wallet Place bet earn CAKE token BNB unstaked time Notes Stake limit per Binance user 10 BNB Users deliberately create multiple Binance Smart Chain wallet event blacklisted receive reward Step step guide Open TP wallet click Discover search keyword Pancake Select Syrup Pool open application 2 Pull find mining pool event make sure choose correct one directly click plus sign set quantity deposit Note maximum supported amount 10 BNB 3 Binance Smart Chain fee cheap authorization completed see next feature also mean operation successful Click Harvest withraw reward Click Unstake BNB unstake Click deposit BNB Max 10 BNB Redeeming BNB also simple clicking redemption option set amount redeemed authorize operation return wallet balance check opinion expressed Blog general informational purpose intended provide specific advice recommendation individual specific security investment product intended provide education financial industry tutorial informational purpose operation DApp wallet intended provide investment Investment involves risk must fully understand risk make investment decisionsTags Blockchain Binance Smart Chain

Decentralization of protocol frontend

Decentralization of protocol frontend Many users depend on the websites that provide a simple way to interact with the smart contracts of defi projects. In the event that the main project site is offline, having a duplicate copy of the frontend may assist user with various smart contract interactions. The main frontend of a protocol can be down due to various reasons : Distributed Denial of Service (DDOS attack) Domain name DDOS / Malicious takeover Abandoned project A clone front end will save you the headache from interacting with the smart contract directly, especially for various complex smart contract calls. Having a duplicate copy of the project does NOT help when the protocol has inherent protocol exploits, or has in-built malicious code or mechanisms. For example: Stop the developer or malicious 3rd party from draining the LPs or token. Prevents infinite mint of tokens. In these cases, direct interaction with the smart contract via etherscan.io or bscscan.com won’t help either. Most projects store a copy of the frontend in their github repository. These frontend ‘source code’ are unpacked and not readied for deployment directly. Navigating and using github is not difficult but might be too nerdy an action for most users. We will attempt to simplify the frontend cloning process through a quick and easy walk through of cloning the acryptos.com (ACS) site.

https://medium.com/@getunrekt/decentralization-of-protocol-frontend-9887a40f8e5

[]

2021-04-08 10:15:49.607000+00:00

['Smart Contract Blockchain', 'Web Development', 'Smart Contract Security', 'Binance Smart Chain', 'Ethereum Blockchain']

Title Decentralization protocol frontendContent Decentralization protocol frontend Many user depend website provide simple way interact smart contract defi project event main project site offline duplicate copy frontend may assist user various smart contract interaction main frontend protocol due various reason Distributed Denial Service DDOS attack Domain name DDOS Malicious takeover Abandoned project clone front end save headache interacting smart contract directly especially various complex smart contract call duplicate copy project help protocol inherent protocol exploit inbuilt malicious code mechanism example Stop developer malicious 3rd party draining LPs token Prevents infinite mint token case direct interaction smart contract via etherscanio bscscancom won’t help either project store copy frontend github repository frontend ‘source code’ unpacked readied deployment directly Navigating using github difficult might nerdy action user attempt simplify frontend cloning process quick easy walk cloning acryptoscom ACS siteTags Smart Contract Blockchain Web Development Smart Contract Security Binance Smart Chain Ethereum Blockchain

Bond+Mint on Spartan Protocol

Bootstrapping Liquidity + Initial SPARTA Token Distribution Summary Bond+Mint; another novel distribution idea from the Spartan Protocol community — After continued discussions about how best to press on with SPARTA token distribution after BurnForSPARTA, the community contributors built and tried out the new Bond+Mint feature. The ‘Burn’ phase will soon be closed off with the remaining token distribution allocation being shifted to the ‘bond’ program (Roughly ~50M SPARTA) SPARTA Distribution Phase 01: BurnForSPARTA If you missed it; here is a quick recap of the unique idea used for the initial token distribution, designed to get SPARTA widely distributed into the firm hands of many Binance Chain communities ready for BSC’s big push: Bob deposits $1,000 worth of BNB into the burn DApp The BNB is ‘burnt’ (sent to a specified ‘burn’ address, which essentially removes them from the supply forever) The contract mints $1,000 worth of SPARTA and sends it to Bob In theory, this means SPARTA absorbs the value of the burnt assets, giving them a baseline value that most holders won’t sell below. There is obviously a lot of nuance there and markets will be markets; however the burn phase was successful in many ways: Wide token distribution, without resorting to techniques like ‘airdrops’ Rug-pull resistant (no team, developer, pre-mine or private sale tokens) Token price appreciation; unfortunately it fell short here. In theory, there should have been a fairly solid 30c base for the token price with the value transfer proposition, and that no one user or group was receiving any SPARTA in a zero-value ‘airdrop’ fashion. Short term wasn’t successful in price action, but time will tell with continued development! The community is showing strong support and belief despite that. The above led to many robust and poductive discussions within the community for determining other ways to continue the distribution of the initial 100M SPARTA allocation. Enter; Bond+Mint… SPARTA Distribution Phase 02: Bonding with SPARTA Bond+Mint v1 was primarily a testnet experiment with the initial idea of a way to achieve two goals: Complete the initial token distribution Begin the first push towards accelerating the TVL of Spartan Protocol V1 Scenario: Bob deposits $1,000 worth of BNB to the DApp The contract mints $1,000 worth of SPARTA at spot price (no slippage) Both assets ($2,000 worth) are added to their relevant Liquidity Pool (SPARTA:BNB Pool) LP tokens are minted representing a claim on those assets entering the pool 50% of these LP tokens are sent to Bob so he can stake them in the DAO and earn harvest rewards (or redeem to sell/swap if he so pleases) The remaining 50% are vested back to Bob linearly over a 12 month period Sounds attractive, right? Double your equity? Bonders get back their initial investment instantly, and it releases the bonus cream on top over a 12-month period. There is an obvious issue with this concept, bad actors will abuse anything with almost zero risk, and will negatively impact token price. With this just being on testnet for experimental purposes, and no obvious or simple way to make anything other than 50/50 (symmetrical mint + add to pool) without causing massive slippage and imbalance in the pools, the smart contract contributors continued working on their code and started experimenting on testnet. After testnet testing, the contributors changed some variables and gave it a small allocation for testing on mainnet. V1 Bug: During mainnet testing, only a small amount of SPARTA was emitted (1,043) from the 5,000,000 allocation because of testers noticing a bug (due to the change of some variables) that only created 75% of the expected SPARTA:BNB total assets, leaving the user with 25% fewer assets after 12 months. The Devs moved on to V2 and pegged the remaining 4,998,957 SPARTA in the contract to be recovered or burnt in a later Bond+Mint version. Bond+Mint v2 involved a few iterative changes to allow for ‘burning’ tokens in the contract in case of an upgrade or issue, and also a simple fix to the 50/50 issue. The ratio was then trialled at 25/75 (25% to Bob now and 75% over 12 months), quietly (on mainnet) with a tiny SPARTA allocation. The testing went well! During this period, the wider community caught on and piled in to wipe out the 5M SPARTA allocation pretty quickly — we are talking a little under 12 hours, with over 9,000 BNB committed into the liquidity pool! Time and effect was put into analysing bonder habits and community feedback, to ensure V3 Bond+Mint addressed some below concerns with the next small test allocation. Market-sell dump — the 25/75 ratio still wasn’t quite low enough to steer bonders away from either selling or swapping their existing SPARTA to get more BNB for Bonding, or from releasing their existing 25% return allocation, selling/swapping the SPARTA portion again, and re-bonding the remaining BNB. V3 will be 0/100 (0% to Bob now, 100% over 12 months) Pool price manipulation remained possible, based on the existing TVL of the BNB:SPARTA Pool (to game the ‘spot price’ used to calculate how many SPARTA minted by your ‘bond’) Whale concentration making use of a flat spot price to avoid slippage To combat the points above, V3 uses ‘purchasing power’ rather than spot price to calculate the SPARTA minted. This can be emulated by visiting the ‘swap’ page of the DApp and pretending to do a swap of the amount you want to bond. Underneath your input you will see a ‘rate’, click the ‘+’ icon next to that to see the ‘rate slip’ underneath. The percentage shown here represents how much it would emit less SPARTA for you in V3 vs V2. For most normal peers, this has little to no affect on the end result. For anyone who was trying to manipulate the spot price to get a better ‘bond’ rate, they will now pay slippage fees twice when attempting this kind of manipulation (large slippage = large fees which are paid into the liquidity pools to reward liquidity providers), this will in theory also drive in more peers with smaller ‘bonds’ (more decentralisation / better distribution) Bond+Mint V3: Three tokens have now been enabled on mainnet for more community testing with a small 2.5M SPARTA allocation and feedback. Remember, whilst this is mainnet it is still experimental and comes with its risks as always. Proceed with caution! BNB, BUSD, USDT all enabled for a small 2.5M SPARTA test allocation V3 scenario: Bob sends $1,000 through the bond contract $1,000 worth of SPARTA is minted (at swap price) price) ~$2,000 worth of assets get locked into the SPARTA:BNB pool 0% goes to Bob straight away 100% is vested to Bob over 12 months (can claim as often as he likes; it is calculated every second just like the harvest feature) V1 Allocation Contract Recovery: V3 implements the lessons learnt throughout testing and feedback during the previous campaigns and seeks to do the same again, starting with an allocation of 2.5 million SPARTA. Remember that 4,998,957 SPARTA locked in the V1 contract? The team has written a contract to allocate it to the V3 testing campaign to allow a larger testing base with the increase maturity of the program. Remember, whilst this is mainnet it is still experimental and comes with its risks as always. Proceed with caution! Community Contribution SpartanProtocol at is at its core a community driven and led project. In this vein, the more contributors the better. There is a great opportunity for community members to contribute by making LP reward analysis tools etc. If you have an idea, share it in the community channels. Engage with the community and developers Where to find out all the latest updates or suggest improvements — get involved.

https://medium.com/spartanprotocol/bond-mint-on-spartan-protocol-75a0e7eb86ae

[]

2020-11-28 06:04:17.125000+00:00

['Binance Smart Chain', 'Defi', 'Liquidity Mining', 'Sparta']

Title BondMint Spartan ProtocolContent Bootstrapping Liquidity Initial SPARTA Token Distribution Summary BondMint another novel distribution idea Spartan Protocol community — continued discussion best press SPARTA token distribution BurnForSPARTA community contributor built tried new BondMint feature ‘Burn’ phase soon closed remaining token distribution allocation shifted ‘bond’ program Roughly 50M SPARTA SPARTA Distribution Phase 01 BurnForSPARTA missed quick recap unique idea used initial token distribution designed get SPARTA widely distributed firm hand many Binance Chain community ready BSC’s big push Bob deposit 1000 worth BNB burn DApp BNB ‘burnt’ sent specified ‘burn’ address essentially remove supply forever contract mint 1000 worth SPARTA sends Bob theory mean SPARTA absorbs value burnt asset giving baseline value holder won’t sell obviously lot nuance market market however burn phase successful many way Wide token distribution without resorting technique like ‘airdrops’ Rugpull resistant team developer premine private sale token Token price appreciation unfortunately fell short theory fairly solid 30c base token price value transfer proposition one user group receiving SPARTA zerovalue ‘airdrop’ fashion Short term wasn’t successful price action time tell continued development community showing strong support belief despite led many robust poductive discussion within community determining way continue distribution initial 100M SPARTA allocation Enter BondMint… SPARTA Distribution Phase 02 Bonding SPARTA BondMint v1 primarily testnet experiment initial idea way achieve two goal Complete initial token distribution Begin first push towards accelerating TVL Spartan Protocol V1 Scenario Bob deposit 1000 worth BNB DApp contract mint 1000 worth SPARTA spot price slippage asset 2000 worth added relevant Liquidity Pool SPARTABNB Pool LP token minted representing claim asset entering pool 50 LP token sent Bob stake DAO earn harvest reward redeem sellswap plea remaining 50 vested back Bob linearly 12 month period Sounds attractive right Double equity Bonders get back initial investment instantly release bonus cream top 12month period obvious issue concept bad actor abuse anything almost zero risk negatively impact token price testnet experimental purpose obvious simple way make anything 5050 symmetrical mint add pool without causing massive slippage imbalance pool smart contract contributor continued working code started experimenting testnet testnet testing contributor changed variable gave small allocation testing mainnet V1 Bug mainnet testing small amount SPARTA emitted 1043 5000000 allocation tester noticing bug due change variable created 75 expected SPARTABNB total asset leaving user 25 fewer asset 12 month Devs moved V2 pegged remaining 4998957 SPARTA contract recovered burnt later BondMint version BondMint v2 involved iterative change allow ‘burning’ token contract case upgrade issue also simple fix 5050 issue ratio trialled 2575 25 Bob 75 12 month quietly mainnet tiny SPARTA allocation testing went well period wider community caught piled wipe 5M SPARTA allocation pretty quickly — talking little 12 hour 9000 BNB committed liquidity pool Time effect put analysing bonder habit community feedback ensure V3 BondMint addressed concern next small test allocation Marketsell dump — 2575 ratio still wasn’t quite low enough steer bonders away either selling swapping existing SPARTA get BNB Bonding releasing existing 25 return allocation sellingswapping SPARTA portion rebonding remaining BNB V3 0100 0 Bob 100 12 month Pool price manipulation remained possible based existing TVL BNBSPARTA Pool game ‘spot price’ used calculate many SPARTA minted ‘bond’ Whale concentration making use flat spot price avoid slippage combat point V3 us ‘purchasing power’ rather spot price calculate SPARTA minted emulated visiting ‘swap’ page DApp pretending swap amount want bond Underneath input see ‘rate’ click ‘’ icon next see ‘rate slip’ underneath percentage shown represents much would emit le SPARTA V3 v V2 normal peer little affect end result anyone trying manipulate spot price get better ‘bond’ rate pay slippage fee twice attempting kind manipulation large slippage large fee paid liquidity pool reward liquidity provider theory also drive peer smaller ‘bonds’ decentralisation better distribution BondMint V3 Three token enabled mainnet community testing small 25M SPARTA allocation feedback Remember whilst mainnet still experimental come risk always Proceed caution BNB BUSD USDT enabled small 25M SPARTA test allocation V3 scenario Bob sends 1000 bond contract 1000 worth SPARTA minted swap price price 2000 worth asset get locked SPARTABNB pool 0 go Bob straight away 100 vested Bob 12 month claim often like calculated every second like harvest feature V1 Allocation Contract Recovery V3 implement lesson learnt throughout testing feedback previous campaign seek starting allocation 25 million SPARTA Remember 4998957 SPARTA locked V1 contract team written contract allocate V3 testing campaign allow larger testing base increase maturity program Remember whilst mainnet still experimental come risk always Proceed caution Community Contribution SpartanProtocol core community driven led project vein contributor better great opportunity community member contribute making LP reward analysis tool etc idea share community channel Engage community developer find latest update suggest improvement — get involvedTags Binance Smart Chain Defi Liquidity Mining Sparta

Introducing ACryptoS Vaults

We’ve been working on a new project called ACryptoS Vaults, which is essentially a Yearn clone on Binance Smart Chain combined with SushiSwap farming mechanics. The project is less than 2 weeks old, and we have been testing and improving it within our small telegram group. We now feel it’s ready to be shared a bit more widely. Automating yield farming We’ve currently got 7 Vaults farming on PancakeSwap where you can deposit CAKE or Cake LP tokens, and the Vault will farm and compound CAKE for you, automatically swapping the farmed CAKE for Cake LP tokens when necessary. Concurrently farming ACS Depositing in the Vaults will also allow you to stake the Vault LP tokens in our Farms and farm our native token ACS. That means liquidity providers can earn both the yield from PancakeSwap, which is compounded in the Vault, and the ACS yield from our Farms. Sharing a stake in the protocol By distributing ACS via our farms, we share a stake in the protocol with our liquidity providers. ACS can be staked in our ACS Vault to earn a share of rewards and fees. Sustainable tokenomics Our tokenomics and fees are designed to encourage long term provision of liquidity and staking of ACS. ~23.254% of daily ACS emissions and almost all fees are used to buy back ACS and/or are distributed directly to ACS stakers in the ACS Vault. The fee structure does mean that short term stakers will most likely have a 0 or even slightly negative return, so do review our docs carefully before depositing, and there are links in the app showing the relevant fees as well. Risk warning We’re a brand new project and ACS is volatile and extremely inflationary at this stage. Do carefully review the Security & Risks section of our docs as well as DYOR before proceeding. Ready to give us a try? https://app.acryptos.com/

https://medium.com/acryptos/introducing-acryptos-vaults-4445c07c2c3f

['X']

2020-11-14 05:55:03.634000+00:00

['Binance Smart Chain', 'Defi', 'Yield Farming', 'Bsc', 'Pancakeswap']

Title Introducing ACryptoS VaultsContent We’ve working new project called ACryptoS Vaults essentially Yearn clone Binance Smart Chain combined SushiSwap farming mechanic project le 2 week old testing improving within small telegram group feel it’s ready shared bit widely Automating yield farming We’ve currently got 7 Vaults farming PancakeSwap deposit CAKE Cake LP token Vault farm compound CAKE automatically swapping farmed CAKE Cake LP token necessary Concurrently farming ACS Depositing Vaults also allow stake Vault LP token Farms farm native token ACS mean liquidity provider earn yield PancakeSwap compounded Vault ACS yield Farms Sharing stake protocol distributing ACS via farm share stake protocol liquidity provider ACS staked ACS Vault earn share reward fee Sustainable tokenomics tokenomics fee designed encourage long term provision liquidity staking ACS 23254 daily ACS emission almost fee used buy back ACS andor distributed directly ACS stakers ACS Vault fee structure mean short term stakers likely 0 even slightly negative return review doc carefully depositing link app showing relevant fee well Risk warning We’re brand new project ACS volatile extremely inflationary stage carefully review Security Risks section doc well DYOR proceeding Ready give u try httpsappacryptoscomTags Binance Smart Chain Defi Yield Farming Bsc Pancakeswap

Nyacademy: Unrugged // How Yield Farming Contract Works

Nyacademy: Unrugged // How Yield Farming Contract Works And… The Case of the ‘Missing’ Tokens (💧x🐱) This episode, we are going to take a look at the popular yield farming contract UniswapRewardsFactory and the SmartChef (somewhat ‘MasterChef’) contract. If you follow us close enough, you will realize that we had a recent collaboration with Bliquid ($BLIQ) on a Nyanchpool which got delayed by a day. We’ve never had such issues before, so something interesting must have happened. We thought that we could go through the yield farming contracts and also add in a twist of the recent BLIQ token encounters. So we’re going to share our experience on hosting a field farm with self-burning mechanism (like BLIQ) using UniswapRewardsFactory contract. This probably won’t affect you if you’re not using the UniswapRewardsFactory. What is UniswapRewardsFactory UniswapRewardsFactory is a reward distribution contract (yield farming) pioneered by Uniswap. It is a super strict contract that absolutely makes sure that the predefined expected rewards are exactly the same as the actual rewards. If you follow how we do our collaboration transactions. We don’t ask our partners to send their tokens to our Deployer. The reason is that Deployers are usually EOA (just a wallet account) so anyone (like the host, aka us) with the keys can simply steal the huge amount of tokens sent by the partners. Here’s a look at PancakeSwap’s Deployer. Could you imagine how much trust is needed for someone to send that many tokens to an EOA account? Of course, PancakeSwap is very trustworthy, but we can’t speak the same for others (like us 🐱). So we’re preventing you.. from us. We usually ask our partners to send the tokens directly to the RewardsFactory contract. This way, we can’t steal the tokens. So.. Why was the BLIQ Nyanchpool delayed? It’s solely mathematical. The interesting thing about BLIQ token is that it has a self-burning mechanism whenever someone triggers a transfer of the token. In short, 6% would be taken out of the sent amount, leaving 94% at the destination. Is that a big deal? Apparently for us, huge deal. If you’re hosting a normal ERC20 token, there won’t be such issues at all. How Does the UniswapRewardsFactory Work? Two contracts are in the picture. The UniswapRewardsFactory (referred to as Factory) and the UniswapRewards (referred to as Reward). We are distributing 21 BLIQ over 7 days on our Nyanchpool. Bliquid sends 21 BLIQ to Factory Nyanswop triggers ‘notifyRewards’ function on Factory Factory sends 21 BLIQ to Reward Reward calculates predefined expected rewardRate against actual rewardRate, and make sure the expected rewardRate is ≤ actual rewardRate (to ensure that it has sufficient BLIQ to pay out to stakers) If all passes, the pool will start. There is no interaction with the Reward contract. We only interact with the Factory contract. RewardRate is defined as BLIQ balance / 604800 (7 days in seconds). So expected RewardRate is fixed at 21 / 604800, which is 0.000034722. And actual RewardRate depends on the BLIQ balance of the Rewards contract divded by 604800, which cannot be calculated now. Ideally it should be exactly the same. And you thought so.. *note that the real representation of 21 is 21*10¹⁸ (18 zeros), we’re shortening it to just 21 for readability Introducing RewardsFactory (and Self-Burning Token) Step 1 — Receive 21 BLIQ in Factory Contract 😸 It starts with Bliquid sending the agreed 21 BLIQ to the Factory contract. Cheers. We’re set. Let’s call the deployment function~ Step 2 — Trigger notifyRewards function in Factory Contract 🐱 Our first deployment attempt was hit with an error. The error simply means that a transfer has failed. We failed at ‘Step 1’. Though we’re pretty sure we saw BscScan showing that the Factory contract has 21 BLIQ.. but is it really 21 BLIQ? ‘Thanks’ BscScan, you lied. That was the moment we recalled that BLIQ has a self-burning mechanism. The awesome team at Bliquid reacted instantly and sent over a small bit of tokens to make it 21. So we try again, we trigger ‘Step 2’ again. Step 3 — Reward to Receive 21 BLIQ from Factory Contract 😾 This error is new. It is something we haven’t encountered before even after hosting 4 projects on Nyanchpool. So we went to find which code threw this error. Step 4 — Pass Expected vs Actual rewardRate Integrity Check 🙀 We made it through ‘Step 3’ but failed at ‘Step 4’. At ‘Step 3’, Factory sends the BLIQ to Reward so by right it shouldn’t fail. Here we recall that the expected rewardRate is fixed which is 0.000034722 (21 / 604800), so the only variable is the actual balance rewardRate (line 588). So something clicked. Since the transferred BLIQ will lose 6% when it reaches the Reward contract, we’ll need our Factory to have at least 22.3404255319 BLIQ (21 / 0.94), so that we will end up with at least 21 BLIQ at Reward after the transfer from Factory. So.. we got Bliquid (thanks again) to send us a bit more BLIQ. Now, we have slighly more than 22.3404255319 BLIQ in our Factory contract so that should finally work. But we seem to hit the same issue again. Seems like we somehow still don’t have 21 BLIQ to pass ‘Step 4’. The real cause might not be as what we thought. We could, logically speaking, send more BLIQ to Factory contract, or dig out the real cause. We chose to believe in our previous judgements, and dig into the possibilities. And we found something that we overlooked: In the Factory contract, it will always and only send the predefined rewardAmount which is 21. Sending more than 21 BLIQ doesn’t help as the contract will only send 21 BLIQ. So that means we’re always going to get 19.74 BLIQ (94% of 21) in the Reward contract no matter what. So does that means that the 21 BLIQ is permanently ‘stuck’ in the Factory contract and that we’re never ever able to host projects with self-burning mechanism? require(rewardRate <= balance.div(rewardsDuration), "Provided reward too high"); After spending some time trying to balance this equation.. Yes, by the looks of it, it’s pretty much not possible unless we make modifications to the contract in the future. Looks like the 21 BLIQ is stuck. So we disappointedly posted to stop the BLIQ Nyanchpool. *inserts sad cat* 😿 After spending the whole night looking for possibilities to transfer out the 21 BLIQ. We found a workaround to make the BLIQ Nyanchpool happen. After ‘Step 3’ (sending 21 BLIQ from Factory to Reward contract), the actual rewardRate’s balance is calculated by rewardsToken.balanceOf(address(this)) , which means the ‘current’ BLIQ in the Reward contract, which is ‘currently’ 19.74 BLIQ. So.. what if we send an extra 1.26 BLIQ to our Rewards contract, will we hit 21 BLIQ at this line? Yes nya~ it worked. From the ‘Tokens Tranferred’, you can see that only 19.74 BLIQ got sent to our Reward contract (as expected, 94%), and the rest was ‘burn’ away. Based on BLIQ’s token behavior, 1% will be burned, 5% will be sent back to the BLIQ contract for some processing. And… we’re back~ That’s how the UniswapRewardsFactory works for rewards distribution. Hopefully that gives you the basic know-how on how it actually works. Having such knowledge is very beneficial especially when you’re checking on a newly designed contract. Are Other Farming Contracts Able to Support Self-Burning Tokens As-is? For yield farming contracts, we should always look at how the contract determines the start and end of the farming period. Let’s take a quick look at PancakeSwap’s SmartChef contract. What’s Initialized When the Contract is Deployed? For starters, we should always look at the constructor first. The contract seems pretty standard for yield farming contract. Mainly, it initalizes the start and end of the farming period. For SmartChef, the fixed rewardPerBlock is also initialized here. Similarly, UniswapRewards contract constructor initializes the same thing. The difference is there UniswapRewards is created by triggering a function in the UniswapRewardsFactory. How Does It Determines Start and End of Distribution? For UniswapRewards contract, there is check (mentioned in the BLIQ scenario): require(rewardRate <= balance.div(rewardsDuration), "Provided reward too high"); It is done upon the triggering of the start of the rewards distribution (notifyRewards). So we can look at how SmartChef determines that a reward distribution has started. One unique aspect of the ‘MasterChef’ style contract is the function to calculate the rewards for the users, usually named as the updatePool function. Line 803 determines if a reward distribution has started. If the current time is before the predefined starting block, this function will exit immediately. Line 812 calculates the CAKE reward for for user based on the percentage ownership of the pool multiplied by a predefined rewardPerBlock rate. So how does the SmartChef contract determines the end of a reward distribution phase? For this, we can follow the bonusEndBlock variable initialized in the constructor. That will lead to just one part of the contract, the getMultiplier function: If you prefer to the previous image, you can see that the _from is the startBlock and _to is the current block number. _from will keep on getting updated with the current block number (check previous image, Line 814). There are two places in the code that uses this function, and both made checks to ensure that block.number is always > than pool.lastRewardBlock . Of course, these values will change over time, but we’re just looking at this point for starting and ending point of view. We’re looking for how it determines ending, so 0 seems to be decent candidate. So the code will hit at Line 780 when the lastRewardBlock eventually becomes ≥ than the bonusEndBlock , as it will keep updating to become the value of current number. So, in a way, the SmartChef contract doesn’t end, it just reduces the rewards to 0. Caveats There’s no strict check on whether the SmartChef is able to distribute the predefined rewards when the rewards distribution starts. You have to really trust the owner to do the right thing. The UniswapRewards contract, however, checks that before allowing the reward distribution to commerce. That also means that SmartChef, technically speaking, could start the rewards distribution even without having 100% of the pre-stated reward token amount. Consider this following: SmartChef is to distribute 1000 NYA tokens over 100 blocks. SmartChef is initialized with: startBlock = 500, endBlock = 600, rewardsPerBlock = 10 So 10 NYA would be distributed every block from 500 to 600. But it doesn’t guarantee that it is able to distribute all of it at any point of time (especially during the start). The owner might deposit only 800 NYA at start, then add another 200 NYA along the way (between block 500 and 600). That is indeed flexible. Unlike the UniswapRewards contract, which is very strict on these. Though it prevents mistakes and middle-man from rug-pulling. It’s strictness defined it’s safetyness and also it’s rigidness (on the good side). Most people simply avoid using this contract for yield farming because of it’s strictness and complication, but we at Nyanswop totally love it. Both has their good and bad points. It really depends on what you’re looking for. Take Away? If you’re sending with ‘self-burning’ tokens, make sure to calculate the starting amount correctly by taking into account of the end state. For you to send 21 BLIQ, with 6% burn rate, you have to send 21/0.94 BLIQ. If you’re dealing with tokens with ‘overriden’ methods (especially if it belongs to the official ERC20 interfaces), do check if the end state is what you expected. For our case, BLIQ token has a burning mechanism for the ‘transfer’ method and we didn’t expect to not receive 21 BLIQ. If you’re using contracts that are very strict on the data integrity, do take extra note when dealing with tokens with unique personalities. If a transaction fails, there’s no need to repeatedly send the same thing because it is bound to fail. Do something different, or reach out to the support team of the Dapp that you’re using (including us nya~ 🐱) We like Uniswap’s RewardsFactory’s strictness as it maintains the integrity of the data. So we’ll not modify our contract to fit special tokens, at least for now. Moving On After this interesting issue. We now require all partners to do a trial-run with us in the Testnet if your token has certain methods overridden (especially transfer method). We thank Bliquid for being very responsive in reacting to our request, and also explaining in-depth on the burning mechanism of the BLIQ token. — Nyan Dev 🐱 Follow us on Twitter and Telegram for the latest updates. Twitter: https://twitter.com/nyanswop Telegram: https://t.me/Nyanswop Telegram (Indonesian): https://t.me/Nyanswop_ID Telegram (Announcements): https://t.me/Nyanswop_ANN

https://medium.com/@nyanswop/nyacademy-unrugged-how-yield-farming-contract-works-647501e6f82e

[]

2020-11-28 15:50:16.453000+00:00

['Blockchain', 'Cryptocurrency', 'Ethereum', 'Binance Smart Chain']

Title Nyacademy Unrugged Yield Farming Contract WorksContent Nyacademy Unrugged Yield Farming Contract Works And… Case ‘Missing’ Tokens 💧x🐱 episode going take look popular yield farming contract UniswapRewardsFactory SmartChef somewhat ‘MasterChef’ contract follow u close enough realize recent collaboration Bliquid BLIQ Nyanchpool got delayed day We’ve never issue something interesting must happened thought could go yield farming contract also add twist recent BLIQ token encounter we’re going share experience hosting field farm selfburning mechanism like BLIQ using UniswapRewardsFactory contract probably won’t affect you’re using UniswapRewardsFactory UniswapRewardsFactory UniswapRewardsFactory reward distribution contract yield farming pioneered Uniswap super strict contract absolutely make sure predefined expected reward exactly actual reward follow collaboration transaction don’t ask partner send token Deployer reason Deployers usually EOA wallet account anyone like host aka u key simply steal huge amount token sent partner Here’s look PancakeSwap’s Deployer Could imagine much trust needed someone send many token EOA account course PancakeSwap trustworthy can’t speak others like u 🐱 we’re preventing u usually ask partner send token directly RewardsFactory contract way can’t steal token BLIQ Nyanchpool delayed It’s solely mathematical interesting thing BLIQ token selfburning mechanism whenever someone trigger transfer token short 6 would taken sent amount leaving 94 destination big deal Apparently u huge deal you’re hosting normal ERC20 token won’t issue UniswapRewardsFactory Work Two contract picture UniswapRewardsFactory referred Factory UniswapRewards referred Reward distributing 21 BLIQ 7 day Nyanchpool Bliquid sends 21 BLIQ Factory Nyanswop trigger ‘notifyRewards’ function Factory Factory sends 21 BLIQ Reward Reward calculates predefined expected rewardRate actual rewardRate make sure expected rewardRate ≤ actual rewardRate ensure sufficient BLIQ pay stakers pass pool start interaction Reward contract interact Factory contract RewardRate defined BLIQ balance 604800 7 day second expected RewardRate fixed 21 604800 0000034722 actual RewardRate depends BLIQ balance Rewards contract divded 604800 cannot calculated Ideally exactly thought note real representation 21 2110¹⁸ 18 zero we’re shortening 21 readability Introducing RewardsFactory SelfBurning Token Step 1 — Receive 21 BLIQ Factory Contract 😸 start Bliquid sending agreed 21 BLIQ Factory contract Cheers We’re set Let’s call deployment function Step 2 — Trigger notifyRewards function Factory Contract 🐱 first deployment attempt hit error error simply mean transfer failed failed ‘Step 1’ Though we’re pretty sure saw BscScan showing Factory contract 21 BLIQ really 21 BLIQ ‘Thanks’ BscScan lied moment recalled BLIQ selfburning mechanism awesome team Bliquid reacted instantly sent small bit token make 21 try trigger ‘Step 2’ Step 3 — Reward Receive 21 BLIQ Factory Contract 😾 error new something haven’t encountered even hosting 4 project Nyanchpool went find code threw error Step 4 — Pass Expected v Actual rewardRate Integrity Check 🙀 made ‘Step 3’ failed ‘Step 4’ ‘Step 3’ Factory sends BLIQ Reward right shouldn’t fail recall expected rewardRate fixed 0000034722 21 604800 variable actual balance rewardRate line 588 something clicked Since transferred BLIQ lose 6 reach Reward contract we’ll need Factory least 223404255319 BLIQ 21 094 end least 21 BLIQ Reward transfer Factory got Bliquid thanks send u bit BLIQ slighly 223404255319 BLIQ Factory contract finally work seem hit issue Seems like somehow still don’t 21 BLIQ pas ‘Step 4’ real cause might thought could logically speaking send BLIQ Factory contract dig real cause chose believe previous judgement dig possibility found something overlooked Factory contract always send predefined rewardAmount 21 Sending 21 BLIQ doesn’t help contract send 21 BLIQ mean we’re always going get 1974 BLIQ 94 21 Reward contract matter mean 21 BLIQ permanently ‘stuck’ Factory contract we’re never ever able host project selfburning mechanism requirerewardRate balancedivrewardsDuration Provided reward high spending time trying balance equation Yes look it’s pretty much possible unless make modification contract future Looks like 21 BLIQ stuck disappointedly posted stop BLIQ Nyanchpool insert sad cat 😿 spending whole night looking possibility transfer 21 BLIQ found workaround make BLIQ Nyanchpool happen ‘Step 3’ sending 21 BLIQ Factory Reward contract actual rewardRate’s balance calculated rewardsTokenbalanceOfaddressthis mean ‘current’ BLIQ Reward contract ‘currently’ 1974 BLIQ send extra 126 BLIQ Rewards contract hit 21 BLIQ line Yes nya worked ‘Tokens Tranferred’ see 1974 BLIQ got sent Reward contract expected 94 rest ‘burn’ away Based BLIQ’s token behavior 1 burned 5 sent back BLIQ contract processing And… we’re back That’s UniswapRewardsFactory work reward distribution Hopefully give basic knowhow actually work knowledge beneficial especially you’re checking newly designed contract Farming Contracts Able Support SelfBurning Tokens Asis yield farming contract always look contract determines start end farming period Let’s take quick look PancakeSwap’s SmartChef contract What’s Initialized Contract Deployed starter always look constructor first contract seems pretty standard yield farming contract Mainly initalizes start end farming period SmartChef fixed rewardPerBlock also initialized Similarly UniswapRewards contract constructor initializes thing difference UniswapRewards created triggering function UniswapRewardsFactory Determines Start End Distribution UniswapRewards contract check mentioned BLIQ scenario requirerewardRate balancedivrewardsDuration Provided reward high done upon triggering start reward distribution notifyRewards look SmartChef determines reward distribution started One unique aspect ‘MasterChef’ style contract function calculate reward user usually named updatePool function Line 803 determines reward distribution started current time predefined starting block function exit immediately Line 812 calculates CAKE reward user based percentage ownership pool multiplied predefined rewardPerBlock rate SmartChef contract determines end reward distribution phase follow bonusEndBlock variable initialized constructor lead one part contract getMultiplier function prefer previous image see startBlock current block number keep getting updated current block number check previous image Line 814 two place code us function made check ensure blocknumber always poollastRewardBlock course value change time we’re looking point starting ending point view We’re looking determines ending 0 seems decent candidate code hit Line 780 lastRewardBlock eventually becomes ≥ bonusEndBlock keep updating become value current number way SmartChef contract doesn’t end reduces reward 0 Caveats There’s strict check whether SmartChef able distribute predefined reward reward distribution start really trust owner right thing UniswapRewards contract however check allowing reward distribution commerce also mean SmartChef technically speaking could start reward distribution even without 100 prestated reward token amount Consider following SmartChef distribute 1000 NYA token 100 block SmartChef initialized startBlock 500 endBlock 600 rewardsPerBlock 10 10 NYA would distributed every block 500 600 doesn’t guarantee able distribute point time especially start owner might deposit 800 NYA start add another 200 NYA along way block 500 600 indeed flexible Unlike UniswapRewards contract strict Though prevents mistake middleman rugpulling It’s strictness defined it’s safetyness also it’s rigidness good side people simply avoid using contract yield farming it’s strictness complication Nyanswop totally love good bad point really depends you’re looking Take Away you’re sending ‘selfburning’ token make sure calculate starting amount correctly taking account end state send 21 BLIQ 6 burn rate send 21094 BLIQ you’re dealing token ‘overriden’ method especially belongs official ERC20 interface check end state expected case BLIQ token burning mechanism ‘transfer’ method didn’t expect receive 21 BLIQ you’re using contract strict data integrity take extra note dealing token unique personality transaction fails there’s need repeatedly send thing bound fail something different reach support team Dapp you’re using including u nya 🐱 like Uniswap’s RewardsFactory’s strictness maintains integrity data we’ll modify contract fit special token least Moving interesting issue require partner trialrun u Testnet token certain method overridden especially transfer method thank Bliquid responsive reacting request also explaining indepth burning mechanism BLIQ token — Nyan Dev 🐱 Follow u Twitter Telegram latest update Twitter httpstwittercomnyanswop Telegram httpstmeNyanswop Telegram Indonesian httpstmeNyanswopID Telegram Announcements httpstmeNyanswopANNTags Blockchain Cryptocurrency Ethereum Binance Smart Chain

GFI Presale Whitelist

GFI Presale Whitelist Dear Global Finance Community, Since officially launching our project and team has experienced overwhelming support from the community. We would like to take this opportunity to thank every single person who have helped us grow and spread the word through Telegram, Twitter, and various other outlets. We will open the Whitelist for our Presale and this article will serve as a way to answer some questions that you may wish to know. As always, please feel free to join our official Telegram channel https://t.me/globalfinance_io where our admins are always on standby to answer any questions you may have. About Global Finance & GFI Token : Global Finance is a DeFi Platform for everyone Staking, Liquidity Mining, Yield farming, Swap and many more. More details : https://docs.globalfinance.io When will the whitelist begin? 1st Dec 2020 10AM UTC How long will the whitelist stay open for? The whitelist will remain open for 7 days, ending on 7th Dec at 10AM UTC or when we fill the maximum amount of applicants, whichever occurs first How will you structure the Presale? We will structure the Presale into a possible two rounds. 1st Round 10,000 GFI Price : 1 GFI= 0.25 BNB Presale start : 10th Dec — 17th Dec 2020 — We will launch our 1st Round Presale for all Whitelisted members with a Min/Max cap 2nd Round 15,000 GFI Price : 1 GFI = 0.33 BNB — If any GFI is left over after Round 1, we will open a pool in bounce finance to give a chance everyone can contribute Listing Price : 1 GFI = 0.5 BNB exchange listing as soon as the presale ends What are the individual caps? 1st Round : Min Cap — 1 BNB Max Cap — 50 BNB 2nd Round : No Minumum Cap Can I contribute again on Round 2 if I already contributed on Round 1? Yes. Whitelisted members who managed to contribute on Round 1 will also be able to contribute on Round 2. What happens if I send my funds in after the hardcap has been reached? Any funds received once our hardcap has been reached will be refunded after the Presale has finished. Where will I find the Wallet contribution address? We will inform the wallet address to whitelisted participants before the Presale start, via official email [email protected] [email protected] Join Whitelist : https://forms.gle/naK1VVDjj5eewXb86 If you feel that your question has not been answered in this article, please contact our community management team by following the link below! We hope you stay with us, in the future we will be uploading more news and progress with the development of the GFI Platform, including new partnerships, and general work on the Ecosystem in progress. Follow Our Social Media Official Website : https://globalfinance.io Twitter : https://twitter.com/globalfinanceio Telegram group Chat : https://t.me/globalfinance_io Telegeram Announcement : https://t.me/globalfinance_ann Github : https://github.com/globalfinanceio

https://medium.com/@globalfinance/gfi-presale-whitelist-ff98f5603ff

['Global Finance']

2020-12-07 23:21:13.359000+00:00

['Presale', 'Defi', 'Staking', 'Yield Farming', 'Binance Smart Chain']

Title GFI Presale WhitelistContent GFI Presale Whitelist Dear Global Finance Community Since officially launching project team experienced overwhelming support community would like take opportunity thank every single person helped u grow spread word Telegram Twitter various outlet open Whitelist Presale article serve way answer question may wish know always please feel free join official Telegram channel httpstmeglobalfinanceio admins always standby answer question may Global Finance GFI Token Global Finance DeFi Platform everyone Staking Liquidity Mining Yield farming Swap many detail httpsdocsglobalfinanceio whitelist begin 1st Dec 2020 10AM UTC long whitelist stay open whitelist remain open 7 day ending 7th Dec 10AM UTC fill maximum amount applicant whichever occurs first structure Presale structure Presale possible two round 1st Round 10000 GFI Price 1 GFI 025 BNB Presale start 10th Dec — 17th Dec 2020 — launch 1st Round Presale Whitelisted member MinMax cap 2nd Round 15000 GFI Price 1 GFI 033 BNB — GFI left Round 1 open pool bounce finance give chance everyone contribute Listing Price 1 GFI 05 BNB exchange listing soon presale end individual cap 1st Round Min Cap — 1 BNB Max Cap — 50 BNB 2nd Round Minumum Cap contribute Round 2 already contributed Round 1 Yes Whitelisted member managed contribute Round 1 also able contribute Round 2 happens send fund hardcap reached fund received hardcap reached refunded Presale finished find Wallet contribution address inform wallet address whitelisted participant Presale start via official email supportglobalfinanceio Presaleglobalfinanceio Join Whitelist httpsformsglenaK1VVDjj5eewXb86 feel question answered article please contact community management team following link hope stay u future uploading news progress development GFI Platform including new partnership general work Ecosystem progress Follow Social Media Official Website httpsglobalfinanceio Twitter httpstwittercomglobalfinanceio Telegram group Chat httpstmeglobalfinanceio Telegeram Announcement httpstmeglobalfinanceann Github httpsgithubcomglobalfinanceioTags Presale Defi Staking Yield Farming Binance Smart Chain

bStable needs you 🦸‍♂️ 🧑‍✈️🧑‍🔬🧑‍💻👨‍🌾

bStable needs you 🦸‍♂️ 🧑‍✈️🧑‍🔬🧑‍💻👨‍🌾 Become an active member of bStable as we take steps towards community governance! Hi bStable community and future bStable community leaders! 👋 As you know, bStable is a decentralized finance protocol that enables users to make swaps between BSC-based stablecoins and to earn interest on their funds by providing liquidity to multi-stablecoin liquidity pools. With a commitment to its goal of community governance, bStable is looking for community ambassadors and beta-testers who are willing to get down and dirty with bStable’s swaps and liquidity pools. If you are ready to actively participate in and grow the bStable community, and help improve bStable’s product, we’d love to have you join our Discord and Telegram communities. As bStable moves closer to launch and takes its first steps towards community governance, we are looking for community members who are knowledgeable of DeFi and who aspire to be leaders in the community. 💰🗳️ Once the bStable governance token is issued, Community Ambassadors will receive rewards in the token and will be encouraged to become even bigger voices in the future governance of bStable through the creation of proposals and participation in weighted voting (based on token ownership). 🔖 In order to register your interest in becoming a future Community Ambassador, please tell us a little bit more about you and what you think of bStable by filling out this form! We look forward to working with you! 🤝

https://medium.com/@bstable/bstable-needs-you-%EF%B8%8F-%EF%B8%8F-951f8212094f

[]

2020-11-20 03:06:17.727000+00:00

['Defi', 'Binance Smart Chain', 'Stablecoin', 'Blockchain', 'Cryptocurrency']

Title bStable need 🦸‍♂️ 🧑‍✈️🧑‍🔬🧑‍💻👨‍🌾Content bStable need 🦸‍♂️ 🧑‍✈️🧑‍🔬🧑‍💻👨‍🌾 Become active member bStable take step towards community governance Hi bStable community future bStable community leader 👋 know bStable decentralized finance protocol enables user make swap BSCbased stablecoins earn interest fund providing liquidity multistablecoin liquidity pool commitment goal community governance bStable looking community ambassador betatesters willing get dirty bStable’s swap liquidity pool ready actively participate grow bStable community help improve bStable’s product we’d love join Discord Telegram community bStable move closer launch take first step towards community governance looking community member knowledgeable DeFi aspire leader community 💰🗳️ bStable governance token issued Community Ambassadors receive reward token encouraged become even bigger voice future governance bStable creation proposal participation weighted voting based token ownership 🔖 order register interest becoming future Community Ambassador please tell u little bit think bStable filling form look forward working 🤝Tags Defi Binance Smart Chain Stablecoin Blockchain Cryptocurrency

Alpaca City is Landing on Binance Smart Chain with 5,000 Alpaca NFTs Airdrop

Alpaca City was launched in late October, 2020. Ever since the launch, we’ve been grateful for the support from our community. Over the last few weeks, Alpaca City has achieved unprecedented growth with the following milestones: Ranked №1 on Dapp.com & Dapp Review Gaming category according 24h transaction volume Ranked №3 on Open Sea collectibles category and №9 overall based on 7-day NFT trading volume In total of 500,000 ALPA (~150K USD) were burned through breeding fees in the past 2 weeks We’ve had a lot of feedback regarding the high gas fee on the Ethereum network. While we are working on ways to reduce gas spending by optimizing our smart contract, we see the needs to explore different options that can reduce transaction cost significantly. We are now excited to work with Binance Smart Chain to solve this problem. Alpaca City will be live on Binance Smart Chain on December 3rd, 2020 at 6am PST with 5,000 Alpaca NFTs airdrop. We are also thrilled to announce official partnerships with other notable projects to celebrate the launch on Binance Smart Chain. Details will be announced at a later time. Join Now to Get a Chance to Win 5,000 Alpaca NFTs Airdrop

https://medium.com/alpacacity/alpaca-city-is-landing-on-binance-smart-chain-with-5-000-alpaca-nfts-airdrop-26ba8f0f29c3

['Alpaca City Team']

2020-12-01 12:01:08.817000+00:00

['Nft', 'Collectibles', 'Binance Smart Chain', 'Defi']

Title Alpaca City Landing Binance Smart Chain 5000 Alpaca NFTs AirdropContent Alpaca City launched late October 2020 Ever since launch we’ve grateful support community last week Alpaca City achieved unprecedented growth following milestone Ranked №1 Dappcom Dapp Review Gaming category according 24h transaction volume Ranked №3 Open Sea collectible category №9 overall based 7day NFT trading volume total 500000 ALPA 150K USD burned breeding fee past 2 week We’ve lot feedback regarding high gas fee Ethereum network working way reduce gas spending optimizing smart contract see need explore different option reduce transaction cost significantly excited work Binance Smart Chain solve problem Alpaca City live Binance Smart Chain December 3rd 2020 6am PST 5000 Alpaca NFTs airdrop also thrilled announce official partnership notable project celebrate launch Binance Smart Chain Details announced later time Join Get Chance Win 5000 Alpaca NFTs AirdropTags Nft Collectibles Binance Smart Chain Defi

Creative Ways to Cut Wedding Costs

Creative Ways to Cut Wedding Costs The overall cost of weddings is spiraling out of control. According to CostofWedding.com, the average cost is close to twenty-seven thousand dollars. That is the cost of a vehicle or a down payment on a house! There are ways to cut costs without having the affair look or feel cheap. Off Peak Dates The most popular wedding dates are between late April and early September. Venue pricing for those months is at the highest it will be all year. It is also difficult to find a date that is not booked up in some places. Consider getting married in March or October. The costs will be lower and booking will be easier. Saving Money on Flowers There are a few ways to save money on wedding flowers and still have beautiful bouquets. One way is to make the boutonnieres yourself. They are easy and inexpensive to make and no one really pays close attention to them anyway. They are a nice detail, but do not have to be perfect or professionally done. Depending on how many ushers are in the wedding party, that savings can add up to quite a significant amount. Using seasonal flowers will also save money without cutting corners. Florists that specialize in floral arrangements and bouquets for weddings, such as Marigold Flower Co, prefer to use seasonal flowers because they are fresh, fragrant, and vibrant. Professionals will be able to recommend which flowers will be in season for the wedding date. Seasonal Wedding flowers Tampa FL will look much different in March than they will in August. Keep the Guest List Relevant So many couples get caught up in inviting long lost family members at the request of their parents. That makes very little sense. Why pay for meals to feed the family of a second cousin you have not seen in twenty years? Plan the guest list based on who you as a couple want to see at the wedding. No one has to approve the list but the bride and groom. If the couple simply want close family and a few friends there, costs will not be tens of thousands of dollars. Listen to input, be polite, but be selfish when it comes to planning the actual wedding day. Do not start married life in debt to please all the relatives. If parents want to pay for the wedding, then consider their requests. If expenses are coming out of the pocket of the bride and groom, invite only those people who are special.

https://medium.com/@mstepanova142/creative-ways-to-cut-wedding-costs-9ce6bb626bff

['Tristan Wynyard']

2017-11-20 10:58:00.716000+00:00

['Weddings', 'Flowers']

Title Creative Ways Cut Wedding CostsContent Creative Ways Cut Wedding Costs overall cost wedding spiraling control According CostofWeddingcom average cost close twentyseven thousand dollar cost vehicle payment house way cut cost without affair look feel cheap Peak Dates popular wedding date late April early September Venue pricing month highest year also difficult find date booked place Consider getting married March October cost lower booking easier Saving Money Flowers way save money wedding flower still beautiful bouquet One way make boutonniere easy inexpensive make one really pay close attention anyway nice detail perfect professionally done Depending many usher wedding party saving add quite significant amount Using seasonal flower also save money without cutting corner Florists specialize floral arrangement bouquet wedding Marigold Flower Co prefer use seasonal flower fresh fragrant vibrant Professionals able recommend flower season wedding date Seasonal Wedding flower Tampa FL look much different March August Keep Guest List Relevant many couple get caught inviting long lost family member request parent make little sense pay meal feed family second cousin seen twenty year Plan guest list based couple want see wedding one approve list bride groom couple simply want close family friend cost ten thousand dollar Listen input polite selfish come planning actual wedding day start married life debt please relative parent want pay wedding consider request expense coming pocket bride groom invite people specialTags Weddings Flowers

Here’s How You Can Choose the Perfect Wedding Bouquet

Here’s How You Can Choose the Perfect Wedding Bouquet Time to bring your floral invitation to life, step up in your wedding planning and choose the impeccable wedding bouquet. On your special day, you’re the center of attraction. But there’s something that is more attractive than the couple themselves. These little connoisseurs of enchanting fragrance enthrall the guests to the core. So it is imperative to make the right choice and pick the best floral bouquet even it is not a spring wedding! At 123WeddingCards, we present you the go-to guide for your selection process. 1. Selecting the color: The main factor that connects the accessories with the aura is the color of the decor. To make sure that you pick the perfect color, we bring to you some guiding steps: a. Select the color that falls in your wedding color scheme If your wedding decor is in tones of lilac and white, it’ll pair up elegantly with petite bouquets of purple Hydrangea — a bloom flower with purple leaves wherein, the purple fades into a scintillating shade of white twinning with your decor and forming a beautiful centerpiece. They are royal embellishments on arches and pillars. You can even opt for replicas of flowers printed in your floral invitations. b. Contrast works magic too. Wedding decor of a darker shade teams up with lighter accessories or vice versa and adds an attractive element to the wedding venue. A bright ‘red’ or ravishing ‘green’ decoration calls for a lighter shade of wedding flower bouquet. Long bouquets of yellow Gladiolus make up for a centerpiece that is soothing and graceful. c. Pair it with the bridal bouquet. For this, be sure that the color of the bridal bouquets and wedding bouquets is not the same. They should follow the same color family of reds, blues, greens or pinks but be distinctive.The star-like blue Agapanthus bouquets for the bridesmaid’s bouquets and oversized blue silk bouquets pair for the decor is pleasing to the eye and distinguishable! 2. Show your style through your flowers: Are you a trend-setter? Or are you someone who prefers lighter tones over blasting colors? Your wedding flower bouquets speak for your style, like floral wedding invitation. If you’re the bold one who kicks off things that hasn’t been done before, exotic flowers are the ideal match. Calla lily and Anthurium are worth giving a try. Strelitzia is an unknown beauty too. It’s an orange color blossom with thin long pointed leaves that vibe magically with an electric blue decor. If you prefer to go with the flow, our pick for you will be roses. They never grow old like rose floral invitations and coordinate with every decor style. With their refreshing fragrance enriching our nostrils long after they’re gone and a multitude of colors they’re available in, make them the best flowers! Carnations, White Lilies, Gardenias, Peonies and orchids grab a place in the list too! 3. Lighter than air, smaller than face. Once you’ve picked the colors and finalized the style, it’s time to select the weight and size of the bouquet. Bridesmaids’ bouquets should be lighter because they’ll hold them for a longer time. So, the ideal pick would be small, thin and long flowers. The long stems will be easier to hold. Buttercup bouquets with a single bloom will be perfect — they’ll be lighter because of only one bulb and look beautiful too! One bulb of Dahlia will make up for a bold pop against the otherwise soothing white gown. The wedding bouquets should be smaller so that they don’t hide the bridesmaids’ pretty faces or block the view of the guests if they’re used as centerpieces. Thus, lightweight bouquets win our hearts here as well. 4. Something about the wedding trends: Wedding trends dictate a major chunk of our romantic thinking. So let’s have a look at what’s trending apart from floral invitations! a. Ditching the ordinary: No more roses. Brides world over are experimenting with a trend-setting floral arrangement. Freesia or Lily of the Valley is becoming the new favorites. b. One flower army. Instead of opting for a bunch of flowers, brides are perfectly okay with only one floral bouquet. So, all the larger flowers out there, you’re on the list now! c. Bold is the new color. No more reds and whites. Brides world around are vouching for a color that is as fiery as their eyes. After the floral invitation, it’s wedding bouquets’ turn to be bolder. Richer shades and monochromes are all lighting the stage on fire! d. Back to tradition. When the world is talking about moving ahead, brides all over the world are stepping back to traditions. Greener, richer bouquets are in fashion once again! Visit our collection of all wedding invitations and choose your best floral pick now!

https://medium.com/@123weddingcards/heres-how-you-can-choose-the-perfect-wedding-bouquet-f6620c88ba1a

[]

2019-12-17 09:26:44.113000+00:00

['Flowers', 'Bridal', 'Inspiration']

Title Here’s Choose Perfect Wedding BouquetContent Here’s Choose Perfect Wedding Bouquet Time bring floral invitation life step wedding planning choose impeccable wedding bouquet special day you’re center attraction there’s something attractive couple little connoisseur enchanting fragrance enthrall guest core imperative make right choice pick best floral bouquet even spring wedding 123WeddingCards present goto guide selection process 1 Selecting color main factor connects accessory aura color decor make sure pick perfect color bring guiding step Select color fall wedding color scheme wedding decor tone lilac white it’ll pair elegantly petite bouquet purple Hydrangea — bloom flower purple leaf wherein purple fade scintillating shade white twinning decor forming beautiful centerpiece royal embellishment arch pillar even opt replica flower printed floral invitation b Contrast work magic Wedding decor darker shade team lighter accessory vice versa add attractive element wedding venue bright ‘red’ ravishing ‘green’ decoration call lighter shade wedding flower bouquet Long bouquet yellow Gladiolus make centerpiece soothing graceful c Pair bridal bouquet sure color bridal bouquet wedding bouquet follow color family red blue green pink distinctiveThe starlike blue Agapanthus bouquet bridesmaid’s bouquet oversized blue silk bouquet pair decor pleasing eye distinguishable 2 Show style flower trendsetter someone prefers lighter tone blasting color wedding flower bouquet speak style like floral wedding invitation you’re bold one kick thing hasn’t done exotic flower ideal match Calla lily Anthurium worth giving try Strelitzia unknown beauty It’s orange color blossom thin long pointed leaf vibe magically electric blue decor prefer go flow pick rose never grow old like rose floral invitation coordinate every decor style refreshing fragrance enriching nostril long they’re gone multitude color they’re available make best flower Carnations White Lilies Gardenias Peonies orchid grab place list 3 Lighter air smaller face you’ve picked color finalized style it’s time select weight size bouquet Bridesmaids’ bouquet lighter they’ll hold longer time ideal pick would small thin long flower long stem easier hold Buttercup bouquet single bloom perfect — they’ll lighter one bulb look beautiful One bulb Dahlia make bold pop otherwise soothing white gown wedding bouquet smaller don’t hide bridesmaids’ pretty face block view guest they’re used centerpiece Thus lightweight bouquet win heart well 4 Something wedding trend Wedding trend dictate major chunk romantic thinking let’s look what’s trending apart floral invitation Ditching ordinary rose Brides world experimenting trendsetting floral arrangement Freesia Lily Valley becoming new favorite b One flower army Instead opting bunch flower bride perfectly okay one floral bouquet larger flower you’re list c Bold new color red white Brides world around vouching color fiery eye floral invitation it’s wedding bouquets’ turn bolder Richer shade monochrome lighting stage fire Back tradition world talking moving ahead bride world stepping back tradition Greener richer bouquet fashion Visit collection wedding invitation choose best floral pick nowTags Flowers Bridal Inspiration