contestId
int64 0
1.01k
| index
stringclasses 57
values | name
stringlengths 2
58
| type
stringclasses 2
values | rating
int64 0
3.5k
| tags
sequencelengths 0
11
| title
stringclasses 522
values | time-limit
stringclasses 8
values | memory-limit
stringclasses 8
values | problem-description
stringlengths 0
7.15k
| input-specification
stringlengths 0
2.05k
| output-specification
stringlengths 0
1.5k
| demo-input
sequencelengths 0
7
| demo-output
sequencelengths 0
7
| note
stringlengths 0
5.24k
| points
float64 0
425k
| test_cases
listlengths 0
402
| creationTimeSeconds
int64 1.37B
1.7B
| relativeTimeSeconds
int64 8
2.15B
| programmingLanguage
stringclasses 3
values | verdict
stringclasses 14
values | testset
stringclasses 12
values | passedTestCount
int64 0
1k
| timeConsumedMillis
int64 0
15k
| memoryConsumedBytes
int64 0
805M
| code
stringlengths 3
65.5k
| prompt
stringlengths 262
8.2k
| response
stringlengths 17
65.5k
| score
float64 -1
3.99
|
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
251 | A | Points on Line | PROGRAMMING | 1,300 | [
"binary search",
"combinatorics",
"two pointers"
] | null | null | Little Petya likes points a lot. Recently his mom has presented him *n* points lying on the line *OX*. Now Petya is wondering in how many ways he can choose three distinct points so that the distance between the two farthest of them doesn't exceed *d*.
Note that the order of the points inside the group of three chosen points doesn't matter. | The first line contains two integers: *n* and *d* (1<=≤<=*n*<=≤<=105; 1<=≤<=*d*<=≤<=109). The next line contains *n* integers *x*1,<=*x*2,<=...,<=*x**n*, their absolute value doesn't exceed 109 — the *x*-coordinates of the points that Petya has got.
It is guaranteed that the coordinates of the points in the input strictly increase. | Print a single integer — the number of groups of three points, where the distance between two farthest points doesn't exceed *d*.
Please do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier. | [
"4 3\n1 2 3 4\n",
"4 2\n-3 -2 -1 0\n",
"5 19\n1 10 20 30 50\n"
] | [
"4\n",
"2\n",
"1\n"
] | In the first sample any group of three points meets our conditions.
In the seconds sample only 2 groups of three points meet our conditions: {-3, -2, -1} and {-2, -1, 0}.
In the third sample only one group does: {1, 10, 20}. | 500 | [
{
"input": "4 3\n1 2 3 4",
"output": "4"
},
{
"input": "4 2\n-3 -2 -1 0",
"output": "2"
},
{
"input": "5 19\n1 10 20 30 50",
"output": "1"
},
{
"input": "10 5\n31 36 43 47 48 50 56 69 71 86",
"output": "2"
},
{
"input": "10 50\n1 4 20 27 65 79 82 83 99 100",
"output": "25"
},
{
"input": "10 90\n24 27 40 41 61 69 73 87 95 97",
"output": "120"
},
{
"input": "100 100\n-98 -97 -96 -93 -92 -91 -90 -87 -86 -84 -81 -80 -79 -78 -76 -75 -73 -71 -69 -67 -65 -64 -63 -62 -61 -54 -51 -50 -49 -48 -46 -45 -44 -37 -36 -33 -30 -28 -27 -16 -15 -13 -12 -10 -9 -7 -6 -5 -4 2 3 5 8 9 10 11 13 14 15 16 17 19 22 24 25 26 27 28 30 31 32 36 40 43 45 46 47 50 51 52 53 58 60 63 69 70 73 78 80 81 82 85 88 89 90 91 95 96 97 99",
"output": "79351"
},
{
"input": "1 14751211\n847188590",
"output": "0"
},
{
"input": "2 1000000000\n-907894512 -289906312",
"output": "0"
},
{
"input": "2 1000000000\n-14348867 1760823",
"output": "0"
},
{
"input": "3 1000000000\n-5 -1 1",
"output": "1"
}
] | 1,378,949,057 | 2,147,483,647 | Python 3 | OK | TESTS | 39 | 1,652 | 9,420,800 | def Search(L,aa,x):
a=aa
b=len(L)
while(b-a>1):
i=(b+a)//2
if(L[i]>x):
b=i
elif(L[i]<x):
a=i
else:
return (i+1)-aa-1
return b-aa-1
import math
n,d=map(int,input().split())
P=list(map(int,input().split()))
ans=0
for i in range(n):
x=Search(P,i,P[i]+d)
if(x>1):
ans+=((x)*(x-1))//2
print(ans)
| Title: Points on Line
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Petya likes points a lot. Recently his mom has presented him *n* points lying on the line *OX*. Now Petya is wondering in how many ways he can choose three distinct points so that the distance between the two farthest of them doesn't exceed *d*.
Note that the order of the points inside the group of three chosen points doesn't matter.
Input Specification:
The first line contains two integers: *n* and *d* (1<=≤<=*n*<=≤<=105; 1<=≤<=*d*<=≤<=109). The next line contains *n* integers *x*1,<=*x*2,<=...,<=*x**n*, their absolute value doesn't exceed 109 — the *x*-coordinates of the points that Petya has got.
It is guaranteed that the coordinates of the points in the input strictly increase.
Output Specification:
Print a single integer — the number of groups of three points, where the distance between two farthest points doesn't exceed *d*.
Please do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use the cin, cout streams or the %I64d specifier.
Demo Input:
['4 3\n1 2 3 4\n', '4 2\n-3 -2 -1 0\n', '5 19\n1 10 20 30 50\n']
Demo Output:
['4\n', '2\n', '1\n']
Note:
In the first sample any group of three points meets our conditions.
In the seconds sample only 2 groups of three points meet our conditions: {-3, -2, -1} and {-2, -1, 0}.
In the third sample only one group does: {1, 10, 20}. | ```python
def Search(L,aa,x):
a=aa
b=len(L)
while(b-a>1):
i=(b+a)//2
if(L[i]>x):
b=i
elif(L[i]<x):
a=i
else:
return (i+1)-aa-1
return b-aa-1
import math
n,d=map(int,input().split())
P=list(map(int,input().split()))
ans=0
for i in range(n):
x=Search(P,i,P[i]+d)
if(x>1):
ans+=((x)*(x-1))//2
print(ans)
``` | 3 |
|
242 | B | Big Segment | PROGRAMMING | 1,100 | [
"implementation",
"sortings"
] | null | null | A coordinate line has *n* segments, the *i*-th segment starts at the position *l**i* and ends at the position *r**i*. We will denote such a segment as [*l**i*,<=*r**i*].
You have suggested that one of the defined segments covers all others. In other words, there is such segment in the given set, which contains all other ones. Now you want to test your assumption. Find in the given set the segment which covers all other segments, and print its number. If such a segment doesn't exist, print -1.
Formally we will assume that segment [*a*,<=*b*] covers segment [*c*,<=*d*], if they meet this condition *a*<=≤<=*c*<=≤<=*d*<=≤<=*b*. | The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of segments. Next *n* lines contain the descriptions of the segments. The *i*-th line contains two space-separated integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=109) — the borders of the *i*-th segment.
It is guaranteed that no two segments coincide. | Print a single integer — the number of the segment that covers all other segments in the set. If there's no solution, print -1.
The segments are numbered starting from 1 in the order in which they appear in the input. | [
"3\n1 1\n2 2\n3 3\n",
"6\n1 5\n2 3\n1 10\n7 10\n7 7\n10 10\n"
] | [
"-1\n",
"3\n"
] | none | 1,000 | [
{
"input": "3\n1 1\n2 2\n3 3",
"output": "-1"
},
{
"input": "6\n1 5\n2 3\n1 10\n7 10\n7 7\n10 10",
"output": "3"
},
{
"input": "4\n1 5\n2 2\n2 4\n2 5",
"output": "1"
},
{
"input": "5\n3 3\n1 3\n2 2\n2 3\n1 2",
"output": "2"
},
{
"input": "7\n7 7\n8 8\n3 7\n1 6\n1 7\n4 7\n2 8",
"output": "-1"
},
{
"input": "3\n2 5\n3 4\n2 3",
"output": "1"
},
{
"input": "16\n15 15\n8 12\n6 9\n15 16\n8 14\n3 12\n7 19\n9 13\n5 16\n9 17\n10 15\n9 14\n9 9\n18 19\n5 15\n6 19",
"output": "-1"
},
{
"input": "9\n1 10\n7 8\n6 7\n1 4\n5 9\n2 8\n3 10\n1 1\n2 3",
"output": "1"
},
{
"input": "1\n1 100000",
"output": "1"
},
{
"input": "6\n2 2\n3 3\n3 5\n4 5\n1 1\n1 5",
"output": "6"
},
{
"input": "33\n2 18\n4 14\n2 16\n10 12\n4 6\n9 17\n2 8\n4 12\n8 20\n1 10\n11 14\n11 17\n8 15\n3 16\n3 4\n6 9\n6 19\n4 17\n17 19\n6 16\n3 12\n1 7\n6 20\n8 16\n12 19\n1 3\n12 18\n6 11\n7 20\n16 18\n4 15\n3 15\n15 19",
"output": "-1"
},
{
"input": "34\n3 8\n5 9\n2 9\n1 4\n3 7\n3 3\n8 9\n6 10\n4 7\n6 7\n5 8\n5 10\n1 5\n8 8\n2 5\n3 5\n7 7\n2 8\n4 5\n1 1\n7 9\n5 6\n2 3\n1 2\n2 4\n8 10\n7 8\n1 3\n4 8\n9 10\n1 7\n10 10\n2 2\n1 8",
"output": "-1"
},
{
"input": "55\n3 4\n6 8\n9 10\n3 9\n9 9\n2 5\n4 8\n3 8\n8 10\n1 1\n4 9\n10 10\n6 6\n8 8\n1 8\n5 5\n4 5\n5 9\n2 2\n3 10\n4 6\n3 6\n1 6\n1 7\n6 10\n2 6\n3 7\n2 4\n4 4\n5 10\n1 4\n2 9\n1 3\n7 9\n7 8\n1 9\n1 10\n2 8\n8 9\n6 7\n1 2\n6 9\n7 7\n4 7\n3 3\n2 7\n4 10\n7 10\n2 3\n2 10\n5 7\n3 5\n5 8\n1 5\n5 6",
"output": "37"
},
{
"input": "1\n999999999 1000000000",
"output": "1"
},
{
"input": "3\n1 20\n2 22\n3 18",
"output": "-1"
},
{
"input": "1\n1000000000 1000000000",
"output": "1"
},
{
"input": "2\n100001 100008\n100005 100006",
"output": "1"
},
{
"input": "1\n1000000 10000000",
"output": "1"
},
{
"input": "3\n3 6\n2 4\n1 5",
"output": "-1"
},
{
"input": "2\n3 5\n1 2",
"output": "-1"
}
] | 1,554,887,966 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 9 | 218 | 0 |
n = int(input())
l = 1000000001
r = 0
found = True
pos = 0
for i in range(n):
(x, y) = map(int, input().split())
if x <= l and y >= r:
(l, r) = (x, y)
pos = i + 1
else:
if x < l or y > r:
found = False
break
if found:
print(pos)
else:
print(-1) | Title: Big Segment
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A coordinate line has *n* segments, the *i*-th segment starts at the position *l**i* and ends at the position *r**i*. We will denote such a segment as [*l**i*,<=*r**i*].
You have suggested that one of the defined segments covers all others. In other words, there is such segment in the given set, which contains all other ones. Now you want to test your assumption. Find in the given set the segment which covers all other segments, and print its number. If such a segment doesn't exist, print -1.
Formally we will assume that segment [*a*,<=*b*] covers segment [*c*,<=*d*], if they meet this condition *a*<=≤<=*c*<=≤<=*d*<=≤<=*b*.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of segments. Next *n* lines contain the descriptions of the segments. The *i*-th line contains two space-separated integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=109) — the borders of the *i*-th segment.
It is guaranteed that no two segments coincide.
Output Specification:
Print a single integer — the number of the segment that covers all other segments in the set. If there's no solution, print -1.
The segments are numbered starting from 1 in the order in which they appear in the input.
Demo Input:
['3\n1 1\n2 2\n3 3\n', '6\n1 5\n2 3\n1 10\n7 10\n7 7\n10 10\n']
Demo Output:
['-1\n', '3\n']
Note:
none | ```python
n = int(input())
l = 1000000001
r = 0
found = True
pos = 0
for i in range(n):
(x, y) = map(int, input().split())
if x <= l and y >= r:
(l, r) = (x, y)
pos = i + 1
else:
if x < l or y > r:
found = False
break
if found:
print(pos)
else:
print(-1)
``` | 0 |
|
934 | A | A Compatible Pair | PROGRAMMING | 1,400 | [
"brute force",
"games"
] | null | null | Nian is a monster which lives deep in the oceans. Once a year, it shows up on the land, devouring livestock and even people. In order to keep the monster away, people fill their villages with red colour, light, and cracking noise, all of which frighten the monster out of coming.
Little Tommy has *n* lanterns and Big Banban has *m* lanterns. Tommy's lanterns have brightness *a*1,<=*a*2,<=...,<=*a**n*, and Banban's have brightness *b*1,<=*b*2,<=...,<=*b**m* respectively.
Tommy intends to hide one of his lanterns, then Banban picks one of Tommy's non-hidden lanterns and one of his own lanterns to form a pair. The pair's brightness will be the product of the brightness of two lanterns.
Tommy wants to make the product as small as possible, while Banban tries to make it as large as possible.
You are asked to find the brightness of the chosen pair if both of them choose optimally. | The first line contains two space-separated integers *n* and *m* (2<=≤<=*n*,<=*m*<=≤<=50).
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n*.
The third line contains *m* space-separated integers *b*1,<=*b*2,<=...,<=*b**m*.
All the integers range from <=-<=109 to 109. | Print a single integer — the brightness of the chosen pair. | [
"2 2\n20 18\n2 14\n",
"5 3\n-1 0 1 2 3\n-1 0 1\n"
] | [
"252\n",
"2\n"
] | In the first example, Tommy will hide 20 and Banban will choose 18 from Tommy and 14 from himself.
In the second example, Tommy will hide 3 and Banban will choose 2 from Tommy and 1 from himself. | 500 | [
{
"input": "2 2\n20 18\n2 14",
"output": "252"
},
{
"input": "5 3\n-1 0 1 2 3\n-1 0 1",
"output": "2"
},
{
"input": "10 2\n1 6 2 10 2 3 2 10 6 4\n5 7",
"output": "70"
},
{
"input": "50 50\n1 6 2 10 2 3 2 10 6 4 5 0 3 1 7 3 2 4 4 2 1 5 0 6 10 1 8 0 10 9 0 4 10 5 5 7 4 9 9 5 5 2 6 7 9 4 3 7 2 0\n0 5 9 4 4 6 1 8 2 1 6 6 8 6 4 4 7 2 1 8 6 7 4 9 8 3 0 2 0 10 7 1 4 9 4 4 2 5 3 5 1 3 2 4 1 6 5 3 8 6",
"output": "100"
},
{
"input": "5 7\n-130464232 -73113866 -542094710 -53118823 -63528720\n-775179088 631683023 -974858199 -157471745 -629658630 71825477 -6235611",
"output": "127184126241438168"
},
{
"input": "16 15\n-94580188 -713689767 -559972014 -632609438 -930348091 -567718487 -611395744 -819913097 -924009672 -427913920 -812510647 -546415480 -982072775 -693369647 -693004777 -714181162\n-772924706 -202246100 -165871667 -991426281 -490838183 209351416 134956137 -36128588 -754413937 -616596290 696201705 -201191199 967464971 -244181984 -729907974",
"output": "922371547895579571"
},
{
"input": "12 22\n-102896616 -311161241 -67541276 -402842686 -830595520 -813834033 -44046671 -584806552 -598620444 -968935604 -303048547 -545969410\n545786451 262898403 442511997 -441241260 -479587986 -752123290 720443264 500646237 737842681 -571966572 -798463881 -477248830 89875164 410339460 -359022689 -251280099 -441455542 -538431186 -406793869 374561004 -108755237 -440143410",
"output": "663200522440413120"
},
{
"input": "33 14\n-576562007 -218618150 -471719380 -583840778 -256368365 -68451917 -405045344 -775538133 -896830082 -439261765 -947070124 -716577019 -456110999 -689862512 -132480131 -10805271 -518903339 -196240188 -222292638 -828546042 -43887962 -161359263 -281422097 -484060534 963147664 -492377073 -154570101 -52145116 187803553 858844161 66540410 418777176 434025748\n-78301978 -319393213 -12393024 542953412 786804661 845642067 754996432 -985617475 -487171947 56142664 203173079 -268261708 -817080591 -511720682",
"output": "883931400924882950"
},
{
"input": "15 8\n-966400308 -992207261 -302395973 -837980754 -516443826 -492405613 -378127629 -762650324 -519519776 -36132939 -286460372 -351445284 -407653342 -604960925 -523442015\n610042288 27129580 -103108347 -942517864 842060508 -588904868 614786155 37455106",
"output": "910849554065102112"
},
{
"input": "6 30\n-524297819 -947277203 -444186475 -182837689 -385379656 -453917269\n834529938 35245081 663687669 585422565 164412867 850052113 796429008 -307345676 -127653313 426960600 211854713 -733687358 251466836 -33491050 -882811238 455544614 774581544 768447941 -241033484 441104324 -493975870 308277556 275268265 935941507 -152292053 -961509996 -740482111 -954176110 -924254634 -518710544",
"output": "504117593849498724"
},
{
"input": "5 32\n-540510995 -841481393 -94342377 -74818927 -93445356\n686714668 -82581175 736472406 502016312 575563638 -899308712 503504178 -644271272 -437408397 385778869 -746757839 306275973 -663503743 -431116516 -418708278 -515261493 -988182324 900230931 218258353 -714420102 -241118202 294802602 -937785552 -857537498 -723195312 -690515139 -214508504 -44086454 -231621215 -418360090 -810003786 -675944617",
"output": "534123411186652380"
},
{
"input": "32 13\n-999451897 -96946179 -524159869 -906101658 -63367320 -629803888 -968586834 -658416130 -874232857 -926556428 -749908220 -517073321 -659752288 -910152878 -786916085 -607633039 -191428642 -867952926 -873793977 -584331784 -733245792 -779809700 -554228536 -464503499 561577340 258991071 -569805979 -372655165 -106685554 -619607960 188856473 -268960803\n886429660 -587284372 911396803 -462990289 -228681210 -876239914 -822830527 -750131315 -401234943 116991909 -582713480 979631847 813552478",
"output": "848714444125692276"
},
{
"input": "12 25\n-464030345 -914672073 -483242132 -856226270 -925135169 -353124606 -294027092 -619650850 -490724485 -240424784 -483066792 -921640365\n279850608 726838739 -431610610 242749870 -244020223 -396865433 129534799 182767854 -939698671 342579400 330027106 893561388 -263513962 643369418 276245179 -99206565 -473767261 -168908664 -853755837 -270920164 -661186118 199341055 765543053 908211534 -93363867",
"output": "866064226130454915"
},
{
"input": "10 13\n-749120991 -186261632 -335412349 -231354880 -195919225 -808736065 -481883825 -263383991 -664780611 -605377134\n718174936 -140362196 -669193674 -598621021 -464130929 450701419 -331183926 107203430 946959233 -565825915 -558199897 246556991 -666216081",
"output": "501307028237810934"
},
{
"input": "17 13\n-483786205 -947257449 -125949195 -294711143 -420288876 -812462057 -250049555 -911026413 -188146919 -129501682 -869006661 -649643966 -26976411 -275761039 -869067490 -272248209 -342067346\n445539900 529728842 -808170728 673157826 -70778491 642872105 299298867 -76674218 -902394063 377664752 723887448 -121522827 906464625",
"output": "822104826327386019"
},
{
"input": "15 29\n-716525085 -464205793 -577203110 -979997115 -491032521 -70793687 -770595947 -817983495 -767886763 -223333719 -971913221 -944656683 -200397825 -295615495 -945544540\n-877638425 -146878165 523758517 -158778747 -49535534 597311016 77325385 494128313 12111658 -4196724 295706874 477139483 375083042 726254399 -439255703 662913604 -481588088 673747948 -345999555 -723334478 -656721905 276267528 628773156 851420802 -585029291 -643535709 -968999740 -384418713 -510285542",
"output": "941783658451562540"
},
{
"input": "5 7\n-130464232 -73113866 -542094710 -53118823 -63528720\n449942926 482853427 861095072 316710734 194604468 20277633 668816604",
"output": "-1288212069119760"
},
{
"input": "24 24\n-700068683 -418791905 -24650102 -167277317 -182309202 -517748507 -663050677 -854097070 -426998982 -197009558 -101944229 -746589957 -849018439 -774208211 -946709040 -594578249 -276703474 -434567489 -743600446 -625029074 -977300284 -895608684 -878936220 -850670748\n704881272 169877679 705460701 94083210 403943695 987978311 786162506 658067668 697640875 186287 295558596 286470276 251313879 353071193 755450449 173370603 805550377 192465301 168935494 110161743 285139426 985238736 723221868 520679017",
"output": "-18990884587723"
},
{
"input": "39 9\n44558618 981372779 318891054 283079237 285093436 907256321 414759796 652683534 79042330 249010687 7020063 309415438 788425492 138577429 714835649 954204512 795507844 389962019 507308352 408180613 194676444 44962879 922688019 101163040 327953325 560462120 183657590 273616448 226876035 233697890 720185285 689340674 372938362 15088928 283418109 796807778 149989495 694808087 276385512\n-681609072 -210918688 -757170622 -205635977 -597872997 -496188744 -97031207 -311654366 -389141528",
"output": "-1464096896176096"
},
{
"input": "5 7\n869535768 926886134 457905290 946881177 936471280\n-550057074 -517146573 -138904928 -683289266 -805395532 -979722367 -331183396",
"output": "-120782803247464704"
},
{
"input": "24 24\n299931317 581208095 975349898 832722683 817690798 482251493 336949323 145902930 573001018 802990442 898055771 253410043 150981561 225791789 53290960 405421751 723296526 565432511 256399554 374970926 22699716 104391316 121063780 149329252\n-295118728 -830122321 -294539299 -905916790 -596056305 -12021689 -213837494 -341932332 -302359125 -999813713 -704441404 -713529724 -748686121 -646928807 -244549551 -826629397 -194449623 -807534699 -831064506 -889838257 -714860574 -14761264 -276778132 -479320983",
"output": "-640647347631440"
},
{
"input": "14 8\n-1000000000 -1000000000 -1000000000 -1000000000 -1000000000 -1000000000 -1000000000 -1000000000 -1000000000 -1000000000 -1000000000 -1000000000 -1000000000 -1000000000\n1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000 1000000000",
"output": "-1000000000000000000"
}
] | 1,591,536,855 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 10 | 109 | 307,200 | t=input()
L=list(map(int,input().split()))
L2=list(map(int,input().split()))
L.sort()
L2.sort()
a=max(L)
X=[]
count=1
for i in range(len(L)):
if L[i]==max(L) and count==1:
count+=1
continue
else:
X.append(L[i])
print(max(max(X)*max(L2),min(X)*min(L2),max(X)*min(L2),min(X)*max(L2))) | Title: A Compatible Pair
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Nian is a monster which lives deep in the oceans. Once a year, it shows up on the land, devouring livestock and even people. In order to keep the monster away, people fill their villages with red colour, light, and cracking noise, all of which frighten the monster out of coming.
Little Tommy has *n* lanterns and Big Banban has *m* lanterns. Tommy's lanterns have brightness *a*1,<=*a*2,<=...,<=*a**n*, and Banban's have brightness *b*1,<=*b*2,<=...,<=*b**m* respectively.
Tommy intends to hide one of his lanterns, then Banban picks one of Tommy's non-hidden lanterns and one of his own lanterns to form a pair. The pair's brightness will be the product of the brightness of two lanterns.
Tommy wants to make the product as small as possible, while Banban tries to make it as large as possible.
You are asked to find the brightness of the chosen pair if both of them choose optimally.
Input Specification:
The first line contains two space-separated integers *n* and *m* (2<=≤<=*n*,<=*m*<=≤<=50).
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n*.
The third line contains *m* space-separated integers *b*1,<=*b*2,<=...,<=*b**m*.
All the integers range from <=-<=109 to 109.
Output Specification:
Print a single integer — the brightness of the chosen pair.
Demo Input:
['2 2\n20 18\n2 14\n', '5 3\n-1 0 1 2 3\n-1 0 1\n']
Demo Output:
['252\n', '2\n']
Note:
In the first example, Tommy will hide 20 and Banban will choose 18 from Tommy and 14 from himself.
In the second example, Tommy will hide 3 and Banban will choose 2 from Tommy and 1 from himself. | ```python
t=input()
L=list(map(int,input().split()))
L2=list(map(int,input().split()))
L.sort()
L2.sort()
a=max(L)
X=[]
count=1
for i in range(len(L)):
if L[i]==max(L) and count==1:
count+=1
continue
else:
X.append(L[i])
print(max(max(X)*max(L2),min(X)*min(L2),max(X)*min(L2),min(X)*max(L2)))
``` | 0 |
|
32 | A | Reconnaissance | PROGRAMMING | 800 | [
"brute force"
] | A. Reconnaissance | 2 | 256 | According to the regulations of Berland's army, a reconnaissance unit should consist of exactly two soldiers. Since these two soldiers shouldn't differ much, their heights can differ by at most *d* centimeters. Captain Bob has *n* soldiers in his detachment. Their heights are *a*1,<=*a*2,<=...,<=*a**n* centimeters. Some soldiers are of the same height. Bob wants to know, how many ways exist to form a reconnaissance unit of two soldiers from his detachment.
Ways (1,<=2) and (2,<=1) should be regarded as different. | The first line contains two integers *n* and *d* (1<=≤<=*n*<=≤<=1000,<=1<=≤<=*d*<=≤<=109) — amount of soldiers in Bob's detachment and the maximum allowed height difference respectively. The second line contains *n* space-separated integers — heights of all the soldiers in Bob's detachment. These numbers don't exceed 109. | Output one number — amount of ways to form a reconnaissance unit of two soldiers, whose height difference doesn't exceed *d*. | [
"5 10\n10 20 50 60 65\n",
"5 1\n55 30 29 31 55\n"
] | [
"6\n",
"6\n"
] | none | 500 | [
{
"input": "5 10\n10 20 50 60 65",
"output": "6"
},
{
"input": "5 1\n55 30 29 31 55",
"output": "6"
},
{
"input": "6 10\n4 6 4 1 9 3",
"output": "30"
},
{
"input": "7 100\n19 1694 261 162 1 234 513",
"output": "8"
},
{
"input": "8 42\n37 53 74 187 568 22 5 65",
"output": "20"
},
{
"input": "10 4\n11 6 76 49 28 20 57 152 5 32",
"output": "4"
},
{
"input": "100 100\n51 93 101 960 2 477 213 129 663 925 254 78 1486 274 160 481 132 156 412 372 5 57 152 298 1771 7 359 468 254 406 202 929 221 366 552 97 555 29 822 118 539 140 992 854 7 163 134 103 940 30 409 1003 398 43 555 79 107 40 23 103 643 171 310 382 770 337 18 189 570 177 29 54 855 171 205 291 299 935 620 180 114 358 88 292 118 400 218 537 369 60 683 192 13 537 59 824 264 191 3 300",
"output": "2404"
}
] | 1,545,296,703 | 2,147,483,647 | Python 3 | OK | TESTS | 32 | 1,964 | 0 | string = input().split(' ')
n = int(string[0])
d = int(string[1])
heights = input().split(' ')
total = 0
for i in range(n):
for j in range(n):
if i != j:
if abs(int(heights[i])-int(heights[j])) <= d:
total += 1
print(total) | Title: Reconnaissance
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
According to the regulations of Berland's army, a reconnaissance unit should consist of exactly two soldiers. Since these two soldiers shouldn't differ much, their heights can differ by at most *d* centimeters. Captain Bob has *n* soldiers in his detachment. Their heights are *a*1,<=*a*2,<=...,<=*a**n* centimeters. Some soldiers are of the same height. Bob wants to know, how many ways exist to form a reconnaissance unit of two soldiers from his detachment.
Ways (1,<=2) and (2,<=1) should be regarded as different.
Input Specification:
The first line contains two integers *n* and *d* (1<=≤<=*n*<=≤<=1000,<=1<=≤<=*d*<=≤<=109) — amount of soldiers in Bob's detachment and the maximum allowed height difference respectively. The second line contains *n* space-separated integers — heights of all the soldiers in Bob's detachment. These numbers don't exceed 109.
Output Specification:
Output one number — amount of ways to form a reconnaissance unit of two soldiers, whose height difference doesn't exceed *d*.
Demo Input:
['5 10\n10 20 50 60 65\n', '5 1\n55 30 29 31 55\n']
Demo Output:
['6\n', '6\n']
Note:
none | ```python
string = input().split(' ')
n = int(string[0])
d = int(string[1])
heights = input().split(' ')
total = 0
for i in range(n):
for j in range(n):
if i != j:
if abs(int(heights[i])-int(heights[j])) <= d:
total += 1
print(total)
``` | 3.509 |
387 | B | George and Round | PROGRAMMING | 1,200 | [
"brute force",
"greedy",
"two pointers"
] | null | null | George decided to prepare a Codesecrof round, so he has prepared *m* problems for the round. Let's number the problems with integers 1 through *m*. George estimates the *i*-th problem's complexity by integer *b**i*.
To make the round good, he needs to put at least *n* problems there. Besides, he needs to have at least one problem with complexity exactly *a*1, at least one with complexity exactly *a*2, ..., and at least one with complexity exactly *a**n*. Of course, the round can also have problems with other complexities.
George has a poor imagination. It's easier for him to make some already prepared problem simpler than to come up with a new one and prepare it. George is magnificent at simplifying problems. He can simplify any already prepared problem with complexity *c* to any positive integer complexity *d* (*c*<=≥<=*d*), by changing limits on the input data.
However, nothing is so simple. George understood that even if he simplifies some problems, he can run out of problems for a good round. That's why he decided to find out the minimum number of problems he needs to come up with in addition to the *m* he's prepared in order to make a good round. Note that George can come up with a new problem of any complexity. | The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=3000) — the minimal number of problems in a good round and the number of problems George's prepared. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a*1<=<<=*a*2<=<<=...<=<<=*a**n*<=≤<=106) — the requirements for the complexity of the problems in a good round. The third line contains space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b*1<=≤<=*b*2...<=≤<=*b**m*<=≤<=106) — the complexities of the problems prepared by George. | Print a single integer — the answer to the problem. | [
"3 5\n1 2 3\n1 2 2 3 3\n",
"3 5\n1 2 3\n1 1 1 1 1\n",
"3 1\n2 3 4\n1\n"
] | [
"0\n",
"2\n",
"3\n"
] | In the first sample the set of the prepared problems meets the requirements for a good round.
In the second sample, it is enough to come up with and prepare two problems with complexities 2 and 3 to get a good round.
In the third sample it is very easy to get a good round if come up with and prepare extra problems with complexities: 2, 3, 4. | 1,000 | [
{
"input": "3 5\n1 2 3\n1 2 2 3 3",
"output": "0"
},
{
"input": "3 5\n1 2 3\n1 1 1 1 1",
"output": "2"
},
{
"input": "3 1\n2 3 4\n1",
"output": "3"
},
{
"input": "29 100\n20 32 41 67 72 155 331 382 399 412 465 470 484 511 515 529 616 637 679 715 733 763 826 843 862 903 925 979 989\n15 15 15 17 18 19 19 20 21 21 22 24 25 26 26 27 28 31 32 32 37 38 38 39 39 40 41 42 43 43 45 45 46 47 49 49 50 50 50 51 52 53 53 55 56 57 59 59 59 60 60 62 62 63 63 64 64 64 66 67 69 69 70 70 72 72 73 74 75 76 77 78 80 80 81 81 83 83 83 84 86 86 86 86 87 88 89 91 91 91 92 93 94 94 96 97 97 97 98 98",
"output": "24"
}
] | 1,618,923,181 | 2,147,483,647 | Python 3 | OK | TESTS | 41 | 78 | 307,200 | n, k = map(int, input().split())
rounds = list(map(int, input().split()))
problems = list(map(int, input().split()))
i = 0
j = 0
count = n
while i < n and j < k:
if rounds[i] <= problems[j]:
count-=1
i+=1
j+=1
else:
j+=1
print(count) | Title: George and Round
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
George decided to prepare a Codesecrof round, so he has prepared *m* problems for the round. Let's number the problems with integers 1 through *m*. George estimates the *i*-th problem's complexity by integer *b**i*.
To make the round good, he needs to put at least *n* problems there. Besides, he needs to have at least one problem with complexity exactly *a*1, at least one with complexity exactly *a*2, ..., and at least one with complexity exactly *a**n*. Of course, the round can also have problems with other complexities.
George has a poor imagination. It's easier for him to make some already prepared problem simpler than to come up with a new one and prepare it. George is magnificent at simplifying problems. He can simplify any already prepared problem with complexity *c* to any positive integer complexity *d* (*c*<=≥<=*d*), by changing limits on the input data.
However, nothing is so simple. George understood that even if he simplifies some problems, he can run out of problems for a good round. That's why he decided to find out the minimum number of problems he needs to come up with in addition to the *m* he's prepared in order to make a good round. Note that George can come up with a new problem of any complexity.
Input Specification:
The first line contains two integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=3000) — the minimal number of problems in a good round and the number of problems George's prepared. The second line contains space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a*1<=<<=*a*2<=<<=...<=<<=*a**n*<=≤<=106) — the requirements for the complexity of the problems in a good round. The third line contains space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b*1<=≤<=*b*2...<=≤<=*b**m*<=≤<=106) — the complexities of the problems prepared by George.
Output Specification:
Print a single integer — the answer to the problem.
Demo Input:
['3 5\n1 2 3\n1 2 2 3 3\n', '3 5\n1 2 3\n1 1 1 1 1\n', '3 1\n2 3 4\n1\n']
Demo Output:
['0\n', '2\n', '3\n']
Note:
In the first sample the set of the prepared problems meets the requirements for a good round.
In the second sample, it is enough to come up with and prepare two problems with complexities 2 and 3 to get a good round.
In the third sample it is very easy to get a good round if come up with and prepare extra problems with complexities: 2, 3, 4. | ```python
n, k = map(int, input().split())
rounds = list(map(int, input().split()))
problems = list(map(int, input().split()))
i = 0
j = 0
count = n
while i < n and j < k:
if rounds[i] <= problems[j]:
count-=1
i+=1
j+=1
else:
j+=1
print(count)
``` | 3 |
|
492 | A | Vanya and Cubes | PROGRAMMING | 800 | [
"implementation"
] | null | null | Vanya got *n* cubes. He decided to build a pyramid from them. Vanya wants to build the pyramid as follows: the top level of the pyramid must consist of 1 cube, the second level must consist of 1<=+<=2<==<=3 cubes, the third level must have 1<=+<=2<=+<=3<==<=6 cubes, and so on. Thus, the *i*-th level of the pyramid must have 1<=+<=2<=+<=...<=+<=(*i*<=-<=1)<=+<=*i* cubes.
Vanya wants to know what is the maximum height of the pyramid that he can make using the given cubes. | The first line contains integer *n* (1<=≤<=*n*<=≤<=104) — the number of cubes given to Vanya. | Print the maximum possible height of the pyramid in the single line. | [
"1\n",
"25\n"
] | [
"1\n",
"4\n"
] | Illustration to the second sample: | 500 | [
{
"input": "1",
"output": "1"
},
{
"input": "25",
"output": "4"
},
{
"input": "2",
"output": "1"
},
{
"input": "4115",
"output": "28"
},
{
"input": "9894",
"output": "38"
},
{
"input": "7969",
"output": "35"
},
{
"input": "6560",
"output": "33"
},
{
"input": "4",
"output": "2"
},
{
"input": "3",
"output": "1"
},
{
"input": "5",
"output": "2"
},
{
"input": "19",
"output": "3"
},
{
"input": "20",
"output": "4"
},
{
"input": "9880",
"output": "38"
},
{
"input": "9879",
"output": "37"
},
{
"input": "7770",
"output": "35"
},
{
"input": "7769",
"output": "34"
},
{
"input": "2925",
"output": "25"
},
{
"input": "220",
"output": "10"
},
{
"input": "219",
"output": "9"
},
{
"input": "3046",
"output": "25"
},
{
"input": "7590",
"output": "34"
},
{
"input": "1014",
"output": "17"
},
{
"input": "7142",
"output": "34"
},
{
"input": "9999",
"output": "38"
},
{
"input": "10000",
"output": "38"
}
] | 1,690,994,839 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 1 | 46 | 0 | n = int(input())
a = 1
b = 1
while b*2<=n:
b*=2
a+=1
print(a) | Title: Vanya and Cubes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vanya got *n* cubes. He decided to build a pyramid from them. Vanya wants to build the pyramid as follows: the top level of the pyramid must consist of 1 cube, the second level must consist of 1<=+<=2<==<=3 cubes, the third level must have 1<=+<=2<=+<=3<==<=6 cubes, and so on. Thus, the *i*-th level of the pyramid must have 1<=+<=2<=+<=...<=+<=(*i*<=-<=1)<=+<=*i* cubes.
Vanya wants to know what is the maximum height of the pyramid that he can make using the given cubes.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=104) — the number of cubes given to Vanya.
Output Specification:
Print the maximum possible height of the pyramid in the single line.
Demo Input:
['1\n', '25\n']
Demo Output:
['1\n', '4\n']
Note:
Illustration to the second sample: | ```python
n = int(input())
a = 1
b = 1
while b*2<=n:
b*=2
a+=1
print(a)
``` | 0 |
|
11 | A | Increasing Sequence | PROGRAMMING | 900 | [
"constructive algorithms",
"implementation",
"math"
] | A. Increasing Sequence | 1 | 64 | A sequence *a*0,<=*a*1,<=...,<=*a**t*<=-<=1 is called increasing if *a**i*<=-<=1<=<<=*a**i* for each *i*:<=0<=<<=*i*<=<<=*t*.
You are given a sequence *b*0,<=*b*1,<=...,<=*b**n*<=-<=1 and a positive integer *d*. In each move you may choose one element of the given sequence and add *d* to it. What is the least number of moves required to make the given sequence increasing? | The first line of the input contains two integer numbers *n* and *d* (2<=≤<=*n*<=≤<=2000,<=1<=≤<=*d*<=≤<=106). The second line contains space separated sequence *b*0,<=*b*1,<=...,<=*b**n*<=-<=1 (1<=≤<=*b**i*<=≤<=106). | Output the minimal number of moves needed to make the sequence increasing. | [
"4 2\n1 3 3 2\n"
] | [
"3\n"
] | none | 0 | [
{
"input": "4 2\n1 3 3 2",
"output": "3"
},
{
"input": "2 1\n1 1",
"output": "1"
},
{
"input": "2 1\n2 5",
"output": "0"
},
{
"input": "2 1\n1 2",
"output": "0"
},
{
"input": "2 1\n1 1",
"output": "1"
},
{
"input": "2 7\n10 20",
"output": "0"
},
{
"input": "2 7\n1 1",
"output": "1"
},
{
"input": "3 3\n18 1 9",
"output": "10"
},
{
"input": "3 3\n15 17 9",
"output": "3"
},
{
"input": "3 3\n10 9 12",
"output": "2"
},
{
"input": "10 3\n2 1 17 10 5 16 8 4 15 17",
"output": "31"
},
{
"input": "10 3\n6 11 4 12 22 15 23 26 24 26",
"output": "13"
},
{
"input": "10 3\n10 24 13 15 18 14 15 26 33 35",
"output": "29"
},
{
"input": "100 3\n529 178 280 403 326 531 671 427 188 866 669 646 421 804 494 609 53 1012 211 243 887 833 900 543 226 42 859 718 454 372 971 692 846 770 511 395 499 479 641 756 115 269 206 45 1039 727 400 779 859 614 146 214 196 919 702 959 380 830 535 878 859 784 316 305 782 924 536 243 236 978 564 150 291 877 808 983 537 839 490 120 168 838 267 650 900 170 211 504 326 771 895 984 994 483 776 100 471 1078 317 580",
"output": "15717"
},
{
"input": "100 3\n329 226 331 909 962 112 837 1005 194 818 506 416 125 648 367 459 400 582 989 547 329 438 234 121 272 226 821 376 834 427 718 164 834 113 654 177 737 212 169 696 744 180 89 944 233 147 667 990 809 1072 1085 1093 814 265 1067 312 833 572 303 901 1032 504 185 817 389 158 613 723 239 269 911 352 769 404 225 822 897 606 947 323 913 804 923 1084 552 901 486 249 209 898 847 610 728 1122 986 669 1116 1076 367 327",
"output": "16133"
}
] | 1,635,327,319 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 15 | 1,000 | 4,505,600 | n, d = map(int, input().split())
lst = list(map(int, input().split()))
additions = 0
for i in range(len(lst)):
while lst[i + 1] <= lst[i]:
lst[i + 1] += d
additions += 1
if i + 2 == len(lst): break
print(additions) | Title: Increasing Sequence
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
A sequence *a*0,<=*a*1,<=...,<=*a**t*<=-<=1 is called increasing if *a**i*<=-<=1<=<<=*a**i* for each *i*:<=0<=<<=*i*<=<<=*t*.
You are given a sequence *b*0,<=*b*1,<=...,<=*b**n*<=-<=1 and a positive integer *d*. In each move you may choose one element of the given sequence and add *d* to it. What is the least number of moves required to make the given sequence increasing?
Input Specification:
The first line of the input contains two integer numbers *n* and *d* (2<=≤<=*n*<=≤<=2000,<=1<=≤<=*d*<=≤<=106). The second line contains space separated sequence *b*0,<=*b*1,<=...,<=*b**n*<=-<=1 (1<=≤<=*b**i*<=≤<=106).
Output Specification:
Output the minimal number of moves needed to make the sequence increasing.
Demo Input:
['4 2\n1 3 3 2\n']
Demo Output:
['3\n']
Note:
none | ```python
n, d = map(int, input().split())
lst = list(map(int, input().split()))
additions = 0
for i in range(len(lst)):
while lst[i + 1] <= lst[i]:
lst[i + 1] += d
additions += 1
if i + 2 == len(lst): break
print(additions)
``` | 0 |
998 | A | Balloons | PROGRAMMING | 1,000 | [
"constructive algorithms",
"implementation"
] | null | null | There are quite a lot of ways to have fun with inflatable balloons. For example, you can fill them with water and see what happens.
Grigory and Andrew have the same opinion. So, once upon a time, they went to the shop and bought $n$ packets with inflatable balloons, where $i$-th of them has exactly $a_i$ balloons inside.
They want to divide the balloons among themselves. In addition, there are several conditions to hold:
- Do not rip the packets (both Grigory and Andrew should get unbroken packets); - Distribute all packets (every packet should be given to someone); - Give both Grigory and Andrew at least one packet; - To provide more fun, the total number of balloons in Grigory's packets should not be equal to the total number of balloons in Andrew's packets.
Help them to divide the balloons or determine that it's impossible under these conditions. | The first line of input contains a single integer $n$ ($1 \le n \le 10$) — the number of packets with balloons.
The second line contains $n$ integers: $a_1$, $a_2$, $\ldots$, $a_n$ ($1 \le a_i \le 1000$) — the number of balloons inside the corresponding packet. | If it's impossible to divide the balloons satisfying the conditions above, print $-1$.
Otherwise, print an integer $k$ — the number of packets to give to Grigory followed by $k$ distinct integers from $1$ to $n$ — the indices of those. The order of packets doesn't matter.
If there are multiple ways to divide balloons, output any of them. | [
"3\n1 2 1\n",
"2\n5 5\n",
"1\n10\n"
] | [
"2\n1 2\n",
"-1\n",
"-1\n"
] | In the first test Grigory gets $3$ balloons in total while Andrey gets $1$.
In the second test there's only one way to divide the packets which leads to equal numbers of balloons.
In the third test one of the boys won't get a packet at all. | 500 | [
{
"input": "3\n1 2 1",
"output": "1\n1"
},
{
"input": "2\n5 5",
"output": "-1"
},
{
"input": "1\n10",
"output": "-1"
},
{
"input": "1\n1",
"output": "-1"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1 1",
"output": "1\n1"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1 9",
"output": "1\n1"
},
{
"input": "10\n26 723 970 13 422 968 875 329 234 983",
"output": "1\n4"
},
{
"input": "3\n3 2 1",
"output": "1\n3"
},
{
"input": "10\n1000 1000 1000 1000 1000 1000 1000 1000 1000 1000",
"output": "1\n1"
},
{
"input": "10\n1 9 7 6 2 4 7 8 1 3",
"output": "1\n1"
},
{
"input": "2\n9 6",
"output": "1\n2"
},
{
"input": "2\n89 7",
"output": "1\n2"
},
{
"input": "2\n101 807",
"output": "1\n1"
},
{
"input": "5\n8 7 4 8 3",
"output": "1\n5"
},
{
"input": "5\n55 62 70 100 90",
"output": "1\n1"
},
{
"input": "5\n850 840 521 42 169",
"output": "1\n4"
},
{
"input": "6\n7 1 4 1 6 1",
"output": "1\n2"
},
{
"input": "6\n36 80 38 88 79 69",
"output": "1\n1"
},
{
"input": "6\n108 318 583 10 344 396",
"output": "1\n4"
},
{
"input": "9\n10 9 10 10 8 3 5 10 2",
"output": "1\n9"
},
{
"input": "9\n90 31 28 63 57 57 27 62 42",
"output": "1\n7"
},
{
"input": "9\n665 646 152 829 190 64 555 536 321",
"output": "1\n6"
},
{
"input": "10\n99 62 10 47 53 9 83 33 15 24",
"output": "1\n6"
},
{
"input": "4\n600 200 100 300",
"output": "1\n3"
},
{
"input": "2\n4 5",
"output": "1\n1"
},
{
"input": "2\n5 12",
"output": "1\n1"
},
{
"input": "2\n1 2",
"output": "1\n1"
},
{
"input": "3\n1 1 2",
"output": "1\n1"
},
{
"input": "2\n3 2",
"output": "1\n2"
},
{
"input": "3\n1 4 5",
"output": "1\n1"
},
{
"input": "4\n5 5 5 5",
"output": "1\n1"
},
{
"input": "1\n5",
"output": "-1"
},
{
"input": "3\n5 5 5",
"output": "1\n1"
},
{
"input": "5\n5 5 5 5 5",
"output": "1\n1"
},
{
"input": "4\n2 7 10 1",
"output": "1\n4"
},
{
"input": "3\n1 1 1",
"output": "1\n1"
},
{
"input": "4\n8 4 2 2",
"output": "1\n3"
},
{
"input": "2\n3 4",
"output": "1\n1"
},
{
"input": "4\n1 1 3 1",
"output": "1\n1"
},
{
"input": "7\n1 2 3 4 5 6 7",
"output": "1\n1"
},
{
"input": "2\n18 19",
"output": "1\n1"
},
{
"input": "2\n17 18",
"output": "1\n1"
},
{
"input": "2\n1 3",
"output": "1\n1"
},
{
"input": "4\n5 5 4 4",
"output": "1\n3"
},
{
"input": "2\n10 11",
"output": "1\n1"
},
{
"input": "2\n10 20",
"output": "1\n1"
},
{
"input": "2\n2 1",
"output": "1\n2"
},
{
"input": "4\n2 3 2 3",
"output": "1\n1"
},
{
"input": "2\n5 6",
"output": "1\n1"
}
] | 1,530,805,600 | 400 | Python 3 | OK | TESTS | 49 | 124 | 0 | n = int(input())
arr = list(map(int, input().split()))
if n == 1:
print(-1)
exit(0)
z = 0
for i in range(n):
if arr[i] < arr[z]:
z = i
if arr[z] != sum(arr) - arr[z]:
print(1)
print(z + 1)
else:
print(-1) | Title: Balloons
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are quite a lot of ways to have fun with inflatable balloons. For example, you can fill them with water and see what happens.
Grigory and Andrew have the same opinion. So, once upon a time, they went to the shop and bought $n$ packets with inflatable balloons, where $i$-th of them has exactly $a_i$ balloons inside.
They want to divide the balloons among themselves. In addition, there are several conditions to hold:
- Do not rip the packets (both Grigory and Andrew should get unbroken packets); - Distribute all packets (every packet should be given to someone); - Give both Grigory and Andrew at least one packet; - To provide more fun, the total number of balloons in Grigory's packets should not be equal to the total number of balloons in Andrew's packets.
Help them to divide the balloons or determine that it's impossible under these conditions.
Input Specification:
The first line of input contains a single integer $n$ ($1 \le n \le 10$) — the number of packets with balloons.
The second line contains $n$ integers: $a_1$, $a_2$, $\ldots$, $a_n$ ($1 \le a_i \le 1000$) — the number of balloons inside the corresponding packet.
Output Specification:
If it's impossible to divide the balloons satisfying the conditions above, print $-1$.
Otherwise, print an integer $k$ — the number of packets to give to Grigory followed by $k$ distinct integers from $1$ to $n$ — the indices of those. The order of packets doesn't matter.
If there are multiple ways to divide balloons, output any of them.
Demo Input:
['3\n1 2 1\n', '2\n5 5\n', '1\n10\n']
Demo Output:
['2\n1 2\n', '-1\n', '-1\n']
Note:
In the first test Grigory gets $3$ balloons in total while Andrey gets $1$.
In the second test there's only one way to divide the packets which leads to equal numbers of balloons.
In the third test one of the boys won't get a packet at all. | ```python
n = int(input())
arr = list(map(int, input().split()))
if n == 1:
print(-1)
exit(0)
z = 0
for i in range(n):
if arr[i] < arr[z]:
z = i
if arr[z] != sum(arr) - arr[z]:
print(1)
print(z + 1)
else:
print(-1)
``` | 3 |
|
227 | B | Effective Approach | PROGRAMMING | 1,100 | [
"implementation"
] | null | null | Once at a team training Vasya, Petya and Sasha got a problem on implementing linear search in an array.
According to the boys, linear search works as follows. The array elements in a pre-selected order are in turn compared with the number that you need to find. Once you find the array element that is equal to the required one, the search ends. The efficiency of the algorithm is the number of performed comparisons. The fewer comparisons the linear search has made, the more effective it is.
Vasya believes that a linear search would work better if it sequentially iterates through the elements, starting with the 1-st one (in this problem we consider the elements of the array indexed from 1 to *n*) and ending with the *n*-th one. And Petya says that Vasya is wrong: the search will need less comparisons if it sequentially iterates the elements starting from the *n*-th and ending with the 1-st one. Sasha argues that the two approaches are equivalent.
To finally begin the task, the teammates decided to settle the debate and compare the two approaches on an example. For this, they took an array that is a permutation of integers from 1 to *n*, and generated *m* queries of the form: find element with value *b**i* in the array. They want to calculate for both approaches how many comparisons in total the linear search will need to respond to all queries. If the first search needs fewer comparisons, then the winner of the dispute is Vasya. If the second one does, then the winner is Petya. If both approaches make the same number of comparisons, then Sasha's got the upper hand.
But the problem is, linear search is too slow. That's why the boys aren't going to find out who is right before the end of the training, unless you come in here. Help them to determine who will win the dispute. | The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of elements in the array. The second line contains *n* distinct space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — the elements of array.
The third line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of queries. The last line contains *m* space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=*n*) — the search queries. Note that the queries can repeat. | Print two integers, showing how many comparisons Vasya's approach needs and how many comparisons Petya's approach needs. Separate the numbers by spaces.
Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use cin, cout streams or the %I64d specifier. | [
"2\n1 2\n1\n1\n",
"2\n2 1\n1\n1\n",
"3\n3 1 2\n3\n1 2 3\n"
] | [
"1 2\n",
"2 1\n",
"6 6\n"
] | In the first sample Vasya's approach will make one comparison (it starts with the 1-st element and immediately finds the required number), and Petya's approach makes two comparisons (first he compares with the 2-nd array element, doesn't find the search item and compares with the 1-st element).
In the second sample, on the contrary, Vasya's approach will need two comparisons (first with 1-st element, and then with the 2-nd), and Petya's approach will find the required value in one comparison (the first comparison with the 2-nd element). | 1,000 | [
{
"input": "2\n1 2\n1\n1",
"output": "1 2"
},
{
"input": "2\n2 1\n1\n1",
"output": "2 1"
},
{
"input": "3\n3 1 2\n3\n1 2 3",
"output": "6 6"
},
{
"input": "9\n2 9 3 1 6 4 7 8 5\n9\n5 1 5 2 8 4 4 4 5",
"output": "58 32"
},
{
"input": "10\n3 10 9 2 7 6 5 8 4 1\n1\n4",
"output": "9 2"
},
{
"input": "10\n5 2 10 8 3 1 9 7 6 4\n9\n2 5 9 2 3 2 5 9 8",
"output": "31 68"
},
{
"input": "9\n3 8 4 7 1 2 5 6 9\n3\n2 7 1",
"output": "15 15"
},
{
"input": "9\n5 3 8 4 2 6 1 7 9\n4\n6 1 9 2",
"output": "27 13"
},
{
"input": "4\n1 3 2 4\n4\n3 1 2 3",
"output": "8 12"
},
{
"input": "3\n1 2 3\n8\n3 2 1 1 2 3 1 2",
"output": "15 17"
}
] | 1,691,018,138 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 5 | 2,000 | 12,083,200 |
n = int(input())
arr = list(map(int, input().split()))
m = int(input())
queries = list(map(int, input().split()))
v, p = 0, 0
for x in queries:
idx = arr.index(x)
idx2 = arr[::-1].index(x)
v += idx + 1
p += idx2 + 1
print(v, p) | Title: Effective Approach
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Once at a team training Vasya, Petya and Sasha got a problem on implementing linear search in an array.
According to the boys, linear search works as follows. The array elements in a pre-selected order are in turn compared with the number that you need to find. Once you find the array element that is equal to the required one, the search ends. The efficiency of the algorithm is the number of performed comparisons. The fewer comparisons the linear search has made, the more effective it is.
Vasya believes that a linear search would work better if it sequentially iterates through the elements, starting with the 1-st one (in this problem we consider the elements of the array indexed from 1 to *n*) and ending with the *n*-th one. And Petya says that Vasya is wrong: the search will need less comparisons if it sequentially iterates the elements starting from the *n*-th and ending with the 1-st one. Sasha argues that the two approaches are equivalent.
To finally begin the task, the teammates decided to settle the debate and compare the two approaches on an example. For this, they took an array that is a permutation of integers from 1 to *n*, and generated *m* queries of the form: find element with value *b**i* in the array. They want to calculate for both approaches how many comparisons in total the linear search will need to respond to all queries. If the first search needs fewer comparisons, then the winner of the dispute is Vasya. If the second one does, then the winner is Petya. If both approaches make the same number of comparisons, then Sasha's got the upper hand.
But the problem is, linear search is too slow. That's why the boys aren't going to find out who is right before the end of the training, unless you come in here. Help them to determine who will win the dispute.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of elements in the array. The second line contains *n* distinct space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=*n*) — the elements of array.
The third line contains integer *m* (1<=≤<=*m*<=≤<=105) — the number of queries. The last line contains *m* space-separated integers *b*1,<=*b*2,<=...,<=*b**m* (1<=≤<=*b**i*<=≤<=*n*) — the search queries. Note that the queries can repeat.
Output Specification:
Print two integers, showing how many comparisons Vasya's approach needs and how many comparisons Petya's approach needs. Separate the numbers by spaces.
Please, do not use the %lld specifier to read or write 64-bit integers in С++. It is preferred to use cin, cout streams or the %I64d specifier.
Demo Input:
['2\n1 2\n1\n1\n', '2\n2 1\n1\n1\n', '3\n3 1 2\n3\n1 2 3\n']
Demo Output:
['1 2\n', '2 1\n', '6 6\n']
Note:
In the first sample Vasya's approach will make one comparison (it starts with the 1-st element and immediately finds the required number), and Petya's approach makes two comparisons (first he compares with the 2-nd array element, doesn't find the search item and compares with the 1-st element).
In the second sample, on the contrary, Vasya's approach will need two comparisons (first with 1-st element, and then with the 2-nd), and Petya's approach will find the required value in one comparison (the first comparison with the 2-nd element). | ```python
n = int(input())
arr = list(map(int, input().split()))
m = int(input())
queries = list(map(int, input().split()))
v, p = 0, 0
for x in queries:
idx = arr.index(x)
idx2 = arr[::-1].index(x)
v += idx + 1
p += idx2 + 1
print(v, p)
``` | 0 |
|
41 | B | Martian Dollar | PROGRAMMING | 1,400 | [
"brute force"
] | B. Martian Dollar | 2 | 256 | One day Vasya got hold of information on the Martian dollar course in bourles for the next *n* days. The buying prices and the selling prices for one dollar on day *i* are the same and are equal to *a**i*. Vasya has *b* bourles. He can buy a certain number of dollars and then sell it no more than once in *n* days. According to Martian laws, one can buy only an integer number of dollars. Which maximal sum of money in bourles can Vasya get by the end of day *n*? | The first line contains two integers *n* and *b* (1<=≤<=*n*,<=*b*<=≤<=2000) — the number of days and the initial number of money in bourles. The next line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=2000) — the prices of Martian dollars. | Print the single number — which maximal sum of money in bourles can Vasya get by the end of day *n*. | [
"2 4\n3 7\n",
"4 10\n4 3 2 1\n",
"4 10\n4 2 3 1\n"
] | [
"8\n",
"10\n",
"15\n"
] | none | 1,000 | [
{
"input": "2 4\n3 7",
"output": "8"
},
{
"input": "4 10\n4 3 2 1",
"output": "10"
},
{
"input": "4 10\n4 2 3 1",
"output": "15"
},
{
"input": "2 755\n51 160",
"output": "2281"
},
{
"input": "3 385\n978 1604 1888",
"output": "385"
},
{
"input": "4 1663\n1904 1049 1622 472",
"output": "2236"
},
{
"input": "5 1293\n1183 142 1356 889 134",
"output": "12219"
},
{
"input": "1 1472\n784",
"output": "1472"
},
{
"input": "1 478\n1955",
"output": "478"
},
{
"input": "1 1483\n1126",
"output": "1483"
},
{
"input": "10 595\n881 832 1159 171 230 750 361 1800 516 567",
"output": "5482"
},
{
"input": "93 867\n97 1270 616 1027 1685 27 1662 947 1480 20 1394 1528 191 1348 67 1694 1772 1706 1394 109 1391 878 1474 307 101 663 1064 116 143 1239 386 651 1534 1348 1604 636 793 1188 1293 24 1729 1204 1656 1579 1644 661 1470 341 1709 1860 1081 1539 5 1892 1732 1049 419 25 1086 1263 967 1284 1229 1013 1348 1046 927 1492 1459 1523 459 1907 68 853 822 994 912 266 850 1991 714 1803 513 835 947 313 1287 1183 285 182 1053 1192 615",
"output": "344445"
},
{
"input": "23 1966\n625 1474 1628 1770 1365 922 120 844 826 1145 878 1479 1489 10 1081 1182 1862 303 101 100 14 1319 326",
"output": "364958"
},
{
"input": "43 1427\n651 1624 295 6 1615 1683 741 183 734 1056 1487 633 1368 1267 1782 1091 541 1277 1263 1703 785 223 184 1837 1724 1581 1400 1483 445 1490 580 643 1998 41 1581 873 1906 846 1607 1503 1131 1858 1861",
"output": "473531"
},
{
"input": "39 897\n18 38 122 130 337 471 492 518 541 557 568 637 688 861 927 989 1018 1046 1158 1292 1309 1316 1347 1380 1430 1530 1589 1637 1651 1696 1798 1821 1829 1830 1838 1883 1896 1912 1917",
"output": "93948"
}
] | 1,605,309,489 | 2,147,483,647 | PyPy 3 | OK | TESTS | 80 | 560 | 1,945,600 | n, b = map(int, input().split())
a = list(map(int, input().split()))
ans = 0
for i in range(n):
for j in range(i, n):
ans = max(ans, (b//a[i])*a[j] + b%a[i])
print(ans) | Title: Martian Dollar
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
One day Vasya got hold of information on the Martian dollar course in bourles for the next *n* days. The buying prices and the selling prices for one dollar on day *i* are the same and are equal to *a**i*. Vasya has *b* bourles. He can buy a certain number of dollars and then sell it no more than once in *n* days. According to Martian laws, one can buy only an integer number of dollars. Which maximal sum of money in bourles can Vasya get by the end of day *n*?
Input Specification:
The first line contains two integers *n* and *b* (1<=≤<=*n*,<=*b*<=≤<=2000) — the number of days and the initial number of money in bourles. The next line contains *n* integers *a**i* (1<=≤<=*a**i*<=≤<=2000) — the prices of Martian dollars.
Output Specification:
Print the single number — which maximal sum of money in bourles can Vasya get by the end of day *n*.
Demo Input:
['2 4\n3 7\n', '4 10\n4 3 2 1\n', '4 10\n4 2 3 1\n']
Demo Output:
['8\n', '10\n', '15\n']
Note:
none | ```python
n, b = map(int, input().split())
a = list(map(int, input().split()))
ans = 0
for i in range(n):
for j in range(i, n):
ans = max(ans, (b//a[i])*a[j] + b%a[i])
print(ans)
``` | 3.856376 |
479 | A | Expression | PROGRAMMING | 1,000 | [
"brute force",
"math"
] | null | null | Petya studies in a school and he adores Maths. His class has been studying arithmetic expressions. On the last class the teacher wrote three positive integers *a*, *b*, *c* on the blackboard. The task was to insert signs of operations '+' and '*', and probably brackets between the numbers so that the value of the resulting expression is as large as possible. Let's consider an example: assume that the teacher wrote numbers 1, 2 and 3 on the blackboard. Here are some ways of placing signs and brackets:
- 1+2*3=7 - 1*(2+3)=5 - 1*2*3=6 - (1+2)*3=9
Note that you can insert operation signs only between *a* and *b*, and between *b* and *c*, that is, you cannot swap integers. For instance, in the given sample you cannot get expression (1+3)*2.
It's easy to see that the maximum value that you can obtain is 9.
Your task is: given *a*, *b* and *c* print the maximum value that you can get. | The input contains three integers *a*, *b* and *c*, each on a single line (1<=≤<=*a*,<=*b*,<=*c*<=≤<=10). | Print the maximum value of the expression that you can obtain. | [
"1\n2\n3\n",
"2\n10\n3\n"
] | [
"9\n",
"60\n"
] | none | 500 | [
{
"input": "1\n2\n3",
"output": "9"
},
{
"input": "2\n10\n3",
"output": "60"
},
{
"input": "1\n1\n1",
"output": "3"
},
{
"input": "1\n2\n1",
"output": "4"
},
{
"input": "10\n10\n10",
"output": "1000"
},
{
"input": "5\n1\n3",
"output": "20"
},
{
"input": "3\n1\n5",
"output": "20"
},
{
"input": "6\n7\n1",
"output": "48"
},
{
"input": "1\n8\n3",
"output": "27"
},
{
"input": "9\n7\n2",
"output": "126"
},
{
"input": "1\n1\n10",
"output": "20"
},
{
"input": "9\n1\n1",
"output": "18"
},
{
"input": "10\n5\n6",
"output": "300"
},
{
"input": "8\n9\n7",
"output": "504"
},
{
"input": "4\n2\n10",
"output": "80"
},
{
"input": "2\n8\n3",
"output": "48"
},
{
"input": "3\n5\n7",
"output": "105"
},
{
"input": "1\n10\n1",
"output": "12"
},
{
"input": "2\n2\n2",
"output": "8"
},
{
"input": "5\n6\n1",
"output": "35"
},
{
"input": "10\n1\n1",
"output": "20"
},
{
"input": "1\n6\n1",
"output": "8"
},
{
"input": "1\n9\n1",
"output": "11"
},
{
"input": "2\n1\n2",
"output": "6"
},
{
"input": "2\n6\n1",
"output": "14"
},
{
"input": "9\n2\n1",
"output": "27"
},
{
"input": "1\n9\n2",
"output": "20"
},
{
"input": "1\n3\n1",
"output": "5"
},
{
"input": "2\n1\n1",
"output": "4"
}
] | 1,693,923,784 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 29 | 62 | 0 | x = int(input())
y = int(input())
z = int(input())
list_1 = []
list_1.append((x+y)*z)
list_1.append(x*(y+z))
list_1.append(x+y+z)
list_1.append(x*y*z)
print(max(list_1)) | Title: Expression
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya studies in a school and he adores Maths. His class has been studying arithmetic expressions. On the last class the teacher wrote three positive integers *a*, *b*, *c* on the blackboard. The task was to insert signs of operations '+' and '*', and probably brackets between the numbers so that the value of the resulting expression is as large as possible. Let's consider an example: assume that the teacher wrote numbers 1, 2 and 3 on the blackboard. Here are some ways of placing signs and brackets:
- 1+2*3=7 - 1*(2+3)=5 - 1*2*3=6 - (1+2)*3=9
Note that you can insert operation signs only between *a* and *b*, and between *b* and *c*, that is, you cannot swap integers. For instance, in the given sample you cannot get expression (1+3)*2.
It's easy to see that the maximum value that you can obtain is 9.
Your task is: given *a*, *b* and *c* print the maximum value that you can get.
Input Specification:
The input contains three integers *a*, *b* and *c*, each on a single line (1<=≤<=*a*,<=*b*,<=*c*<=≤<=10).
Output Specification:
Print the maximum value of the expression that you can obtain.
Demo Input:
['1\n2\n3\n', '2\n10\n3\n']
Demo Output:
['9\n', '60\n']
Note:
none | ```python
x = int(input())
y = int(input())
z = int(input())
list_1 = []
list_1.append((x+y)*z)
list_1.append(x*(y+z))
list_1.append(x+y+z)
list_1.append(x*y*z)
print(max(list_1))
``` | 3 |
|
221 | A | Little Elephant and Function | PROGRAMMING | 1,000 | [
"implementation",
"math"
] | null | null | The Little Elephant enjoys recursive functions.
This time he enjoys the sorting function. Let *a* is a permutation of an integers from 1 to *n*, inclusive, and *a**i* denotes the *i*-th element of the permutation. The Little Elephant's recursive function *f*(*x*), that sorts the first *x* permutation's elements, works as follows:
- If *x*<==<=1, exit the function. - Otherwise, call *f*(*x*<=-<=1), and then make *swap*(*a**x*<=-<=1,<=*a**x*) (swap the *x*-th and (*x*<=-<=1)-th elements of *a*).
The Little Elephant's teacher believes that this function does not work correctly. But that-be do not get an F, the Little Elephant wants to show the performance of its function. Help him, find a permutation of numbers from 1 to *n*, such that after performing the Little Elephant's function (that is call *f*(*n*)), the permutation will be sorted in ascending order. | A single line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the size of permutation. | In a single line print *n* distinct integers from 1 to *n* — the required permutation. Numbers in a line should be separated by spaces.
It is guaranteed that the answer exists. | [
"1\n",
"2\n"
] | [
"1 ",
"2 1 "
] | none | 500 | [
{
"input": "1",
"output": "1 "
},
{
"input": "2",
"output": "2 1 "
},
{
"input": "3",
"output": "3 1 2 "
},
{
"input": "4",
"output": "4 1 2 3 "
},
{
"input": "5",
"output": "5 1 2 3 4 "
},
{
"input": "6",
"output": "6 1 2 3 4 5 "
},
{
"input": "7",
"output": "7 1 2 3 4 5 6 "
},
{
"input": "1000",
"output": "1000 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "999",
"output": "999 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "998",
"output": "998 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "997",
"output": "997 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "900",
"output": "900 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "101",
"output": "101 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 "
},
{
"input": "3",
"output": "3 1 2 "
},
{
"input": "67",
"output": "67 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 "
},
{
"input": "779",
"output": "779 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "195",
"output": "195 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "907",
"output": "907 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "971",
"output": "971 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "683",
"output": "683 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "99",
"output": "99 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 "
},
{
"input": "811",
"output": "811 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "875",
"output": "875 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "291",
"output": "291 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "3",
"output": "3 1 2 "
},
{
"input": "419",
"output": "419 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "779",
"output": "779 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "195",
"output": "195 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "907",
"output": "907 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "21",
"output": "21 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 "
},
{
"input": "22",
"output": "22 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 "
},
{
"input": "23",
"output": "23 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 "
},
{
"input": "24",
"output": "24 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 "
},
{
"input": "25",
"output": "25 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 "
}
] | 1,591,987,991 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 186 | 0 | n = int(input())
anwer = []
for i in range(n , 0 , -1):
anwer += str(i)
print(" ".join(anwer)) | Title: Little Elephant and Function
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The Little Elephant enjoys recursive functions.
This time he enjoys the sorting function. Let *a* is a permutation of an integers from 1 to *n*, inclusive, and *a**i* denotes the *i*-th element of the permutation. The Little Elephant's recursive function *f*(*x*), that sorts the first *x* permutation's elements, works as follows:
- If *x*<==<=1, exit the function. - Otherwise, call *f*(*x*<=-<=1), and then make *swap*(*a**x*<=-<=1,<=*a**x*) (swap the *x*-th and (*x*<=-<=1)-th elements of *a*).
The Little Elephant's teacher believes that this function does not work correctly. But that-be do not get an F, the Little Elephant wants to show the performance of its function. Help him, find a permutation of numbers from 1 to *n*, such that after performing the Little Elephant's function (that is call *f*(*n*)), the permutation will be sorted in ascending order.
Input Specification:
A single line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the size of permutation.
Output Specification:
In a single line print *n* distinct integers from 1 to *n* — the required permutation. Numbers in a line should be separated by spaces.
It is guaranteed that the answer exists.
Demo Input:
['1\n', '2\n']
Demo Output:
['1 ', '2 1 ']
Note:
none | ```python
n = int(input())
anwer = []
for i in range(n , 0 , -1):
anwer += str(i)
print(" ".join(anwer))
``` | 0 |
|
34 | A | Reconnaissance 2 | PROGRAMMING | 800 | [
"implementation"
] | A. Reconnaissance 2 | 2 | 256 | *n* soldiers stand in a circle. For each soldier his height *a**i* is known. A reconnaissance unit can be made of such two neighbouring soldiers, whose heights difference is minimal, i.e. |*a**i*<=-<=*a**j*| is minimal. So each of them will be less noticeable with the other. Output any pair of soldiers that can form a reconnaissance unit. | The first line contains integer *n* (2<=≤<=*n*<=≤<=100) — amount of soldiers. Then follow the heights of the soldiers in their order in the circle — *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000). The soldier heights are given in clockwise or counterclockwise direction. | Output two integers — indexes of neighbouring soldiers, who should form a reconnaissance unit. If there are many optimum solutions, output any of them. Remember, that the soldiers stand in a circle. | [
"5\n10 12 13 15 10\n",
"4\n10 20 30 40\n"
] | [
"5 1\n",
"1 2\n"
] | none | 500 | [
{
"input": "5\n10 12 13 15 10",
"output": "5 1"
},
{
"input": "4\n10 20 30 40",
"output": "1 2"
},
{
"input": "6\n744 359 230 586 944 442",
"output": "2 3"
},
{
"input": "5\n826 747 849 687 437",
"output": "1 2"
},
{
"input": "5\n999 999 993 969 999",
"output": "1 2"
},
{
"input": "5\n4 24 6 1 15",
"output": "3 4"
},
{
"input": "2\n511 32",
"output": "1 2"
},
{
"input": "3\n907 452 355",
"output": "2 3"
},
{
"input": "4\n303 872 764 401",
"output": "4 1"
},
{
"input": "10\n684 698 429 694 956 812 594 170 937 764",
"output": "1 2"
},
{
"input": "20\n646 840 437 946 640 564 936 917 487 752 844 734 468 969 674 646 728 642 514 695",
"output": "7 8"
},
{
"input": "30\n996 999 998 984 989 1000 996 993 1000 983 992 999 999 1000 979 992 987 1000 996 1000 1000 989 981 996 995 999 999 989 999 1000",
"output": "12 13"
},
{
"input": "50\n93 27 28 4 5 78 59 24 19 134 31 128 118 36 90 32 32 1 44 32 33 13 31 10 12 25 38 50 25 12 4 22 28 53 48 83 4 25 57 31 71 24 8 7 28 86 23 80 101 58",
"output": "16 17"
},
{
"input": "88\n1000 1000 1000 1000 1000 998 998 1000 1000 1000 1000 999 999 1000 1000 1000 999 1000 997 999 997 1000 999 998 1000 999 1000 1000 1000 999 1000 999 999 1000 1000 999 1000 999 1000 1000 998 1000 1000 1000 998 998 1000 1000 999 1000 1000 1000 1000 1000 1000 1000 998 1000 1000 1000 999 1000 1000 999 1000 1000 1000 1000 1000 1000 1000 1000 1000 1000 998 1000 1000 1000 998 1000 1000 998 1000 999 1000 1000 1000 1000",
"output": "1 2"
},
{
"input": "99\n4 4 21 6 5 3 13 2 6 1 3 4 1 3 1 9 11 1 6 17 4 5 20 4 1 9 5 11 3 4 14 1 3 3 1 4 3 5 27 1 1 2 10 7 11 4 19 7 11 6 11 13 3 1 10 7 2 1 16 1 9 4 29 13 2 12 14 2 21 1 9 8 26 12 12 5 2 14 7 8 8 8 9 4 12 2 6 6 7 16 8 14 2 10 20 15 3 7 4",
"output": "1 2"
},
{
"input": "100\n713 572 318 890 577 657 646 146 373 783 392 229 455 871 20 593 573 336 26 381 280 916 907 732 820 713 111 840 570 446 184 711 481 399 788 647 492 15 40 530 549 506 719 782 126 20 778 996 712 761 9 74 812 418 488 175 103 585 900 3 604 521 109 513 145 708 990 361 682 827 791 22 596 780 596 385 450 643 158 496 876 975 319 783 654 895 891 361 397 81 682 899 347 623 809 557 435 279 513 438",
"output": "86 87"
},
{
"input": "100\n31 75 86 68 111 27 22 22 26 30 54 163 107 75 160 122 14 23 17 26 27 20 43 58 59 71 21 148 9 32 43 91 133 286 132 70 90 156 84 14 77 93 23 18 13 72 18 131 33 28 72 175 30 86 249 20 14 208 28 57 63 199 6 10 24 30 62 267 43 479 60 28 138 1 45 3 19 47 7 166 116 117 50 140 28 14 95 85 93 43 61 15 2 70 10 51 7 95 9 25",
"output": "7 8"
},
{
"input": "100\n896 898 967 979 973 709 961 968 806 967 896 967 826 975 936 903 986 856 851 931 852 971 786 837 949 978 686 936 952 909 965 749 908 916 943 973 983 975 939 886 964 928 960 976 907 788 994 773 949 871 947 980 945 985 726 981 887 943 907 990 931 874 840 867 948 951 961 904 888 901 976 967 994 921 828 970 972 722 755 970 860 855 914 869 714 899 969 978 898 862 642 939 904 936 819 934 884 983 955 964",
"output": "1 2"
},
{
"input": "100\n994 927 872 970 815 986 952 996 965 1000 877 986 978 999 950 990 936 997 993 960 921 860 895 869 943 998 983 968 973 953 999 990 995 871 853 979 973 963 953 938 997 989 993 964 960 973 946 975 1000 962 920 746 989 957 904 965 920 979 966 961 1000 993 975 952 846 971 991 979 985 969 984 973 956 1000 952 778 983 974 956 927 995 997 980 997 1000 970 960 970 988 983 947 904 935 972 1000 863 992 996 932 967",
"output": "81 82"
},
{
"input": "100\n48 108 63 21 27 8 49 21 75 8 24 42 149 18 8 28 21 18 25 35 59 70 59 33 40 1 67 34 120 82 4 115 72 87 3 15 15 63 37 12 40 27 83 14 38 20 14 58 93 10 31 3 39 6 197 77 54 16 31 146 9 49 14 8 77 82 5 11 80 116 8 61 50 24 7 103 29 11 3 3 1 12 46 24 21 131 39 29 36 2 107 40 16 99 31 41 29 48 17 17",
"output": "36 37"
}
] | 1,617,960,596 | 2,147,483,647 | PyPy 3 | OK | TESTS | 20 | 186 | 0 | n=int(input())
l=list(map(int,input().split()))
mi=100000000000
ans=-1
for i in range(n):
if(abs(l[i]-l[i-1])<mi):
ans=((i-1+n))%n
mi=abs(l[i]-l[i-1])
print(ans+1,(ans+1)%n+1)
| Title: Reconnaissance 2
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
*n* soldiers stand in a circle. For each soldier his height *a**i* is known. A reconnaissance unit can be made of such two neighbouring soldiers, whose heights difference is minimal, i.e. |*a**i*<=-<=*a**j*| is minimal. So each of them will be less noticeable with the other. Output any pair of soldiers that can form a reconnaissance unit.
Input Specification:
The first line contains integer *n* (2<=≤<=*n*<=≤<=100) — amount of soldiers. Then follow the heights of the soldiers in their order in the circle — *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1000). The soldier heights are given in clockwise or counterclockwise direction.
Output Specification:
Output two integers — indexes of neighbouring soldiers, who should form a reconnaissance unit. If there are many optimum solutions, output any of them. Remember, that the soldiers stand in a circle.
Demo Input:
['5\n10 12 13 15 10\n', '4\n10 20 30 40\n']
Demo Output:
['5 1\n', '1 2\n']
Note:
none | ```python
n=int(input())
l=list(map(int,input().split()))
mi=100000000000
ans=-1
for i in range(n):
if(abs(l[i]-l[i-1])<mi):
ans=((i-1+n))%n
mi=abs(l[i]-l[i-1])
print(ans+1,(ans+1)%n+1)
``` | 3.9535 |
914 | A | Perfect Squares | PROGRAMMING | 900 | [
"brute force",
"implementation",
"math"
] | null | null | Given an array *a*1,<=*a*2,<=...,<=*a**n* of *n* integers, find the largest number in the array that is not a perfect square.
A number *x* is said to be a perfect square if there exists an integer *y* such that *x*<==<=*y*2. | The first line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of elements in the array.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=106<=≤<=*a**i*<=≤<=106) — the elements of the array.
It is guaranteed that at least one element of the array is not a perfect square. | Print the largest number in the array which is not a perfect square. It is guaranteed that an answer always exists. | [
"2\n4 2\n",
"8\n1 2 4 8 16 32 64 576\n"
] | [
"2\n",
"32\n"
] | In the first sample case, 4 is a perfect square, so the largest number in the array that is not a perfect square is 2. | 500 | [
{
"input": "2\n4 2",
"output": "2"
},
{
"input": "8\n1 2 4 8 16 32 64 576",
"output": "32"
},
{
"input": "3\n-1 -4 -9",
"output": "-1"
},
{
"input": "5\n918375 169764 598796 76602 538757",
"output": "918375"
},
{
"input": "5\n804610 765625 2916 381050 93025",
"output": "804610"
},
{
"input": "5\n984065 842724 127449 525625 573049",
"output": "984065"
},
{
"input": "2\n226505 477482",
"output": "477482"
},
{
"input": "2\n370881 659345",
"output": "659345"
},
{
"input": "2\n4 5",
"output": "5"
},
{
"input": "2\n3 4",
"output": "3"
},
{
"input": "2\n999999 1000000",
"output": "999999"
},
{
"input": "3\n-1 -2 -3",
"output": "-1"
},
{
"input": "2\n-1000000 1000000",
"output": "-1000000"
},
{
"input": "2\n-1 0",
"output": "-1"
},
{
"input": "1\n2",
"output": "2"
},
{
"input": "1\n-1",
"output": "-1"
},
{
"input": "35\n-871271 -169147 -590893 -400197 -476793 0 -15745 -890852 -124052 -631140 -238569 -597194 -147909 -928925 -587628 -569656 -581425 -963116 -665954 -506797 -196044 -309770 -701921 -926257 -152426 -991371 -624235 -557143 -689886 -59804 -549134 -107407 -182016 -24153 -607462",
"output": "-15745"
},
{
"input": "16\n-882343 -791322 0 -986738 -415891 -823354 -840236 -552554 -760908 -331993 -549078 -863759 -913261 -937429 -257875 -602322",
"output": "-257875"
},
{
"input": "71\n908209 289 44521 240100 680625 274576 212521 91809 506944 499849 3844 15376 592900 58081 240100 984064 732736 257049 600625 180625 130321 580644 261121 75625 46225 853776 485809 700569 817216 268324 293764 528529 25921 399424 175561 99856 295936 20736 611524 13924 470596 574564 5329 15376 676 431649 145161 697225 41616 550564 514089 9409 227529 1681 839056 3721 552049 465124 38809 197136 659344 214369 998001 44944 3844 186624 362404 -766506 739600 10816 299209",
"output": "-766506"
},
{
"input": "30\n192721 -950059 -734656 625 247009 -423468 318096 622521 678976 777924 1444 748303 27556 62001 795664 89401 221841 -483208 467856 477109 196 -461813 831744 772641 574564 -519370 861184 67600 -717966 -259259",
"output": "748303"
},
{
"input": "35\n628849 962361 436921 944784 444889 29241 -514806 171396 685584 -823202 -929730 6982 198025 783225 552049 -957165 782287 -659167 -414846 695556 -336330 41616 963781 71289 119639 952576 -346713 178929 232324 121802 393266 841 649636 179555 998001",
"output": "963781"
},
{
"input": "53\n280988 756430 -515570 -248578 170649 -21608 642677 216770 827291 589500 940901 216097 -118956 -919104 -319264 -761585 289479 499613 588276 883036 480518 -323196 -274570 -406556 -381484 -956025 702135 -445274 -783543 136593 153664 897473 352651 737974 -21123 -284944 501734 898033 604429 624138 40804 248782 -786059 -304592 -209210 -312904 419820 -328648 -47331 -919227 -280955 104827 877304",
"output": "940901"
},
{
"input": "15\n256 -227055 427717 827239 462070 66049 987533 -175306 -552810 -867915 -408251 -693957 -972981 -245827 896904",
"output": "987533"
},
{
"input": "3\n-1 1 0",
"output": "-1"
},
{
"input": "2\n0 -5",
"output": "-5"
},
{
"input": "3\n-1 -2 0",
"output": "-1"
},
{
"input": "2\n-5 0",
"output": "-5"
},
{
"input": "1\n-439",
"output": "-439"
},
{
"input": "1\n-1000000",
"output": "-1000000"
},
{
"input": "1\n-917455",
"output": "-917455"
},
{
"input": "3\n1 1 -1",
"output": "-1"
},
{
"input": "2\n131073 1",
"output": "131073"
},
{
"input": "2\n99999 3",
"output": "99999"
},
{
"input": "2\n-524272 -1000000",
"output": "-524272"
},
{
"input": "2\n15 131073",
"output": "131073"
}
] | 1,638,293,052 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 13 | 46 | 0 | import sys
n = int(input())
values = sorted(list(map(int, input().split())), reverse=True)
if values[0] < 0:
print(values[0])
sys.exit(0)
for n in values:
if n > 0 and n != (int(n ** 0.5) ** 2):
print(n)
break
| Title: Perfect Squares
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Given an array *a*1,<=*a*2,<=...,<=*a**n* of *n* integers, find the largest number in the array that is not a perfect square.
A number *x* is said to be a perfect square if there exists an integer *y* such that *x*<==<=*y*2.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of elements in the array.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (<=-<=106<=≤<=*a**i*<=≤<=106) — the elements of the array.
It is guaranteed that at least one element of the array is not a perfect square.
Output Specification:
Print the largest number in the array which is not a perfect square. It is guaranteed that an answer always exists.
Demo Input:
['2\n4 2\n', '8\n1 2 4 8 16 32 64 576\n']
Demo Output:
['2\n', '32\n']
Note:
In the first sample case, 4 is a perfect square, so the largest number in the array that is not a perfect square is 2. | ```python
import sys
n = int(input())
values = sorted(list(map(int, input().split())), reverse=True)
if values[0] < 0:
print(values[0])
sys.exit(0)
for n in values:
if n > 0 and n != (int(n ** 0.5) ** 2):
print(n)
break
``` | 0 |
|
50 | A | Domino piling | PROGRAMMING | 800 | [
"greedy",
"math"
] | A. Domino piling | 2 | 256 | You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions. | In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16). | Output one number — the maximal number of dominoes, which can be placed. | [
"2 4\n",
"3 3\n"
] | [
"4\n",
"4\n"
] | none | 500 | [
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,644,349,403 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 62 | 0 | en = int(input())
boy = int(input())
alan = en*boy
print(alan//2) | Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none | ```python
en = int(input())
boy = int(input())
alan = en*boy
print(alan//2)
``` | -1 |
69 | A | Young Physicist | PROGRAMMING | 1,000 | [
"implementation",
"math"
] | A. Young Physicist | 2 | 256 | A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces. | The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100). | Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not. | [
"3\n4 1 7\n-2 4 -1\n1 -5 -3\n",
"3\n3 -1 7\n-5 2 -4\n2 -1 -3\n"
] | [
"NO",
"YES"
] | none | 500 | [
{
"input": "3\n4 1 7\n-2 4 -1\n1 -5 -3",
"output": "NO"
},
{
"input": "3\n3 -1 7\n-5 2 -4\n2 -1 -3",
"output": "YES"
},
{
"input": "10\n21 32 -46\n43 -35 21\n42 2 -50\n22 40 20\n-27 -9 38\n-4 1 1\n-40 6 -31\n-13 -2 34\n-21 34 -12\n-32 -29 41",
"output": "NO"
},
{
"input": "10\n25 -33 43\n-27 -42 28\n-35 -20 19\n41 -42 -1\n49 -39 -4\n-49 -22 7\n-19 29 41\n8 -27 -43\n8 34 9\n-11 -3 33",
"output": "NO"
},
{
"input": "10\n-6 21 18\n20 -11 -8\n37 -11 41\n-5 8 33\n29 23 32\n30 -33 -11\n39 -49 -36\n28 34 -49\n22 29 -34\n-18 -6 7",
"output": "NO"
},
{
"input": "10\n47 -2 -27\n0 26 -14\n5 -12 33\n2 18 3\n45 -30 -49\n4 -18 8\n-46 -44 -41\n-22 -10 -40\n-35 -21 26\n33 20 38",
"output": "NO"
},
{
"input": "13\n-3 -36 -46\n-11 -50 37\n42 -11 -15\n9 42 44\n-29 -12 24\n3 9 -40\n-35 13 50\n14 43 18\n-13 8 24\n-48 -15 10\n50 9 -50\n21 0 -50\n0 0 -6",
"output": "YES"
},
{
"input": "14\n43 23 17\n4 17 44\n5 -5 -16\n-43 -7 -6\n47 -48 12\n50 47 -45\n2 14 43\n37 -30 15\n4 -17 -11\n17 9 -45\n-50 -3 -8\n-50 0 0\n-50 0 0\n-16 0 0",
"output": "YES"
},
{
"input": "13\n29 49 -11\n38 -11 -20\n25 1 -40\n-11 28 11\n23 -19 1\n45 -41 -17\n-3 0 -19\n-13 -33 49\n-30 0 28\n34 17 45\n-50 9 -27\n-50 0 0\n-37 0 0",
"output": "YES"
},
{
"input": "12\n3 28 -35\n-32 -44 -17\n9 -25 -6\n-42 -22 20\n-19 15 38\n-21 38 48\n-1 -37 -28\n-10 -13 -50\n-5 21 29\n34 28 50\n50 11 -49\n34 0 0",
"output": "YES"
},
{
"input": "37\n-64 -79 26\n-22 59 93\n-5 39 -12\n77 -9 76\n55 -86 57\n83 100 -97\n-70 94 84\n-14 46 -94\n26 72 35\n14 78 -62\n17 82 92\n-57 11 91\n23 15 92\n-80 -1 1\n12 39 18\n-23 -99 -75\n-34 50 19\n-39 84 -7\n45 -30 -39\n-60 49 37\n45 -16 -72\n33 -51 -56\n-48 28 5\n97 91 88\n45 -82 -11\n-21 -15 -90\n-53 73 -26\n-74 85 -90\n-40 23 38\n100 -13 49\n32 -100 -100\n0 -100 -70\n0 -100 0\n0 -100 0\n0 -100 0\n0 -100 0\n0 -37 0",
"output": "YES"
},
{
"input": "4\n68 3 100\n68 21 -100\n-100 -24 0\n-36 0 0",
"output": "YES"
},
{
"input": "33\n-1 -46 -12\n45 -16 -21\n-11 45 -21\n-60 -42 -93\n-22 -45 93\n37 96 85\n-76 26 83\n-4 9 55\n7 -52 -9\n66 8 -85\n-100 -54 11\n-29 59 74\n-24 12 2\n-56 81 85\n-92 69 -52\n-26 -97 91\n54 59 -51\n58 21 -57\n7 68 56\n-47 -20 -51\n-59 77 -13\n-85 27 91\n79 60 -56\n66 -80 5\n21 -99 42\n-31 -29 98\n66 93 76\n-49 45 61\n100 -100 -100\n100 -100 -100\n66 -75 -100\n0 0 -100\n0 0 -87",
"output": "YES"
},
{
"input": "3\n1 2 3\n3 2 1\n0 0 0",
"output": "NO"
},
{
"input": "2\n5 -23 12\n0 0 0",
"output": "NO"
},
{
"input": "1\n0 0 0",
"output": "YES"
},
{
"input": "1\n1 -2 0",
"output": "NO"
},
{
"input": "2\n-23 77 -86\n23 -77 86",
"output": "YES"
},
{
"input": "26\n86 7 20\n-57 -64 39\n-45 6 -93\n-44 -21 100\n-11 -49 21\n73 -71 -80\n-2 -89 56\n-65 -2 7\n5 14 84\n57 41 13\n-12 69 54\n40 -25 27\n-17 -59 0\n64 -91 -30\n-53 9 42\n-54 -8 14\n-35 82 27\n-48 -59 -80\n88 70 79\n94 57 97\n44 63 25\n84 -90 -40\n-100 100 -100\n-92 100 -100\n0 10 -100\n0 0 -82",
"output": "YES"
},
{
"input": "42\n11 27 92\n-18 -56 -57\n1 71 81\n33 -92 30\n82 83 49\n-87 -61 -1\n-49 45 49\n73 26 15\n-22 22 -77\n29 -93 87\n-68 44 -90\n-4 -84 20\n85 67 -6\n-39 26 77\n-28 -64 20\n65 -97 24\n-72 -39 51\n35 -75 -91\n39 -44 -8\n-25 -27 -57\n91 8 -46\n-98 -94 56\n94 -60 59\n-9 -95 18\n-53 -37 98\n-8 -94 -84\n-52 55 60\n15 -14 37\n65 -43 -25\n94 12 66\n-8 -19 -83\n29 81 -78\n-58 57 33\n24 86 -84\n-53 32 -88\n-14 7 3\n89 97 -53\n-5 -28 -91\n-100 100 -6\n-84 100 0\n0 100 0\n0 70 0",
"output": "YES"
},
{
"input": "3\n96 49 -12\n2 -66 28\n-98 17 -16",
"output": "YES"
},
{
"input": "5\n70 -46 86\n-100 94 24\n-27 63 -63\n57 -100 -47\n0 -11 0",
"output": "YES"
},
{
"input": "18\n-86 -28 70\n-31 -89 42\n31 -48 -55\n95 -17 -43\n24 -95 -85\n-21 -14 31\n68 -18 81\n13 31 60\n-15 28 99\n-42 15 9\n28 -61 -62\n-16 71 29\n-28 75 -48\n-77 -67 36\n-100 83 89\n100 100 -100\n57 34 -100\n0 0 -53",
"output": "YES"
},
{
"input": "44\n52 -54 -29\n-82 -5 -94\n-54 43 43\n91 16 71\n7 80 -91\n3 15 29\n-99 -6 -77\n-3 -77 -64\n73 67 34\n25 -10 -18\n-29 91 63\n-72 86 -16\n-68 85 -81\n-3 36 44\n-74 -14 -80\n34 -96 -97\n-76 -78 -33\n-24 44 -58\n98 12 77\n95 -63 -6\n-51 3 -90\n-92 -10 72\n7 3 -68\n57 -53 71\n29 57 -48\n35 -60 10\n79 -70 -61\n-20 77 55\n-86 -15 -35\n84 -88 -18\n100 -42 77\n-20 46 8\n-41 -43 -65\n38 -98 -23\n-100 65 45\n-7 -91 -63\n46 88 -85\n48 59 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 100\n0 0 1",
"output": "YES"
},
{
"input": "18\n-14 -64 -91\n-8 -66 -86\n-23 92 -40\n6 -3 -53\n57 41 78\n-79 42 -22\n-88 -17 45\n4 -45 44\n83 -18 -25\n34 86 -92\n75 -30 12\n44 99 11\n-67 -13 72\n22 83 -56\n-37 71 72\n-9 -100 100\n0 -100 31\n0 -58 0",
"output": "YES"
},
{
"input": "23\n-70 37 78\n42 84 6\n28 -94 -24\n-49 76 95\n-67 18 84\n-53 78 -5\n65 -63 -64\n-66 -64 -69\n81 -93 95\n10 52 -79\n-89 -61 -64\n-64 -47 43\n-81 -35 55\n80 82 73\n-60 -81 -18\n49 -10 -19\n-58 70 12\n-24 -15 -93\n98 -93 -54\n-28 -75 11\n100 100 -63\n100 100 0\n56 34 0",
"output": "YES"
},
{
"input": "3\n0 2 -2\n1 -1 3\n-3 0 0",
"output": "NO"
}
] | 1,632,804,534 | 2,147,483,647 | Python 3 | OK | TESTS | 81 | 124 | 6,963,200 | n=int(input())
matrix=[]
l1=[]
for i in range(n):
l1=[int(x) for x in input().split()]
matrix.append(l1)
for i in range(3):
sum=0
for j in range(n):
sum=sum+matrix[j][i]
if sum==0:
res=1
continue
else:
res=0
break
if res==1:
print("YES")
else:
print("NO") | Title: Young Physicist
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
A guy named Vasya attends the final grade of a high school. One day Vasya decided to watch a match of his favorite hockey team. And, as the boy loves hockey very much, even more than physics, he forgot to do the homework. Specifically, he forgot to complete his physics tasks. Next day the teacher got very angry at Vasya and decided to teach him a lesson. He gave the lazy student a seemingly easy task: You are given an idle body in space and the forces that affect it. The body can be considered as a material point with coordinates (0; 0; 0). Vasya had only to answer whether it is in equilibrium. "Piece of cake" — thought Vasya, we need only to check if the sum of all vectors is equal to 0. So, Vasya began to solve the problem. But later it turned out that there can be lots and lots of these forces, and Vasya can not cope without your help. Help him. Write a program that determines whether a body is idle or is moving by the given vectors of forces.
Input Specification:
The first line contains a positive integer *n* (1<=≤<=*n*<=≤<=100), then follow *n* lines containing three integers each: the *x**i* coordinate, the *y**i* coordinate and the *z**i* coordinate of the force vector, applied to the body (<=-<=100<=≤<=*x**i*,<=*y**i*,<=*z**i*<=≤<=100).
Output Specification:
Print the word "YES" if the body is in equilibrium, or the word "NO" if it is not.
Demo Input:
['3\n4 1 7\n-2 4 -1\n1 -5 -3\n', '3\n3 -1 7\n-5 2 -4\n2 -1 -3\n']
Demo Output:
['NO', 'YES']
Note:
none | ```python
n=int(input())
matrix=[]
l1=[]
for i in range(n):
l1=[int(x) for x in input().split()]
matrix.append(l1)
for i in range(3):
sum=0
for j in range(n):
sum=sum+matrix[j][i]
if sum==0:
res=1
continue
else:
res=0
break
if res==1:
print("YES")
else:
print("NO")
``` | 3.95603 |
237 | A | Free Cash | PROGRAMMING | 1,000 | [
"implementation"
] | null | null | Valera runs a 24/7 fast food cafe. He magically learned that next day *n* people will visit his cafe. For each person we know the arrival time: the *i*-th person comes exactly at *h**i* hours *m**i* minutes. The cafe spends less than a minute to serve each client, but if a client comes in and sees that there is no free cash, than he doesn't want to wait and leaves the cafe immediately.
Valera is very greedy, so he wants to serve all *n* customers next day (and get more profit). However, for that he needs to ensure that at each moment of time the number of working cashes is no less than the number of clients in the cafe.
Help Valera count the minimum number of cashes to work at his cafe next day, so that they can serve all visitors. | The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), that is the number of cafe visitors.
Each of the following *n* lines has two space-separated integers *h**i* and *m**i* (0<=≤<=*h**i*<=≤<=23; 0<=≤<=*m**i*<=≤<=59), representing the time when the *i*-th person comes into the cafe.
Note that the time is given in the chronological order. All time is given within one 24-hour period. | Print a single integer — the minimum number of cashes, needed to serve all clients next day. | [
"4\n8 0\n8 10\n8 10\n8 45\n",
"3\n0 12\n10 11\n22 22\n"
] | [
"2\n",
"1\n"
] | In the first sample it is not enough one cash to serve all clients, because two visitors will come into cafe in 8:10. Therefore, if there will be one cash in cafe, then one customer will be served by it, and another one will not wait and will go away.
In the second sample all visitors will come in different times, so it will be enough one cash. | 500 | [
{
"input": "4\n8 0\n8 10\n8 10\n8 45",
"output": "2"
},
{
"input": "3\n0 12\n10 11\n22 22",
"output": "1"
},
{
"input": "5\n12 8\n15 27\n15 27\n16 2\n19 52",
"output": "2"
},
{
"input": "7\n5 6\n7 34\n7 34\n7 34\n12 29\n15 19\n20 23",
"output": "3"
},
{
"input": "8\n0 36\n4 7\n4 7\n4 7\n11 46\n12 4\n15 39\n18 6",
"output": "3"
},
{
"input": "20\n4 12\n4 21\n4 27\n4 56\n5 55\n7 56\n11 28\n11 36\n14 58\n15 59\n16 8\n17 12\n17 23\n17 23\n17 23\n17 23\n17 23\n17 23\n20 50\n22 32",
"output": "6"
},
{
"input": "10\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30\n1 30",
"output": "10"
},
{
"input": "50\n0 23\n1 21\n2 8\n2 45\n3 1\n4 19\n4 37\n7 7\n7 40\n8 43\n9 51\n10 13\n11 2\n11 19\n11 30\n12 37\n12 37\n12 37\n12 37\n12 37\n12 37\n12 37\n12 37\n12 54\n13 32\n13 42\n14 29\n14 34\n14 48\n15 0\n15 27\n16 22\n16 31\n17 25\n17 26\n17 33\n18 14\n18 16\n18 20\n19 0\n19 5\n19 56\n20 22\n21 26\n22 0\n22 10\n22 11\n22 36\n23 17\n23 20",
"output": "8"
},
{
"input": "10\n0 39\n1 35\n1 49\n1 51\n5 24\n7 40\n7 56\n16 42\n23 33\n23 49",
"output": "1"
},
{
"input": "15\n0 16\n6 15\n8 2\n8 6\n8 7\n10 1\n10 1\n10 3\n10 12\n13 5\n14 16\n14 16\n14 16\n14 16\n14 16",
"output": "5"
},
{
"input": "2\n0 24\n1 0",
"output": "1"
},
{
"input": "1\n0 0",
"output": "1"
},
{
"input": "1\n1 5",
"output": "1"
},
{
"input": "1\n1 1",
"output": "1"
},
{
"input": "3\n0 0\n0 0\n0 0",
"output": "3"
},
{
"input": "1\n5 0",
"output": "1"
},
{
"input": "5\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "5"
},
{
"input": "1\n10 10",
"output": "1"
},
{
"input": "1\n8 0",
"output": "1"
},
{
"input": "10\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0\n0 0",
"output": "10"
},
{
"input": "2\n0 0\n0 1",
"output": "1"
},
{
"input": "2\n8 5\n8 5",
"output": "2"
}
] | 1,607,362,656 | 2,147,483,647 | PyPy 3 | TIME_LIMIT_EXCEEDED | TESTS | 9 | 2,000 | 9,113,600 | n = int(input())
a = []
k = 0
for i in range(n):
h,m = map(int,input().split())
a.append(h*60+m)
for i in set(a):
if a.count(i) > k:
k = a.count(i)
print(1 if not k else k)
| Title: Free Cash
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera runs a 24/7 fast food cafe. He magically learned that next day *n* people will visit his cafe. For each person we know the arrival time: the *i*-th person comes exactly at *h**i* hours *m**i* minutes. The cafe spends less than a minute to serve each client, but if a client comes in and sees that there is no free cash, than he doesn't want to wait and leaves the cafe immediately.
Valera is very greedy, so he wants to serve all *n* customers next day (and get more profit). However, for that he needs to ensure that at each moment of time the number of working cashes is no less than the number of clients in the cafe.
Help Valera count the minimum number of cashes to work at his cafe next day, so that they can serve all visitors.
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=105), that is the number of cafe visitors.
Each of the following *n* lines has two space-separated integers *h**i* and *m**i* (0<=≤<=*h**i*<=≤<=23; 0<=≤<=*m**i*<=≤<=59), representing the time when the *i*-th person comes into the cafe.
Note that the time is given in the chronological order. All time is given within one 24-hour period.
Output Specification:
Print a single integer — the minimum number of cashes, needed to serve all clients next day.
Demo Input:
['4\n8 0\n8 10\n8 10\n8 45\n', '3\n0 12\n10 11\n22 22\n']
Demo Output:
['2\n', '1\n']
Note:
In the first sample it is not enough one cash to serve all clients, because two visitors will come into cafe in 8:10. Therefore, if there will be one cash in cafe, then one customer will be served by it, and another one will not wait and will go away.
In the second sample all visitors will come in different times, so it will be enough one cash. | ```python
n = int(input())
a = []
k = 0
for i in range(n):
h,m = map(int,input().split())
a.append(h*60+m)
for i in set(a):
if a.count(i) > k:
k = a.count(i)
print(1 if not k else k)
``` | 0 |
|
977 | A | Wrong Subtraction | PROGRAMMING | 800 | [
"implementation"
] | null | null | Little girl Tanya is learning how to decrease a number by one, but she does it wrong with a number consisting of two or more digits. Tanya subtracts one from a number by the following algorithm:
- if the last digit of the number is non-zero, she decreases the number by one; - if the last digit of the number is zero, she divides the number by 10 (i.e. removes the last digit).
You are given an integer number $n$. Tanya will subtract one from it $k$ times. Your task is to print the result after all $k$ subtractions.
It is guaranteed that the result will be positive integer number. | The first line of the input contains two integer numbers $n$ and $k$ ($2 \le n \le 10^9$, $1 \le k \le 50$) — the number from which Tanya will subtract and the number of subtractions correspondingly. | Print one integer number — the result of the decreasing $n$ by one $k$ times.
It is guaranteed that the result will be positive integer number. | [
"512 4\n",
"1000000000 9\n"
] | [
"50\n",
"1\n"
] | The first example corresponds to the following sequence: $512 \rightarrow 511 \rightarrow 510 \rightarrow 51 \rightarrow 50$. | 0 | [
{
"input": "512 4",
"output": "50"
},
{
"input": "1000000000 9",
"output": "1"
},
{
"input": "131203 11",
"output": "12"
},
{
"input": "999999999 50",
"output": "9999"
},
{
"input": "999999999 49",
"output": "99990"
},
{
"input": "131203 9",
"output": "130"
},
{
"input": "900000000 16",
"output": "1"
},
{
"input": "909090909 50",
"output": "3"
},
{
"input": "1001 2",
"output": "100"
},
{
"input": "5 2",
"output": "3"
},
{
"input": "2 1",
"output": "1"
}
] | 1,695,537,933 | 2,147,483,647 | Python 3 | OK | TESTS | 11 | 46 | 0 | num, r = map(int, input().split())
for _ in range(r):
if num%10 == 0:
num = num//10
else:
num -= 1
print(num) | Title: Wrong Subtraction
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little girl Tanya is learning how to decrease a number by one, but she does it wrong with a number consisting of two or more digits. Tanya subtracts one from a number by the following algorithm:
- if the last digit of the number is non-zero, she decreases the number by one; - if the last digit of the number is zero, she divides the number by 10 (i.e. removes the last digit).
You are given an integer number $n$. Tanya will subtract one from it $k$ times. Your task is to print the result after all $k$ subtractions.
It is guaranteed that the result will be positive integer number.
Input Specification:
The first line of the input contains two integer numbers $n$ and $k$ ($2 \le n \le 10^9$, $1 \le k \le 50$) — the number from which Tanya will subtract and the number of subtractions correspondingly.
Output Specification:
Print one integer number — the result of the decreasing $n$ by one $k$ times.
It is guaranteed that the result will be positive integer number.
Demo Input:
['512 4\n', '1000000000 9\n']
Demo Output:
['50\n', '1\n']
Note:
The first example corresponds to the following sequence: $512 \rightarrow 511 \rightarrow 510 \rightarrow 51 \rightarrow 50$. | ```python
num, r = map(int, input().split())
for _ in range(r):
if num%10 == 0:
num = num//10
else:
num -= 1
print(num)
``` | 3 |
|
462 | A | Appleman and Easy Task | PROGRAMMING | 1,000 | [
"brute force",
"implementation"
] | null | null | Toastman came up with a very easy task. He gives it to Appleman, but Appleman doesn't know how to solve it. Can you help him?
Given a *n*<=×<=*n* checkerboard. Each cell of the board has either character 'x', or character 'o'. Is it true that each cell of the board has even number of adjacent cells with 'o'? Two cells of the board are adjacent if they share a side. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Then *n* lines follow containing the description of the checkerboard. Each of them contains *n* characters (either 'x' or 'o') without spaces. | Print "YES" or "NO" (without the quotes) depending on the answer to the problem. | [
"3\nxxo\nxox\noxx\n",
"4\nxxxo\nxoxo\noxox\nxxxx\n"
] | [
"YES\n",
"NO\n"
] | none | 500 | [
{
"input": "3\nxxo\nxox\noxx",
"output": "YES"
},
{
"input": "4\nxxxo\nxoxo\noxox\nxxxx",
"output": "NO"
},
{
"input": "1\no",
"output": "YES"
},
{
"input": "2\nox\nxo",
"output": "YES"
},
{
"input": "2\nxx\nxo",
"output": "NO"
},
{
"input": "3\nooo\noxo\nxoo",
"output": "NO"
},
{
"input": "3\nxxx\nxxo\nxxo",
"output": "NO"
},
{
"input": "4\nxooo\nooxo\noxoo\nooox",
"output": "YES"
},
{
"input": "4\noooo\noxxo\nxoxo\noooo",
"output": "NO"
},
{
"input": "5\noxoxo\nxxxxx\noxoxo\nxxxxx\noxoxo",
"output": "YES"
},
{
"input": "5\nxxxox\nxxxxo\nxoxox\noxoxx\nxoxxx",
"output": "NO"
},
{
"input": "10\nxoxooooooo\noxxoxxxxxo\nxxooxoooxo\noooxxoxoxo\noxxxooooxo\noxooooxxxo\noxoxoxxooo\noxoooxooxx\noxxxxxoxxo\noooooooxox",
"output": "YES"
},
{
"input": "10\nxxxxxxxoox\nxooxxooooo\noxoooxxooo\nxoxxxxxxxx\nxxoxooxxox\nooxoxxooox\nooxxxxxooo\nxxxxoxooox\nxoxxooxxxx\noooooxxoxo",
"output": "NO"
},
{
"input": "19\noxoxoxoxooxoooxxoox\nxxxxxxxxoxxoxoooooo\noxoxoxooxxxooxxxooo\nxxoxxxooxooxxxoxxox\noxoxooxxxooooxxoxox\nxxxoooxoxxoxxoxxxoo\noxooxxxoooooxxoooxo\nxxooxooxoxxoxxoxxoo\noxxxxooooxxxooooxxx\nooxooxoxxoxxoxooxoo\nxxxooooxxxooooxoxox\noooxoxooxxoxooxooxx\nxxoooxxxooooxxoooxo\nooxxxooxoxooxooxxxx\nxoxoxxooxoxxxooxoxo\nxoxxoxoxooxooxxxxxx\noooxxxooxxxooxoxoxo\nxoooooxoxooxxxxxxxo\nxooxxoooxxoxoxoxoxx",
"output": "NO"
},
{
"input": "12\nxxooxxoxxxoo\nxxoooxoxoxoo\nooxoxoxxooxx\nooxxooooxoxo\nxxxxxxxxoxxx\noxooooxxxooo\noxxoxoxoooxx\nxxxxxxxooxox\noxoooooxoxxx\nxxooxxoxxoxx\noxxxxxxxooxx\nooxoxooxxooo",
"output": "NO"
},
{
"input": "2\noo\nxx",
"output": "NO"
}
] | 1,558,707,296 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 3 | 93 | 0 | #codeforces462A
gi = lambda : list(map(int,input().strip().split()))
n, = gi()
g = [list(input()) for _ in range(n)]
g = [[0 if e[k] == 'x' else 1 for k in range(n)] for e in g]
for k in range(n):
for j in range(n):
temp = 0
try:
temp += g[k][j+1]
except Exception:
temp += 0
try:
temp += g[k][j-1]
except Exception:
temp += 0
try:
temp += g[k+1][j]
except Exception:
temp += 0
try:
temp += g[k-1][j]
except Exception:
temp += 0
if temp%2:
print("NO")
exit();
print("YES") | Title: Appleman and Easy Task
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Toastman came up with a very easy task. He gives it to Appleman, but Appleman doesn't know how to solve it. Can you help him?
Given a *n*<=×<=*n* checkerboard. Each cell of the board has either character 'x', or character 'o'. Is it true that each cell of the board has even number of adjacent cells with 'o'? Two cells of the board are adjacent if they share a side.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100). Then *n* lines follow containing the description of the checkerboard. Each of them contains *n* characters (either 'x' or 'o') without spaces.
Output Specification:
Print "YES" or "NO" (without the quotes) depending on the answer to the problem.
Demo Input:
['3\nxxo\nxox\noxx\n', '4\nxxxo\nxoxo\noxox\nxxxx\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none | ```python
#codeforces462A
gi = lambda : list(map(int,input().strip().split()))
n, = gi()
g = [list(input()) for _ in range(n)]
g = [[0 if e[k] == 'x' else 1 for k in range(n)] for e in g]
for k in range(n):
for j in range(n):
temp = 0
try:
temp += g[k][j+1]
except Exception:
temp += 0
try:
temp += g[k][j-1]
except Exception:
temp += 0
try:
temp += g[k+1][j]
except Exception:
temp += 0
try:
temp += g[k-1][j]
except Exception:
temp += 0
if temp%2:
print("NO")
exit();
print("YES")
``` | 0 |
|
313 | A | Ilya and Bank Account | PROGRAMMING | 900 | [
"implementation",
"number theory"
] | null | null | Ilya is a very clever lion, he lives in an unusual city ZooVille. In this city all the animals have their rights and obligations. Moreover, they even have their own bank accounts. The state of a bank account is an integer. The state of a bank account can be a negative number. This means that the owner of the account owes the bank money.
Ilya the Lion has recently had a birthday, so he got a lot of gifts. One of them (the gift of the main ZooVille bank) is the opportunity to delete the last digit or the digit before last from the state of his bank account no more than once. For example, if the state of Ilya's bank account is -123, then Ilya can delete the last digit and get his account balance equal to -12, also he can remove its digit before last and get the account balance equal to -13. Of course, Ilya is permitted not to use the opportunity to delete a digit from the balance.
Ilya is not very good at math, and that's why he asks you to help him maximize his bank account. Find the maximum state of the bank account that can be obtained using the bank's gift. | The single line contains integer *n* (10<=≤<=|*n*|<=≤<=109) — the state of Ilya's bank account. | In a single line print an integer — the maximum state of the bank account that Ilya can get. | [
"2230\n",
"-10\n",
"-100003\n"
] | [
"2230\n",
"0\n",
"-10000\n"
] | In the first test sample Ilya doesn't profit from using the present.
In the second test sample you can delete digit 1 and get the state of the account equal to 0. | 500 | [
{
"input": "2230",
"output": "2230"
},
{
"input": "-10",
"output": "0"
},
{
"input": "-100003",
"output": "-10000"
},
{
"input": "544883178",
"output": "544883178"
},
{
"input": "-847251738",
"output": "-84725173"
},
{
"input": "423654797",
"output": "423654797"
},
{
"input": "-623563697",
"output": "-62356367"
},
{
"input": "645894116",
"output": "645894116"
},
{
"input": "-384381709",
"output": "-38438170"
},
{
"input": "437587210",
"output": "437587210"
},
{
"input": "-297534606",
"output": "-29753460"
},
{
"input": "891773002",
"output": "891773002"
},
{
"input": "-56712976",
"output": "-5671296"
},
{
"input": "963662765",
"output": "963662765"
},
{
"input": "-272656295",
"output": "-27265625"
},
{
"input": "383441522",
"output": "383441522"
},
{
"input": "-477665112",
"output": "-47766511"
},
{
"input": "791725034",
"output": "791725034"
},
{
"input": "-812168727",
"output": "-81216872"
},
{
"input": "528894922",
"output": "528894922"
},
{
"input": "-479977172",
"output": "-47997712"
},
{
"input": "568044564",
"output": "568044564"
},
{
"input": "-392784794",
"output": "-39278474"
},
{
"input": "925596634",
"output": "925596634"
},
{
"input": "-836078769",
"output": "-83607876"
},
{
"input": "71036059",
"output": "71036059"
},
{
"input": "-337396162",
"output": "-33739612"
},
{
"input": "87129297",
"output": "87129297"
},
{
"input": "-648171877",
"output": "-64817187"
},
{
"input": "20218400",
"output": "20218400"
},
{
"input": "10",
"output": "10"
},
{
"input": "1000000000",
"output": "1000000000"
},
{
"input": "-1000000000",
"output": "-100000000"
},
{
"input": "-102",
"output": "-10"
},
{
"input": "-120",
"output": "-10"
},
{
"input": "-20",
"output": "0"
},
{
"input": "-15",
"output": "-1"
},
{
"input": "-5575533",
"output": "-557553"
},
{
"input": "-50",
"output": "0"
},
{
"input": "-31",
"output": "-1"
},
{
"input": "-55",
"output": "-5"
},
{
"input": "-81",
"output": "-1"
},
{
"input": "-99",
"output": "-9"
},
{
"input": "-23",
"output": "-2"
},
{
"input": "-41",
"output": "-1"
},
{
"input": "-24",
"output": "-2"
},
{
"input": "46",
"output": "46"
}
] | 1,687,961,270 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 32 | 92 | 0 | n = int(input())
if n > 0:
print(max(n, n // 10, int((str(n // 100)+str(n % 10)))))
else:
print(max(n, n // 10 + 1, int((str(n // 100 + 1)+str(abs(n) % 10))))) | Title: Ilya and Bank Account
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Ilya is a very clever lion, he lives in an unusual city ZooVille. In this city all the animals have their rights and obligations. Moreover, they even have their own bank accounts. The state of a bank account is an integer. The state of a bank account can be a negative number. This means that the owner of the account owes the bank money.
Ilya the Lion has recently had a birthday, so he got a lot of gifts. One of them (the gift of the main ZooVille bank) is the opportunity to delete the last digit or the digit before last from the state of his bank account no more than once. For example, if the state of Ilya's bank account is -123, then Ilya can delete the last digit and get his account balance equal to -12, also he can remove its digit before last and get the account balance equal to -13. Of course, Ilya is permitted not to use the opportunity to delete a digit from the balance.
Ilya is not very good at math, and that's why he asks you to help him maximize his bank account. Find the maximum state of the bank account that can be obtained using the bank's gift.
Input Specification:
The single line contains integer *n* (10<=≤<=|*n*|<=≤<=109) — the state of Ilya's bank account.
Output Specification:
In a single line print an integer — the maximum state of the bank account that Ilya can get.
Demo Input:
['2230\n', '-10\n', '-100003\n']
Demo Output:
['2230\n', '0\n', '-10000\n']
Note:
In the first test sample Ilya doesn't profit from using the present.
In the second test sample you can delete digit 1 and get the state of the account equal to 0. | ```python
n = int(input())
if n > 0:
print(max(n, n // 10, int((str(n // 100)+str(n % 10)))))
else:
print(max(n, n // 10 + 1, int((str(n // 100 + 1)+str(abs(n) % 10)))))
``` | 0 |
|
705 | A | Hulk | PROGRAMMING | 800 | [
"implementation"
] | null | null | Dr. Bruce Banner hates his enemies (like others don't). As we all know, he can barely talk when he turns into the incredible Hulk. That's why he asked you to help him to express his feelings.
Hulk likes the Inception so much, and like that his feelings are complicated. They have *n* layers. The first layer is hate, second one is love, third one is hate and so on...
For example if *n*<==<=1, then his feeling is "I hate it" or if *n*<==<=2 it's "I hate that I love it", and if *n*<==<=3 it's "I hate that I love that I hate it" and so on.
Please help Dr. Banner. | The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of layers of love and hate. | Print Dr.Banner's feeling in one line. | [
"1\n",
"2\n",
"3\n"
] | [
"I hate it\n",
"I hate that I love it\n",
"I hate that I love that I hate it\n"
] | none | 500 | [
{
"input": "1",
"output": "I hate it"
},
{
"input": "2",
"output": "I hate that I love it"
},
{
"input": "3",
"output": "I hate that I love that I hate it"
},
{
"input": "4",
"output": "I hate that I love that I hate that I love it"
},
{
"input": "5",
"output": "I hate that I love that I hate that I love that I hate it"
},
{
"input": "10",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it"
},
{
"input": "18",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it"
},
{
"input": "19",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate it"
},
{
"input": "76",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "77",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "81",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "82",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "85",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "86",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "100",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "99",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "98",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "33",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate it"
},
{
"input": "34",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it"
},
{
"input": "57",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "100",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
}
] | 1,698,950,173 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 3 | 31 | 0 | n = int(input())
if n == 1: print('I hate it')
elif n == 2: print('I hate that I love it')
elif n == 3 : print('I hate that I love that I hate it')
| Title: Hulk
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dr. Bruce Banner hates his enemies (like others don't). As we all know, he can barely talk when he turns into the incredible Hulk. That's why he asked you to help him to express his feelings.
Hulk likes the Inception so much, and like that his feelings are complicated. They have *n* layers. The first layer is hate, second one is love, third one is hate and so on...
For example if *n*<==<=1, then his feeling is "I hate it" or if *n*<==<=2 it's "I hate that I love it", and if *n*<==<=3 it's "I hate that I love that I hate it" and so on.
Please help Dr. Banner.
Input Specification:
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of layers of love and hate.
Output Specification:
Print Dr.Banner's feeling in one line.
Demo Input:
['1\n', '2\n', '3\n']
Demo Output:
['I hate it\n', 'I hate that I love it\n', 'I hate that I love that I hate it\n']
Note:
none | ```python
n = int(input())
if n == 1: print('I hate it')
elif n == 2: print('I hate that I love it')
elif n == 3 : print('I hate that I love that I hate it')
``` | 0 |
|
288 | E | Polo the Penguin and Lucky Numbers | PROGRAMMING | 2,800 | [
"dp",
"implementation",
"math"
] | null | null | Everybody knows that lucky numbers are positive integers that contain only lucky digits 4 and 7 in their decimal representation. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Polo the Penguin have two positive integers *l* and *r* (*l*<=<<=*r*), both of them are lucky numbers. Moreover, their lengths (that is, the number of digits in the decimal representation without the leading zeroes) are equal to each other.
Let's assume that *n* is the number of distinct lucky numbers, each of them cannot be greater than *r* or less than *l*, and *a**i* is the *i*-th (in increasing order) number of them. Find *a*1·*a*2<=+<=*a*2·*a*3<=+<=...<=+<=*a**n*<=-<=1·*a**n*. As the answer can be rather large, print the remainder after dividing it by 1000000007 (109<=+<=7). | The first line contains a positive integer *l*, and the second line contains a positive integer *r* (1<=≤<=*l*<=<<=*r*<=≤<=10100000). The numbers are given without any leading zeroes.
It is guaranteed that the lengths of the given numbers are equal to each other and that both of them are lucky numbers. | In the single line print a single integer — the answer to the problem modulo 1000000007 (109<=+<=7). | [
"4\n7\n",
"474\n777\n"
] | [
"28\n",
"2316330\n"
] | none | 2,500 | [
{
"input": "4\n7",
"output": "28"
},
{
"input": "474\n777",
"output": "2316330"
},
{
"input": "44\n77",
"output": "11244"
},
{
"input": "444\n777",
"output": "2726676"
},
{
"input": "444\n477",
"output": "636444"
},
{
"input": "444\n744",
"output": "991332"
},
{
"input": "47\n74",
"output": "3478"
},
{
"input": "447\n774",
"output": "1926810"
},
{
"input": "4444\n7777",
"output": "590030340"
},
{
"input": "44444\n77777",
"output": "401420814"
},
{
"input": "444444\n777777",
"output": "216989898"
},
{
"input": "44744\n74747",
"output": "345750711"
},
{
"input": "47774\n74777",
"output": "806413754"
},
{
"input": "47\n77",
"output": "9176"
},
{
"input": "474\n747",
"output": "1136754"
},
{
"input": "7447\n7744",
"output": "169443864"
},
{
"input": "74744\n74747",
"output": "586889733"
},
{
"input": "7447777\n7774477",
"output": "470497189"
},
{
"input": "747447\n777744",
"output": "395287121"
},
{
"input": "4477447744\n4477744774",
"output": "193612693"
},
{
"input": "77474444777444447747\n77777474474474447774",
"output": "406365121"
},
{
"input": "477744777477477\n777777744444747",
"output": "863368093"
},
{
"input": "47747447474\n47747477474",
"output": "390034001"
},
{
"input": "474777474447\n777474744747",
"output": "899484028"
},
{
"input": "4777474744774\n7444747447774",
"output": "708497142"
},
{
"input": "47447477777774\n47744474777744",
"output": "142029093"
},
{
"input": "44474444747774774747747747444744447477747774777\n74474447477474444747777474447474777774747444447",
"output": "959345026"
},
{
"input": "4477744777447747474474477774444744774447474774774444\n7447744774477777774777444747444447774774444747477744",
"output": "343981660"
},
{
"input": "47474747777477444447474477474774777747747777477777474477747477744477477474447447447747474477774744474744777777774477774774777744\n47777447444777474774477444747474477444777747774747477777774477474747447747447447474444474774774474747474777447747747477444774474",
"output": "648303833"
},
{
"input": "777444747747744474774447447747447477444777477777777774444777447477744474447477477447747777477477744\n777747774447774774444747747744447447447774447777744777447744447474474777747444444444747447744744777",
"output": "147071195"
}
] | 1,689,631,959 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 0 | 62 | 0 | print("_RANDOM_GUESS_1689631959.2502246")# 1689631959.250245 | Title: Polo the Penguin and Lucky Numbers
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Everybody knows that lucky numbers are positive integers that contain only lucky digits 4 and 7 in their decimal representation. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Polo the Penguin have two positive integers *l* and *r* (*l*<=<<=*r*), both of them are lucky numbers. Moreover, their lengths (that is, the number of digits in the decimal representation without the leading zeroes) are equal to each other.
Let's assume that *n* is the number of distinct lucky numbers, each of them cannot be greater than *r* or less than *l*, and *a**i* is the *i*-th (in increasing order) number of them. Find *a*1·*a*2<=+<=*a*2·*a*3<=+<=...<=+<=*a**n*<=-<=1·*a**n*. As the answer can be rather large, print the remainder after dividing it by 1000000007 (109<=+<=7).
Input Specification:
The first line contains a positive integer *l*, and the second line contains a positive integer *r* (1<=≤<=*l*<=<<=*r*<=≤<=10100000). The numbers are given without any leading zeroes.
It is guaranteed that the lengths of the given numbers are equal to each other and that both of them are lucky numbers.
Output Specification:
In the single line print a single integer — the answer to the problem modulo 1000000007 (109<=+<=7).
Demo Input:
['4\n7\n', '474\n777\n']
Demo Output:
['28\n', '2316330\n']
Note:
none | ```python
print("_RANDOM_GUESS_1689631959.2502246")# 1689631959.250245
``` | 0 |
|
1 | A | Theatre Square | PROGRAMMING | 1,000 | [
"math"
] | A. Theatre Square | 1 | 256 | Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square. | The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109). | Write the needed number of flagstones. | [
"6 6 4\n"
] | [
"4\n"
] | none | 0 | [
{
"input": "6 6 4",
"output": "4"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "2 1 1",
"output": "2"
},
{
"input": "1 2 1",
"output": "2"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "1 1 3",
"output": "1"
},
{
"input": "2 3 4",
"output": "1"
},
{
"input": "1000000000 1000000000 1",
"output": "1000000000000000000"
},
{
"input": "12 13 4",
"output": "12"
},
{
"input": "222 332 5",
"output": "3015"
},
{
"input": "1000 1000 10",
"output": "10000"
},
{
"input": "1001 1000 10",
"output": "10100"
},
{
"input": "100 10001 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 999999999",
"output": "4"
},
{
"input": "1000000000 1000000000 192",
"output": "27126743055556"
},
{
"input": "1000000000 987654321 1",
"output": "987654321000000000"
},
{
"input": "456784567 1000000000 51",
"output": "175618850864484"
},
{
"input": "39916800 134217728 40320",
"output": "3295710"
}
] | 1,661,976,559 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 1 | 30 | 0 | [n,m,a]=input().split()
if(int(n)%int(a)==0):
rows=int(n)/int(a)
else:
rows=(int(n)//int(a))+1
if(int(m)%int(a)==0):
col=int(m)/int(a)
else:
col=(int(m)//int(a))+1
print(rows*col)
| Title: Theatre Square
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
Input Specification:
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Output Specification:
Write the needed number of flagstones.
Demo Input:
['6 6 4\n']
Demo Output:
['4\n']
Note:
none | ```python
[n,m,a]=input().split()
if(int(n)%int(a)==0):
rows=int(n)/int(a)
else:
rows=(int(n)//int(a))+1
if(int(m)%int(a)==0):
col=int(m)/int(a)
else:
col=(int(m)//int(a))+1
print(rows*col)
``` | 0 |
875 | B | Sorting the Coins | PROGRAMMING | 1,500 | [
"dsu",
"implementation",
"sortings",
"two pointers"
] | null | null | Recently, Dima met with Sasha in a philatelic store, and since then they are collecting coins together. Their favorite occupation is to sort collections of coins. Sasha likes having things in order, that is why he wants his coins to be arranged in a row in such a way that firstly come coins out of circulation, and then come coins still in circulation.
For arranging coins Dima uses the following algorithm. One step of his algorithm looks like the following:
1. He looks through all the coins from left to right; 1. If he sees that the *i*-th coin is still in circulation, and (*i*<=+<=1)-th coin is already out of circulation, he exchanges these two coins and continues watching coins from (*i*<=+<=1)-th.
Dima repeats the procedure above until it happens that no two coins were exchanged during this procedure. Dima calls hardness of ordering the number of steps required for him according to the algorithm above to sort the sequence, e.g. the number of times he looks through the coins from the very beginning. For example, for the ordered sequence hardness of ordering equals one.
Today Sasha invited Dima and proposed him a game. First he puts *n* coins in a row, all of them are out of circulation. Then Sasha chooses one of the coins out of circulation and replaces it with a coin in circulation for *n* times. During this process Sasha constantly asks Dima what is the hardness of ordering of the sequence.
The task is more complicated because Dima should not touch the coins and he should determine hardness of ordering in his mind. Help Dima with this task. | The first line contains single integer *n* (1<=≤<=*n*<=≤<=300<=000) — number of coins that Sasha puts behind Dima.
Second line contains *n* distinct integers *p*1,<=*p*2,<=...,<=*p**n* (1<=≤<=*p**i*<=≤<=*n*) — positions that Sasha puts coins in circulation to. At first Sasha replaces coin located at position *p*1, then coin located at position *p*2 and so on. Coins are numbered from left to right. | Print *n*<=+<=1 numbers *a*0,<=*a*1,<=...,<=*a**n*, where *a*0 is a hardness of ordering at the beginning, *a*1 is a hardness of ordering after the first replacement and so on. | [
"4\n1 3 4 2\n",
"8\n6 8 3 4 7 2 1 5\n"
] | [
"1 2 3 2 1\n",
"1 2 2 3 4 3 4 5 1\n"
] | Let's denote as O coin out of circulation, and as X — coin is circulation.
At the first sample, initially in row there are coins that are not in circulation, so Dima will look through them from left to right and won't make any exchanges.
After replacement of the first coin with a coin in circulation, Dima will exchange this coin with next three times and after that he will finally look through the coins and finish the process.
XOOO → OOOX
After replacement of the third coin, Dima's actions look this way:
XOXO → OXOX → OOXX
After replacement of the fourth coin, Dima's actions look this way:
XOXX → OXXX
Finally, after replacement of the second coin, row becomes consisting of coins that are in circulation and Dima will look through coins from left to right without any exchanges. | 1,000 | [
{
"input": "4\n1 3 4 2",
"output": "1 2 3 2 1"
},
{
"input": "8\n6 8 3 4 7 2 1 5",
"output": "1 2 2 3 4 3 4 5 1"
},
{
"input": "1\n1",
"output": "1 1"
},
{
"input": "11\n10 8 9 4 6 3 5 1 11 7 2",
"output": "1 2 3 4 5 6 7 8 9 6 2 1"
},
{
"input": "11\n10 8 9 4 3 5 1 11 7 2 6",
"output": "1 2 3 4 5 6 7 8 5 5 6 1"
},
{
"input": "100\n1 72 43 50 58 87 10 94 29 51 99 86 92 80 36 31 9 100 85 59 66 30 3 78 17 73 93 37 57 71 45 15 24 2 64 44 65 22 38 79 23 8 16 52 98 97 96 95 91 90 89 88 84 83 82 81 77 76 75 74 70 69 68 67 63 62 61 60 56 55 54 53 49 48 47 46 42 41 40 39 35 34 33 32 28 27 26 25 21 20 19 18 14 13 12 11 7 6 5 4",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 43 43 43 40 40 40 40 37 37 37 37 34 34 34 34 31 31 31 31 28 28 28 28 25 25 25 25 22 22 22 22 19 19 19 19 16 16 16 16 13 13 13 13 10 10 10 10 7 7 7 7 4 4 4 4 1"
},
{
"input": "100\n98 52 63 2 18 96 31 58 84 40 41 45 66 100 46 71 26 48 81 20 73 91 68 76 13 93 17 29 64 95 79 21 55 75 19 85 54 51 89 78 15 87 43 59 36 1 90 35 65 56 62 28 86 5 82 49 3 99 33 9 92 32 74 69 27 22 77 16 44 94 34 6 57 70 23 12 61 25 8 11 67 47 83 88 10 14 30 7 97 60 42 37 24 38 53 50 4 80 72 39",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 70 71 72 73 74 75 76 77 78 71 39 1"
}
] | 1,518,682,637 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 8 | 1,000 | 6,246,400 | n = int(input())
cir = [int(x) for x in input().split(' ')]
output = []
coins = [0]*n
for c in cir:
coins[c-1] = c
looks = sum([1 for i,j in zip(coins, sorted(coins)) if (j and i!=j)]) + 1
output.append(str(looks))
output = ['1'] + output
print(' '.join(output)) | Title: Sorting the Coins
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently, Dima met with Sasha in a philatelic store, and since then they are collecting coins together. Their favorite occupation is to sort collections of coins. Sasha likes having things in order, that is why he wants his coins to be arranged in a row in such a way that firstly come coins out of circulation, and then come coins still in circulation.
For arranging coins Dima uses the following algorithm. One step of his algorithm looks like the following:
1. He looks through all the coins from left to right; 1. If he sees that the *i*-th coin is still in circulation, and (*i*<=+<=1)-th coin is already out of circulation, he exchanges these two coins and continues watching coins from (*i*<=+<=1)-th.
Dima repeats the procedure above until it happens that no two coins were exchanged during this procedure. Dima calls hardness of ordering the number of steps required for him according to the algorithm above to sort the sequence, e.g. the number of times he looks through the coins from the very beginning. For example, for the ordered sequence hardness of ordering equals one.
Today Sasha invited Dima and proposed him a game. First he puts *n* coins in a row, all of them are out of circulation. Then Sasha chooses one of the coins out of circulation and replaces it with a coin in circulation for *n* times. During this process Sasha constantly asks Dima what is the hardness of ordering of the sequence.
The task is more complicated because Dima should not touch the coins and he should determine hardness of ordering in his mind. Help Dima with this task.
Input Specification:
The first line contains single integer *n* (1<=≤<=*n*<=≤<=300<=000) — number of coins that Sasha puts behind Dima.
Second line contains *n* distinct integers *p*1,<=*p*2,<=...,<=*p**n* (1<=≤<=*p**i*<=≤<=*n*) — positions that Sasha puts coins in circulation to. At first Sasha replaces coin located at position *p*1, then coin located at position *p*2 and so on. Coins are numbered from left to right.
Output Specification:
Print *n*<=+<=1 numbers *a*0,<=*a*1,<=...,<=*a**n*, where *a*0 is a hardness of ordering at the beginning, *a*1 is a hardness of ordering after the first replacement and so on.
Demo Input:
['4\n1 3 4 2\n', '8\n6 8 3 4 7 2 1 5\n']
Demo Output:
['1 2 3 2 1\n', '1 2 2 3 4 3 4 5 1\n']
Note:
Let's denote as O coin out of circulation, and as X — coin is circulation.
At the first sample, initially in row there are coins that are not in circulation, so Dima will look through them from left to right and won't make any exchanges.
After replacement of the first coin with a coin in circulation, Dima will exchange this coin with next three times and after that he will finally look through the coins and finish the process.
XOOO → OOOX
After replacement of the third coin, Dima's actions look this way:
XOXO → OXOX → OOXX
After replacement of the fourth coin, Dima's actions look this way:
XOXX → OXXX
Finally, after replacement of the second coin, row becomes consisting of coins that are in circulation and Dima will look through coins from left to right without any exchanges. | ```python
n = int(input())
cir = [int(x) for x in input().split(' ')]
output = []
coins = [0]*n
for c in cir:
coins[c-1] = c
looks = sum([1 for i,j in zip(coins, sorted(coins)) if (j and i!=j)]) + 1
output.append(str(looks))
output = ['1'] + output
print(' '.join(output))
``` | 0 |
|
0 | none | none | none | 0 | [
"none"
] | null | null | The main road in Bytecity is a straight line from south to north. Conveniently, there are coordinates measured in meters from the southernmost building in north direction.
At some points on the road there are *n* friends, and *i*-th of them is standing at the point *x**i* meters and can move with any speed no greater than *v**i* meters per second in any of the two directions along the road: south or north.
You are to compute the minimum time needed to gather all the *n* friends at some point on the road. Note that the point they meet at doesn't need to have integer coordinate. | The first line contains single integer *n* (2<=≤<=*n*<=≤<=60<=000) — the number of friends.
The second line contains *n* integers *x*1,<=*x*2,<=...,<=*x**n* (1<=≤<=*x**i*<=≤<=109) — the current coordinates of the friends, in meters.
The third line contains *n* integers *v*1,<=*v*2,<=...,<=*v**n* (1<=≤<=*v**i*<=≤<=109) — the maximum speeds of the friends, in meters per second. | Print the minimum time (in seconds) needed for all the *n* friends to meet at some point on the road.
Your answer will be considered correct, if its absolute or relative error isn't greater than 10<=-<=6. Formally, let your answer be *a*, while jury's answer be *b*. Your answer will be considered correct if holds. | [
"3\n7 1 3\n1 2 1\n",
"4\n5 10 3 2\n2 3 2 4\n"
] | [
"2.000000000000\n",
"1.400000000000\n"
] | In the first sample, all friends can gather at the point 5 within 2 seconds. In order to achieve this, the first friend should go south all the time at his maximum speed, while the second and the third friends should go north at their maximum speeds. | 0 | [
{
"input": "3\n7 1 3\n1 2 1",
"output": "2.000000000000"
},
{
"input": "4\n5 10 3 2\n2 3 2 4",
"output": "1.400000000000"
},
{
"input": "3\n1 1000000000 2\n1 2 1000000000",
"output": "333333332.999999999971"
},
{
"input": "2\n4 5\n10 8",
"output": "0.055555555556"
},
{
"input": "4\n14 12 10 17\n8 6 5 10",
"output": "0.466666666667"
},
{
"input": "5\n1 15 61 29 43\n15 11 19 19 19",
"output": "1.764705882353"
},
{
"input": "10\n20 11 17 38 15 27 2 40 24 37\n22 30 22 30 28 16 7 20 22 13",
"output": "1.750000000000"
},
{
"input": "2\n1000000000 1000000000\n1 1",
"output": "0.000000000000"
},
{
"input": "3\n1 1 1\n1 1 1",
"output": "0.000000000000"
}
] | 1,488,726,171 | 7,071 | Python 3 | TIME_LIMIT_EXCEEDED | PRETESTS | 0 | 5,000 | 4,608,000 |
dif = 0.000001
t = 0
n = int(input())
xi = [int(x) for x in input().split()]
vi = [int(x) for x in input().split()]
a = min(xi)
b = max(xi)
while b - a > (dif / max(1,a)):
t = 0
xt = (b-a)/2
xf = 0
for i in range(n):
if t < abs(xi[i] - xt) / vi[i]:
t = abs(xi[i] - xt) / vi[i]
xf = xi[i]
if xf > xt:
a = xt
else:
b = xt
print(t) | Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The main road in Bytecity is a straight line from south to north. Conveniently, there are coordinates measured in meters from the southernmost building in north direction.
At some points on the road there are *n* friends, and *i*-th of them is standing at the point *x**i* meters and can move with any speed no greater than *v**i* meters per second in any of the two directions along the road: south or north.
You are to compute the minimum time needed to gather all the *n* friends at some point on the road. Note that the point they meet at doesn't need to have integer coordinate.
Input Specification:
The first line contains single integer *n* (2<=≤<=*n*<=≤<=60<=000) — the number of friends.
The second line contains *n* integers *x*1,<=*x*2,<=...,<=*x**n* (1<=≤<=*x**i*<=≤<=109) — the current coordinates of the friends, in meters.
The third line contains *n* integers *v*1,<=*v*2,<=...,<=*v**n* (1<=≤<=*v**i*<=≤<=109) — the maximum speeds of the friends, in meters per second.
Output Specification:
Print the minimum time (in seconds) needed for all the *n* friends to meet at some point on the road.
Your answer will be considered correct, if its absolute or relative error isn't greater than 10<=-<=6. Formally, let your answer be *a*, while jury's answer be *b*. Your answer will be considered correct if holds.
Demo Input:
['3\n7 1 3\n1 2 1\n', '4\n5 10 3 2\n2 3 2 4\n']
Demo Output:
['2.000000000000\n', '1.400000000000\n']
Note:
In the first sample, all friends can gather at the point 5 within 2 seconds. In order to achieve this, the first friend should go south all the time at his maximum speed, while the second and the third friends should go north at their maximum speeds. | ```python
dif = 0.000001
t = 0
n = int(input())
xi = [int(x) for x in input().split()]
vi = [int(x) for x in input().split()]
a = min(xi)
b = max(xi)
while b - a > (dif / max(1,a)):
t = 0
xt = (b-a)/2
xf = 0
for i in range(n):
if t < abs(xi[i] - xt) / vi[i]:
t = abs(xi[i] - xt) / vi[i]
xf = xi[i]
if xf > xt:
a = xt
else:
b = xt
print(t)
``` | 0 |
|
155 | A | I_love_\%username\% | PROGRAMMING | 800 | [
"brute force"
] | null | null | Vasya adores sport programming. He can't write programs but he loves to watch the contests' progress. Vasya even has a favorite coder and Vasya pays special attention to him.
One day Vasya decided to collect the results of all contests where his favorite coder participated and track the progress of his coolness. For each contest where this coder participated, he wrote out a single non-negative number — the number of points his favorite coder earned in the contest. Vasya wrote out the points for the contest in the order, in which the contests run (naturally, no two contests ran simultaneously).
Vasya considers a coder's performance in a contest amazing in two situations: he can break either his best or his worst performance record. First, it is amazing if during the contest the coder earns strictly more points that he earned on each past contest. Second, it is amazing if during the contest the coder earns strictly less points that he earned on each past contest. A coder's first contest isn't considered amazing. Now he wants to count the number of amazing performances the coder had throughout his whole history of participating in contests. But the list of earned points turned out long and Vasya can't code... That's why he asks you to help him. | The first line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of contests where the coder participated.
The next line contains *n* space-separated non-negative integer numbers — they are the points which the coder has earned. The points are given in the chronological order. All points do not exceed 10000. | Print the single number — the number of amazing performances the coder has had during his whole history of participating in the contests. | [
"5\n100 50 200 150 200\n",
"10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242\n"
] | [
"2\n",
"4\n"
] | In the first sample the performances number 2 and 3 are amazing.
In the second sample the performances number 2, 4, 9 and 10 are amazing. | 500 | [
{
"input": "5\n100 50 200 150 200",
"output": "2"
},
{
"input": "10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242",
"output": "4"
},
{
"input": "1\n6",
"output": "0"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "5\n100 36 53 7 81",
"output": "2"
},
{
"input": "5\n7 36 53 81 100",
"output": "4"
},
{
"input": "5\n100 81 53 36 7",
"output": "4"
},
{
"input": "10\n8 6 3 4 9 10 7 7 1 3",
"output": "5"
},
{
"input": "10\n1627 1675 1488 1390 1812 1137 1746 1324 1952 1862",
"output": "6"
},
{
"input": "10\n1 3 3 4 6 7 7 8 9 10",
"output": "7"
},
{
"input": "10\n1952 1862 1812 1746 1675 1627 1488 1390 1324 1137",
"output": "9"
},
{
"input": "25\n1448 4549 2310 2725 2091 3509 1565 2475 2232 3989 4231 779 2967 2702 608 3739 721 1552 2767 530 3114 665 1940 48 4198",
"output": "5"
},
{
"input": "33\n1097 1132 1091 1104 1049 1038 1023 1080 1104 1029 1035 1061 1049 1060 1088 1106 1105 1087 1063 1076 1054 1103 1047 1041 1028 1120 1126 1063 1117 1110 1044 1093 1101",
"output": "5"
},
{
"input": "34\n821 5536 2491 6074 7216 9885 764 1603 778 8736 8987 771 617 1587 8943 7922 439 7367 4115 8886 7878 6899 8811 5752 3184 3401 9760 9400 8995 4681 1323 6637 6554 6498",
"output": "7"
},
{
"input": "68\n6764 6877 6950 6768 6839 6755 6726 6778 6699 6805 6777 6985 6821 6801 6791 6805 6940 6761 6677 6999 6911 6699 6959 6933 6903 6843 6972 6717 6997 6756 6789 6668 6735 6852 6735 6880 6723 6834 6810 6694 6780 6679 6698 6857 6826 6896 6979 6968 6957 6988 6960 6700 6919 6892 6984 6685 6813 6678 6715 6857 6976 6902 6780 6686 6777 6686 6842 6679",
"output": "9"
},
{
"input": "60\n9000 9014 9034 9081 9131 9162 9174 9199 9202 9220 9221 9223 9229 9235 9251 9260 9268 9269 9270 9298 9307 9309 9313 9323 9386 9399 9407 9495 9497 9529 9531 9544 9614 9615 9627 9627 9643 9654 9656 9657 9685 9699 9701 9736 9745 9758 9799 9827 9843 9845 9854 9854 9885 9891 9896 9913 9942 9963 9986 9992",
"output": "57"
},
{
"input": "100\n7 61 12 52 41 16 34 99 30 44 48 89 31 54 21 1 48 52 61 15 35 87 21 76 64 92 44 81 16 93 84 92 32 15 68 76 53 39 26 4 11 26 7 4 99 99 61 65 55 85 65 67 47 39 2 74 63 49 98 87 5 94 22 30 25 42 31 84 49 23 89 60 16 26 92 27 9 57 75 61 94 35 83 47 99 100 63 24 91 88 79 10 15 45 22 64 3 11 89 83",
"output": "4"
},
{
"input": "100\n9999 9999 9999 9998 9998 9998 9997 9996 9996 9995 9993 9993 9991 9990 9989 9986 9984 9984 9983 9981 9981 9980 9980 9980 9979 9977 9977 9977 9977 9977 9976 9976 9975 9975 9973 9972 9972 9972 9972 9971 9969 9969 9969 9968 9967 9965 9962 9962 9962 9962 9960 9958 9958 9955 9954 9954 9954 9954 9950 9949 9949 9947 9943 9943 9940 9940 9939 9937 9937 9937 9936 9935 9932 9932 9931 9929 9927 9927 9926 9923 9919 9919 9918 9918 9918 9917 9917 9916 9916 9915 9914 9911 9910 9907 9907 9906 9905 9905 9904 9901",
"output": "57"
},
{
"input": "100\n158 159 157 156 155 154 160 153 161 152 162 163 151 164 150 165 149 148 147 166 146 167 145 144 143 142 168 141 169 170 140 139 138 137 171 136 135 134 172 173 174 133 175 132 177 178 131 179 180 130 129 181 128 127 182 126 183 125 124 184 123 122 121 120 119 118 117 185 186 187 188 189 116 190 115 191 192 193 114 113 112 111 110 109 108 194 195 107 106 105 196 197 104 198 199 103 102 200 101 100",
"output": "99"
},
{
"input": "2\n0 10000",
"output": "1"
},
{
"input": "2\n5 5",
"output": "0"
},
{
"input": "2\n1 1",
"output": "0"
},
{
"input": "2\n10 10",
"output": "0"
},
{
"input": "1\n0",
"output": "0"
}
] | 1,672,747,193 | 2,147,483,647 | Python 3 | OK | TESTS | 37 | 92 | 0 | n = int(input())
points = list(map(int, input().split()))
amazing = 0
minimum = points[0]
maximum = points[0]
for i in range(1, n):
if points[i] > minimum and points[i] > maximum:
amazing += 1
maximum = points[i]
elif points[i] < minimum:
amazing += 1
minimum = points[i]
print(amazing) | Title: I_love_\%username\%
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya adores sport programming. He can't write programs but he loves to watch the contests' progress. Vasya even has a favorite coder and Vasya pays special attention to him.
One day Vasya decided to collect the results of all contests where his favorite coder participated and track the progress of his coolness. For each contest where this coder participated, he wrote out a single non-negative number — the number of points his favorite coder earned in the contest. Vasya wrote out the points for the contest in the order, in which the contests run (naturally, no two contests ran simultaneously).
Vasya considers a coder's performance in a contest amazing in two situations: he can break either his best or his worst performance record. First, it is amazing if during the contest the coder earns strictly more points that he earned on each past contest. Second, it is amazing if during the contest the coder earns strictly less points that he earned on each past contest. A coder's first contest isn't considered amazing. Now he wants to count the number of amazing performances the coder had throughout his whole history of participating in contests. But the list of earned points turned out long and Vasya can't code... That's why he asks you to help him.
Input Specification:
The first line contains the single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of contests where the coder participated.
The next line contains *n* space-separated non-negative integer numbers — they are the points which the coder has earned. The points are given in the chronological order. All points do not exceed 10000.
Output Specification:
Print the single number — the number of amazing performances the coder has had during his whole history of participating in the contests.
Demo Input:
['5\n100 50 200 150 200\n', '10\n4664 6496 5814 7010 5762 5736 6944 4850 3698 7242\n']
Demo Output:
['2\n', '4\n']
Note:
In the first sample the performances number 2 and 3 are amazing.
In the second sample the performances number 2, 4, 9 and 10 are amazing. | ```python
n = int(input())
points = list(map(int, input().split()))
amazing = 0
minimum = points[0]
maximum = points[0]
for i in range(1, n):
if points[i] > minimum and points[i] > maximum:
amazing += 1
maximum = points[i]
elif points[i] < minimum:
amazing += 1
minimum = points[i]
print(amazing)
``` | 3 |
|
81 | A | Plug-in | PROGRAMMING | 1,400 | [
"implementation"
] | A. Plug-in | 1 | 256 | Polycarp thinks about the meaning of life very often. He does this constantly, even when typing in the editor. Every time he starts brooding he can no longer fully concentrate and repeatedly presses the keys that need to be pressed only once. For example, instead of the phrase "how are you" he can type "hhoow aaaare yyoouu".
Polycarp decided to automate the process of correcting such errors. He decided to write a plug-in to the text editor that will remove pairs of identical consecutive letters (if there are any in the text). Of course, this is not exactly what Polycarp needs, but he's got to start from something!
Help Polycarp and write the main plug-in module. Your program should remove from a string all pairs of identical letters, which are consecutive. If after the removal there appear new pairs, the program should remove them as well. Technically, its work should be equivalent to the following: while the string contains a pair of consecutive identical letters, the pair should be deleted. Note that deleting of the consecutive identical letters can be done in any order, as any order leads to the same result. | The input data consists of a single line to be processed. The length of the line is from 1 to 2·105 characters inclusive. The string contains only lowercase Latin letters. | Print the given string after it is processed. It is guaranteed that the result will contain at least one character. | [
"hhoowaaaareyyoouu\n",
"reallazy\n",
"abacabaabacabaa\n"
] | [
"wre",
"rezy",
"a"
] | none | 500 | [
{
"input": "hhoowaaaareyyoouu",
"output": "wre"
},
{
"input": "reallazy",
"output": "rezy"
},
{
"input": "abacabaabacabaa",
"output": "a"
},
{
"input": "xraccabccbry",
"output": "xy"
},
{
"input": "a",
"output": "a"
},
{
"input": "b",
"output": "b"
},
{
"input": "il",
"output": "il"
},
{
"input": "gfj",
"output": "gfj"
},
{
"input": "babbbbbababa",
"output": "babababa"
},
{
"input": "babbbbabbabbbababbabbbbbbabaabaababaaabbbbbabbbbaaaaabbaaabbaabaabbbbabbbababbabaaabbababaaababbbaaa",
"output": "babababababababababababa"
},
{
"input": "aab",
"output": "b"
},
{
"input": "abb",
"output": "a"
},
{
"input": "aba",
"output": "aba"
},
{
"input": "ab",
"output": "ab"
}
] | 1,697,963,188 | 2,147,483,647 | Python 3 | OK | TESTS | 32 | 374 | 6,656,000 | # LUOGU_RID: 131046759
import sys
input = lambda:sys.stdin.readline().strip()
arc = []
for i in input():
if arc and i == arc[-1]:
arc.pop()
else:
arc.append(i)
print(*arc,sep="") | Title: Plug-in
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Polycarp thinks about the meaning of life very often. He does this constantly, even when typing in the editor. Every time he starts brooding he can no longer fully concentrate and repeatedly presses the keys that need to be pressed only once. For example, instead of the phrase "how are you" he can type "hhoow aaaare yyoouu".
Polycarp decided to automate the process of correcting such errors. He decided to write a plug-in to the text editor that will remove pairs of identical consecutive letters (if there are any in the text). Of course, this is not exactly what Polycarp needs, but he's got to start from something!
Help Polycarp and write the main plug-in module. Your program should remove from a string all pairs of identical letters, which are consecutive. If after the removal there appear new pairs, the program should remove them as well. Technically, its work should be equivalent to the following: while the string contains a pair of consecutive identical letters, the pair should be deleted. Note that deleting of the consecutive identical letters can be done in any order, as any order leads to the same result.
Input Specification:
The input data consists of a single line to be processed. The length of the line is from 1 to 2·105 characters inclusive. The string contains only lowercase Latin letters.
Output Specification:
Print the given string after it is processed. It is guaranteed that the result will contain at least one character.
Demo Input:
['hhoowaaaareyyoouu\n', 'reallazy\n', 'abacabaabacabaa\n']
Demo Output:
['wre', 'rezy', 'a']
Note:
none | ```python
# LUOGU_RID: 131046759
import sys
input = lambda:sys.stdin.readline().strip()
arc = []
for i in input():
if arc and i == arc[-1]:
arc.pop()
else:
arc.append(i)
print(*arc,sep="")
``` | 3.800602 |
49 | A | Sleuth | PROGRAMMING | 800 | [
"implementation"
] | A. Sleuth | 2 | 256 | Vasya plays the sleuth with his friends. The rules of the game are as follows: those who play for the first time, that is Vasya is the sleuth, he should investigate a "crime" and find out what is happening. He can ask any questions whatsoever that can be answered with "Yes" or "No". All the rest agree beforehand to answer the questions like that: if the question’s last letter is a vowel, they answer "Yes" and if the last letter is a consonant, they answer "No". Of course, the sleuth knows nothing about it and his task is to understand that.
Unfortunately, Vasya is not very smart. After 5 hours of endless stupid questions everybody except Vasya got bored. That’s why Vasya’s friends ask you to write a program that would give answers instead of them.
The English alphabet vowels are: A, E, I, O, U, Y
The English alphabet consonants are: B, C, D, F, G, H, J, K, L, M, N, P, Q, R, S, T, V, W, X, Z | The single line contains a question represented by a non-empty line consisting of large and small Latin letters, spaces and a question mark. The line length does not exceed 100. It is guaranteed that the question mark occurs exactly once in the line — as the last symbol and that the line contains at least one letter. | Print answer for the question in a single line: YES if the answer is "Yes", NO if the answer is "No".
Remember that in the reply to the question the last letter, not the last character counts. I. e. the spaces and the question mark do not count as letters. | [
"Is it a melon?\n",
"Is it an apple?\n",
"Is it a banana ?\n",
"Is it an apple and a banana simultaneouSLY?\n"
] | [
"NO\n",
"YES\n",
"YES\n",
"YES\n"
] | none | 500 | [
{
"input": "Is it a melon?",
"output": "NO"
},
{
"input": "Is it an apple?",
"output": "YES"
},
{
"input": " Is it a banana ?",
"output": "YES"
},
{
"input": "Is it an apple and a banana simultaneouSLY?",
"output": "YES"
},
{
"input": "oHtSbDwzHb?",
"output": "NO"
},
{
"input": "sZecYdUvZHrXx?",
"output": "NO"
},
{
"input": "uMtXK?",
"output": "NO"
},
{
"input": "U?",
"output": "YES"
},
{
"input": "aqFDkCUKeHMyvZFcAyWlMUSQTFomtaWjoKLVyxLCw vcufPBFbaljOuHWiDCROYTcmbgzbaqHXKPOYEbuEtRqqoxBbOETCsQzhw?",
"output": "NO"
},
{
"input": "dJcNqQiFXzcbsj fItCpBLyXOnrSBPebwyFHlxUJHqCUzzCmcAvMiKL NunwOXnKeIxUZmBVwiCUfPkjRAkTPbkYCmwRRnDSLaz?",
"output": "NO"
},
{
"input": "gxzXbdcAQMuFKuuiPohtMgeypr wpDIoDSyOYTdvylcg SoEBZjnMHHYZGEqKgCgBeTbyTwyGuPZxkxsnSczotBdYyfcQsOVDVC?",
"output": "NO"
},
{
"input": "FQXBisXaJFMiHFQlXjixBDMaQuIbyqSBKGsBfTmBKCjszlGVZxEOqYYqRTUkGpSDDAoOXyXcQbHcPaegeOUBNeSD JiKOdECPOF?",
"output": "NO"
},
{
"input": "YhCuZnrWUBEed?",
"output": "NO"
},
{
"input": "hh?",
"output": "NO"
},
{
"input": "whU?",
"output": "YES"
},
{
"input": "fgwg?",
"output": "NO"
},
{
"input": "GlEmEPKrYcOnBNJUIFjszWUyVdvWw DGDjoCMtRJUburkPToCyDrOtMr?",
"output": "NO"
},
{
"input": "n?",
"output": "NO"
},
{
"input": "BueDOlxgzeNlxrzRrMbKiQdmGujEKmGxclvaPpTuHmTqBp?",
"output": "NO"
},
{
"input": "iehvZNQXDGCuVmJPOEysLyUryTdfaIxIuTzTadDbqRQGoCLXkxnyfWSGoLXebNnQQNTqAQJebbyYvHOfpUnXeWdjx?",
"output": "NO"
},
{
"input": " J ?",
"output": "NO"
},
{
"input": " j ?",
"output": "NO"
},
{
"input": " o ?",
"output": "YES"
},
{
"input": " T ?",
"output": "NO"
},
{
"input": " q ?",
"output": "NO"
},
{
"input": " j ?",
"output": "NO"
},
{
"input": " c ?",
"output": "NO"
},
{
"input": " B ?",
"output": "NO"
},
{
"input": "LuhxDHVwMPTtUIUMIQTuQETgXCOQPsfdFlyHvpfOVedjUTpGLAZGOHloIjJJtOLAlHPivzA?",
"output": "YES"
},
{
"input": "wmztmzFfwbGyOmNHENUFMTsFEMWYA?",
"output": "YES"
},
{
"input": "wGsfZCSwN PEUhNUrLfABrxA?",
"output": "YES"
},
{
"input": "mCDHENXjYbgMdBimAdPnewaHfpGWowjWrVAdvWczjw iDcUbyzMsmsnwbviiKiAyGVA?",
"output": "YES"
},
{
"input": "ARIWnwqFqxsQXsXXzHqvFjxOCttAGPUzDtWzsenPYdNXuFOIUGYZsLLK IaoxiyjBBRThoelwdPTkuCQfcBLUEJpCPIrVZlvUWA?",
"output": "YES"
},
{
"input": " PslvVpgpN BXkMFBEVXsyZFIQbBEFxGkYTeXKrOdcmhbiTUatYRUoYAayrchqbksswIlfIjerZPqptvCGnMUhyrQSvwltRhFzA?",
"output": "YES"
},
{
"input": "HpBkttwSjBXDmyleGiRWNUMPaAIE uzTrp KJDzaUiCdsMYOoWKHoUhWUoecCPmACymMUUbGav UMRpCytPETwNFAObZJA?",
"output": "YES"
}
] | 1,600,878,283 | 2,147,483,647 | Python 3 | OK | TESTS | 35 | 248 | 0 | n = input().lower()
x = [97, 101, 105, 111, 117, 121]
i = len(n) - 1
while i+1:
on = ord(n[i])
if on in range(97, 123):
if on in x:
print('YES')
else:
print('NO')
break
i -= 1
| Title: Sleuth
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya plays the sleuth with his friends. The rules of the game are as follows: those who play for the first time, that is Vasya is the sleuth, he should investigate a "crime" and find out what is happening. He can ask any questions whatsoever that can be answered with "Yes" or "No". All the rest agree beforehand to answer the questions like that: if the question’s last letter is a vowel, they answer "Yes" and if the last letter is a consonant, they answer "No". Of course, the sleuth knows nothing about it and his task is to understand that.
Unfortunately, Vasya is not very smart. After 5 hours of endless stupid questions everybody except Vasya got bored. That’s why Vasya’s friends ask you to write a program that would give answers instead of them.
The English alphabet vowels are: A, E, I, O, U, Y
The English alphabet consonants are: B, C, D, F, G, H, J, K, L, M, N, P, Q, R, S, T, V, W, X, Z
Input Specification:
The single line contains a question represented by a non-empty line consisting of large and small Latin letters, spaces and a question mark. The line length does not exceed 100. It is guaranteed that the question mark occurs exactly once in the line — as the last symbol and that the line contains at least one letter.
Output Specification:
Print answer for the question in a single line: YES if the answer is "Yes", NO if the answer is "No".
Remember that in the reply to the question the last letter, not the last character counts. I. e. the spaces and the question mark do not count as letters.
Demo Input:
['Is it a melon?\n', 'Is it an apple?\n', 'Is it a banana ?\n', 'Is it an apple and a banana simultaneouSLY?\n']
Demo Output:
['NO\n', 'YES\n', 'YES\n', 'YES\n']
Note:
none | ```python
n = input().lower()
x = [97, 101, 105, 111, 117, 121]
i = len(n) - 1
while i+1:
on = ord(n[i])
if on in range(97, 123):
if on in x:
print('YES')
else:
print('NO')
break
i -= 1
``` | 3.938 |
814 | A | An abandoned sentiment from past | PROGRAMMING | 900 | [
"constructive algorithms",
"greedy",
"implementation",
"sortings"
] | null | null | A few years ago, Hitagi encountered a giant crab, who stole the whole of her body weight. Ever since, she tried to avoid contact with others, for fear that this secret might be noticed.
To get rid of the oddity and recover her weight, a special integer sequence is needed. Hitagi's sequence has been broken for a long time, but now Kaiki provides an opportunity.
Hitagi's sequence *a* has a length of *n*. Lost elements in it are denoted by zeros. Kaiki provides another sequence *b*, whose length *k* equals the number of lost elements in *a* (i.e. the number of zeros). Hitagi is to replace each zero in *a* with an element from *b* so that each element in *b* should be used exactly once. Hitagi knows, however, that, apart from 0, no integer occurs in *a* and *b* more than once in total.
If the resulting sequence is not an increasing sequence, then it has the power to recover Hitagi from the oddity. You are to determine whether this is possible, or Kaiki's sequence is just another fake. In other words, you should detect whether it is possible to replace each zero in *a* with an integer from *b* so that each integer from *b* is used exactly once, and the resulting sequence is not increasing. | The first line of input contains two space-separated positive integers *n* (2<=≤<=*n*<=≤<=100) and *k* (1<=≤<=*k*<=≤<=*n*) — the lengths of sequence *a* and *b* respectively.
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=200) — Hitagi's broken sequence with exactly *k* zero elements.
The third line contains *k* space-separated integers *b*1,<=*b*2,<=...,<=*b**k* (1<=≤<=*b**i*<=≤<=200) — the elements to fill into Hitagi's sequence.
Input guarantees that apart from 0, no integer occurs in *a* and *b* more than once in total. | Output "Yes" if it's possible to replace zeros in *a* with elements in *b* and make the resulting sequence not increasing, and "No" otherwise. | [
"4 2\n11 0 0 14\n5 4\n",
"6 1\n2 3 0 8 9 10\n5\n",
"4 1\n8 94 0 4\n89\n",
"7 7\n0 0 0 0 0 0 0\n1 2 3 4 5 6 7\n"
] | [
"Yes\n",
"No\n",
"Yes\n",
"Yes\n"
] | In the first sample:
- Sequence *a* is 11, 0, 0, 14. - Two of the elements are lost, and the candidates in *b* are 5 and 4. - There are two possible resulting sequences: 11, 5, 4, 14 and 11, 4, 5, 14, both of which fulfill the requirements. Thus the answer is "Yes".
In the second sample, the only possible resulting sequence is 2, 3, 5, 8, 9, 10, which is an increasing sequence and therefore invalid. | 500 | [
{
"input": "4 2\n11 0 0 14\n5 4",
"output": "Yes"
},
{
"input": "6 1\n2 3 0 8 9 10\n5",
"output": "No"
},
{
"input": "4 1\n8 94 0 4\n89",
"output": "Yes"
},
{
"input": "7 7\n0 0 0 0 0 0 0\n1 2 3 4 5 6 7",
"output": "Yes"
},
{
"input": "40 1\n23 26 27 28 31 35 38 40 43 50 52 53 56 57 59 61 65 73 75 76 79 0 82 84 85 86 88 93 99 101 103 104 105 106 110 111 112 117 119 120\n80",
"output": "No"
},
{
"input": "100 1\n99 95 22 110 47 20 37 34 23 0 16 69 64 49 111 42 112 96 13 40 18 77 44 46 74 55 15 54 56 75 78 100 82 101 31 83 53 80 52 63 30 57 104 36 67 65 103 51 48 26 68 59 35 92 85 38 107 98 73 90 62 43 32 89 19 106 17 88 41 72 113 86 66 102 81 27 29 50 71 79 109 91 70 39 61 76 93 84 108 97 24 25 45 105 94 60 33 87 14 21\n58",
"output": "Yes"
},
{
"input": "4 1\n2 1 0 4\n3",
"output": "Yes"
},
{
"input": "2 1\n199 0\n200",
"output": "No"
},
{
"input": "3 2\n115 0 0\n145 191",
"output": "Yes"
},
{
"input": "5 1\n196 197 198 0 200\n199",
"output": "No"
},
{
"input": "5 1\n92 0 97 99 100\n93",
"output": "No"
},
{
"input": "3 1\n3 87 0\n81",
"output": "Yes"
},
{
"input": "3 1\n0 92 192\n118",
"output": "Yes"
},
{
"input": "10 1\n1 3 0 7 35 46 66 72 83 90\n22",
"output": "Yes"
},
{
"input": "100 1\n14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 0 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113\n67",
"output": "No"
},
{
"input": "100 5\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 0 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 0 53 54 0 56 57 58 59 60 61 62 63 0 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 0 99 100\n98 64 55 52 29",
"output": "Yes"
},
{
"input": "100 5\n175 30 124 0 12 111 6 0 119 108 0 38 127 3 151 114 95 54 4 128 91 11 168 120 80 107 18 21 149 169 0 141 195 20 78 157 33 118 17 69 105 130 197 57 74 110 138 84 71 172 132 93 191 44 152 156 24 101 146 26 2 36 143 122 104 42 103 97 39 116 115 0 155 87 53 85 7 43 65 196 136 154 16 79 45 129 67 150 35 73 55 76 37 147 112 82 162 58 40 75\n121 199 62 193 27",
"output": "Yes"
},
{
"input": "100 1\n1 2 3 4 5 6 7 8 9 0 10 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100\n11",
"output": "Yes"
},
{
"input": "100 1\n0 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100\n1",
"output": "No"
},
{
"input": "100 1\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 0\n100",
"output": "No"
},
{
"input": "100 1\n9 79 7 98 10 50 28 99 43 74 89 20 32 66 23 45 87 78 81 41 86 71 75 85 5 39 14 53 42 48 40 52 3 51 11 34 35 76 77 61 47 19 55 91 62 56 8 72 88 4 33 0 97 92 31 83 18 49 54 21 17 16 63 44 84 22 2 96 70 36 68 60 80 82 13 73 26 94 27 58 1 30 100 38 12 15 93 90 57 59 67 6 64 46 25 29 37 95 69 24\n65",
"output": "Yes"
},
{
"input": "100 2\n0 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 0 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100\n48 1",
"output": "Yes"
},
{
"input": "100 1\n2 7 11 17 20 22 23 24 25 27 29 30 31 33 34 35 36 38 39 40 42 44 46 47 50 52 53 58 59 60 61 62 63 66 0 67 71 72 75 79 80 81 86 91 93 94 99 100 101 102 103 104 105 108 109 110 111 113 114 118 119 120 122 123 127 129 130 131 132 133 134 135 136 138 139 140 141 142 147 154 155 156 160 168 170 171 172 176 179 180 181 182 185 186 187 188 189 190 194 198\n69",
"output": "Yes"
},
{
"input": "100 1\n3 5 7 9 11 12 13 18 20 21 22 23 24 27 28 29 31 34 36 38 39 43 46 48 49 50 52 53 55 59 60 61 62 63 66 68 70 72 73 74 75 77 78 79 80 81 83 85 86 88 89 91 92 94 97 98 102 109 110 115 116 117 118 120 122 126 127 128 0 133 134 136 137 141 142 144 145 147 151 152 157 159 160 163 164 171 172 175 176 178 179 180 181 184 186 188 190 192 193 200\n129",
"output": "No"
},
{
"input": "5 2\n0 2 7 0 10\n1 8",
"output": "Yes"
},
{
"input": "3 1\n5 4 0\n1",
"output": "Yes"
},
{
"input": "3 1\n1 0 3\n4",
"output": "Yes"
},
{
"input": "2 1\n0 2\n1",
"output": "No"
},
{
"input": "2 1\n0 5\n7",
"output": "Yes"
},
{
"input": "5 1\n10 11 0 12 13\n1",
"output": "Yes"
},
{
"input": "5 1\n0 2 3 4 5\n6",
"output": "Yes"
},
{
"input": "6 2\n1 0 3 4 0 6\n2 5",
"output": "Yes"
},
{
"input": "7 2\n1 2 3 0 0 6 7\n4 5",
"output": "Yes"
},
{
"input": "4 1\n1 2 3 0\n4",
"output": "No"
},
{
"input": "2 2\n0 0\n1 2",
"output": "Yes"
},
{
"input": "3 2\n1 0 0\n2 3",
"output": "Yes"
},
{
"input": "4 2\n1 0 4 0\n5 2",
"output": "Yes"
},
{
"input": "2 1\n0 1\n2",
"output": "Yes"
},
{
"input": "5 2\n1 0 4 0 6\n2 5",
"output": "Yes"
},
{
"input": "5 1\n2 3 0 4 5\n1",
"output": "Yes"
},
{
"input": "3 1\n0 2 3\n5",
"output": "Yes"
},
{
"input": "6 1\n1 2 3 4 5 0\n6",
"output": "No"
},
{
"input": "5 1\n1 2 0 4 5\n6",
"output": "Yes"
},
{
"input": "3 1\n5 0 2\n7",
"output": "Yes"
},
{
"input": "4 1\n4 5 0 8\n3",
"output": "Yes"
},
{
"input": "5 1\n10 11 12 0 14\n13",
"output": "No"
},
{
"input": "4 1\n1 2 0 4\n5",
"output": "Yes"
},
{
"input": "3 1\n0 11 14\n12",
"output": "Yes"
},
{
"input": "4 1\n1 3 0 4\n2",
"output": "Yes"
},
{
"input": "2 1\n0 5\n1",
"output": "No"
},
{
"input": "5 1\n1 2 0 4 7\n5",
"output": "Yes"
},
{
"input": "3 1\n2 3 0\n1",
"output": "Yes"
},
{
"input": "6 1\n1 2 3 0 5 4\n6",
"output": "Yes"
},
{
"input": "4 2\n11 0 0 14\n13 12",
"output": "Yes"
},
{
"input": "2 1\n1 0\n2",
"output": "No"
},
{
"input": "3 1\n1 2 0\n3",
"output": "No"
},
{
"input": "4 1\n1 0 3 2\n4",
"output": "Yes"
},
{
"input": "3 1\n0 1 2\n5",
"output": "Yes"
},
{
"input": "3 1\n0 1 2\n3",
"output": "Yes"
},
{
"input": "4 1\n0 2 3 4\n5",
"output": "Yes"
},
{
"input": "6 1\n1 2 3 0 4 5\n6",
"output": "Yes"
},
{
"input": "3 1\n1 2 0\n5",
"output": "No"
},
{
"input": "4 2\n1 0 0 4\n3 2",
"output": "Yes"
},
{
"input": "5 1\n2 3 0 5 7\n6",
"output": "Yes"
},
{
"input": "3 1\n2 3 0\n4",
"output": "No"
},
{
"input": "3 1\n1 0 11\n5",
"output": "No"
},
{
"input": "4 1\n7 9 5 0\n8",
"output": "Yes"
},
{
"input": "6 2\n1 2 3 0 5 0\n6 4",
"output": "Yes"
},
{
"input": "3 2\n0 1 0\n3 2",
"output": "Yes"
},
{
"input": "4 1\n6 9 5 0\n8",
"output": "Yes"
},
{
"input": "2 1\n0 3\n6",
"output": "Yes"
},
{
"input": "5 2\n1 2 0 0 5\n4 3",
"output": "Yes"
},
{
"input": "4 2\n2 0 0 8\n3 4",
"output": "Yes"
},
{
"input": "2 1\n0 2\n3",
"output": "Yes"
},
{
"input": "3 1\n0 4 5\n6",
"output": "Yes"
},
{
"input": "6 1\n1 2 3 4 0 5\n6",
"output": "Yes"
},
{
"input": "2 1\n2 0\n3",
"output": "No"
},
{
"input": "4 2\n11 0 0 200\n100 199",
"output": "Yes"
},
{
"input": "2 1\n5 0\n4",
"output": "Yes"
},
{
"input": "3 1\n1 0 5\n10",
"output": "Yes"
},
{
"input": "6 2\n1 2 0 0 5 6\n3 4",
"output": "Yes"
},
{
"input": "5 2\n1 0 3 0 5\n2 4",
"output": "Yes"
},
{
"input": "4 1\n1 4 0 8\n3",
"output": "Yes"
},
{
"input": "4 1\n5 9 4 0\n8",
"output": "Yes"
},
{
"input": "4 2\n1 0 0 7\n3 2",
"output": "Yes"
},
{
"input": "3 3\n0 0 0\n1 4 3",
"output": "Yes"
},
{
"input": "5 5\n0 0 0 0 0\n5 4 3 2 1",
"output": "Yes"
},
{
"input": "4 1\n3 9 4 0\n8",
"output": "Yes"
},
{
"input": "4 2\n1 0 0 4\n2 3",
"output": "Yes"
},
{
"input": "6 1\n2 4 0 8 9 10\n3",
"output": "Yes"
},
{
"input": "4 1\n0 3 5 6\n9",
"output": "Yes"
},
{
"input": "4 2\n1 2 0 0\n3 4",
"output": "Yes"
},
{
"input": "5 1\n2 3 4 5 0\n1",
"output": "Yes"
},
{
"input": "3 1\n2 0 4\n5",
"output": "Yes"
}
] | 1,538,463,094 | 2,147,483,647 | Python 3 | OK | TESTS | 96 | 124 | 1,024,000 | n,k=list(map(int,input().split()))
p=list(map(int,input().split()))
l=list(map(int,input().split()))
la=p.count(0)
for x in range(la):
if l!=list():
sa=max(l)
ka=p.index(0)
p[ka]=sa
l.remove(sa)
else:
break
tam=sorted(p)
if p.count(0)==0 and tam!=p:
print("YES")
else:
print("NO") | Title: An abandoned sentiment from past
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A few years ago, Hitagi encountered a giant crab, who stole the whole of her body weight. Ever since, she tried to avoid contact with others, for fear that this secret might be noticed.
To get rid of the oddity and recover her weight, a special integer sequence is needed. Hitagi's sequence has been broken for a long time, but now Kaiki provides an opportunity.
Hitagi's sequence *a* has a length of *n*. Lost elements in it are denoted by zeros. Kaiki provides another sequence *b*, whose length *k* equals the number of lost elements in *a* (i.e. the number of zeros). Hitagi is to replace each zero in *a* with an element from *b* so that each element in *b* should be used exactly once. Hitagi knows, however, that, apart from 0, no integer occurs in *a* and *b* more than once in total.
If the resulting sequence is not an increasing sequence, then it has the power to recover Hitagi from the oddity. You are to determine whether this is possible, or Kaiki's sequence is just another fake. In other words, you should detect whether it is possible to replace each zero in *a* with an integer from *b* so that each integer from *b* is used exactly once, and the resulting sequence is not increasing.
Input Specification:
The first line of input contains two space-separated positive integers *n* (2<=≤<=*n*<=≤<=100) and *k* (1<=≤<=*k*<=≤<=*n*) — the lengths of sequence *a* and *b* respectively.
The second line contains *n* space-separated integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=200) — Hitagi's broken sequence with exactly *k* zero elements.
The third line contains *k* space-separated integers *b*1,<=*b*2,<=...,<=*b**k* (1<=≤<=*b**i*<=≤<=200) — the elements to fill into Hitagi's sequence.
Input guarantees that apart from 0, no integer occurs in *a* and *b* more than once in total.
Output Specification:
Output "Yes" if it's possible to replace zeros in *a* with elements in *b* and make the resulting sequence not increasing, and "No" otherwise.
Demo Input:
['4 2\n11 0 0 14\n5 4\n', '6 1\n2 3 0 8 9 10\n5\n', '4 1\n8 94 0 4\n89\n', '7 7\n0 0 0 0 0 0 0\n1 2 3 4 5 6 7\n']
Demo Output:
['Yes\n', 'No\n', 'Yes\n', 'Yes\n']
Note:
In the first sample:
- Sequence *a* is 11, 0, 0, 14. - Two of the elements are lost, and the candidates in *b* are 5 and 4. - There are two possible resulting sequences: 11, 5, 4, 14 and 11, 4, 5, 14, both of which fulfill the requirements. Thus the answer is "Yes".
In the second sample, the only possible resulting sequence is 2, 3, 5, 8, 9, 10, which is an increasing sequence and therefore invalid. | ```python
n,k=list(map(int,input().split()))
p=list(map(int,input().split()))
l=list(map(int,input().split()))
la=p.count(0)
for x in range(la):
if l!=list():
sa=max(l)
ka=p.index(0)
p[ka]=sa
l.remove(sa)
else:
break
tam=sorted(p)
if p.count(0)==0 and tam!=p:
print("YES")
else:
print("NO")
``` | 3 |
|
841 | A | Generous Kefa | PROGRAMMING | 900 | [
"brute force",
"implementation"
] | null | null | One day Kefa found *n* baloons. For convenience, we denote color of *i*-th baloon as *s**i* — lowercase letter of the Latin alphabet. Also Kefa has *k* friends. Friend will be upset, If he get two baloons of the same color. Kefa want to give out all baloons to his friends. Help Kefa to find out, can he give out all his baloons, such that no one of his friens will be upset — print «YES», if he can, and «NO», otherwise. Note, that Kefa's friend will not upset, if he doesn't get baloons at all. | The first line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=100) — the number of baloons and friends.
Next line contains string *s* — colors of baloons. | Answer to the task — «YES» or «NO» in a single line.
You can choose the case (lower or upper) for each letter arbitrary. | [
"4 2\naabb\n",
"6 3\naacaab\n"
] | [
"YES\n",
"NO\n"
] | In the first sample Kefa can give 1-st and 3-rd baloon to the first friend, and 2-nd and 4-th to the second.
In the second sample Kefa needs to give to all his friends baloons of color a, but one baloon will stay, thats why answer is «NO». | 500 | [
{
"input": "4 2\naabb",
"output": "YES"
},
{
"input": "6 3\naacaab",
"output": "NO"
},
{
"input": "2 2\nlu",
"output": "YES"
},
{
"input": "5 3\novvoo",
"output": "YES"
},
{
"input": "36 13\nbzbzcffczzcbcbzzfzbbfzfzzbfbbcbfccbf",
"output": "YES"
},
{
"input": "81 3\nooycgmvvrophvcvpoupepqllqttwcocuilvyxbyumdmmfapvpnxhjhxfuagpnntonibicaqjvwfhwxhbv",
"output": "NO"
},
{
"input": "100 100\nxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx",
"output": "YES"
},
{
"input": "100 1\nnubcvvjvbjgnjsdkajimdcxvewbcytvfkihunycdrlconddlwgzjasjlsrttlrzsumzpyumpveglfqzmaofbshbojmwuwoxxvrod",
"output": "NO"
},
{
"input": "100 13\nvyldolgryldqrvoldvzvrdrgorlorszddtgqvrlisxxrxdxlqtvtgsrqlzixoyrozxzogqxlsgzdddzqrgitxxritoolzolgrtvl",
"output": "YES"
},
{
"input": "18 6\njzwtnkvmscqhmdlsxy",
"output": "YES"
},
{
"input": "21 2\nfscegcqgzesefghhwcexs",
"output": "NO"
},
{
"input": "32 22\ncduamsptaklqtxlyoutlzepxgyfkvngc",
"output": "YES"
},
{
"input": "49 27\noxyorfnkzwsfllnyvdhdanppuzrnbxehugvmlkgeymqjlmfxd",
"output": "YES"
},
{
"input": "50 24\nxxutzjwbggcwvxztttkmzovtmuwttzcbwoztttohzzxghuuthv",
"output": "YES"
},
{
"input": "57 35\nglxshztrqqfyxthqamagvtmrdparhelnzrqvcwqxjytkbuitovkdxueul",
"output": "YES"
},
{
"input": "75 23\nittttiiuitutuiiuuututiuttiuiuutuuuiuiuuuuttuuttuutuiiuiuiiuiitttuututuiuuii",
"output": "NO"
},
{
"input": "81 66\nfeqevfqfebhvubhuuvfuqheuqhbeeuebehuvhffvbqvqvfbqqvvhevqffbqqhvvqhfeehuhqeqhueuqqq",
"output": "YES"
},
{
"input": "93 42\npqeiafraiavfcteumflpcbpozcomlvpovlzdbldvoopnhdoeqaopzthiuzbzmeieiatthdeqovaqfipqlddllmfcrrnhb",
"output": "YES"
},
{
"input": "100 53\nizszyqyndzwzyzgsdagdwdazadiawizinagqqgczaqqnawgijziziawzszdjdcqjdjqiwgadydcnqisaayjiqqsscwwzjzaycwwc",
"output": "YES"
},
{
"input": "100 14\nvkrdcqbvkwuckpmnbydmczdxoagdsgtqxvhaxntdcxhjcrjyvukhugoglbmyoaqexgtcfdgemmizoniwtmisqqwcwfusmygollab",
"output": "YES"
},
{
"input": "100 42\naaaaaiiiiaiiiaaiaiiaaiiiiiaaaaaiaiiiaiiiiaiiiaaaaaiiiaaaiiaaiiiaiiiaiaaaiaiiiiaaiiiaiiaiaiiaiiiaaaia",
"output": "NO"
},
{
"input": "100 89\ntjbkmydejporbqhcbztkcumxjjgsrvxpuulbhzeeckkbchpbxwhedrlhjsabcexcohgdzouvsgphjdthpuqrlkgzxvqbuhqxdsmf",
"output": "YES"
},
{
"input": "100 100\njhpyiuuzizhubhhpxbbhpyxzhbpjphzppuhiahihiappbhuypyauhizpbibzixjbzxzpbphuiaypyujappuxiyuyaajaxjupbahb",
"output": "YES"
},
{
"input": "100 3\nsszoovvzysavsvzsozzvoozvysozsaszayaszasaysszzzysosyayyvzozovavzoyavsooaoyvoozvvozsaosvayyovazzszzssa",
"output": "NO"
},
{
"input": "100 44\ndluthkxwnorabqsukgnxnvhmsmzilyulpursnxkdsavgemiuizbyzebhyjejgqrvuckhaqtuvdmpziesmpmewpvozdanjyvwcdgo",
"output": "YES"
},
{
"input": "100 90\ntljonbnwnqounictqqctgonktiqoqlocgoblngijqokuquoolciqwnctgoggcbojtwjlculoikbggquqncittwnjbkgkgubnioib",
"output": "YES"
},
{
"input": "100 79\nykxptzgvbqxlregvkvucewtydvnhqhuggdsyqlvcfiuaiddnrrnstityyehiamrggftsqyduwxpuldztyzgmfkehprrneyvtknmf",
"output": "YES"
},
{
"input": "100 79\naagwekyovbviiqeuakbqbqifwavkfkutoriovgfmittulhwojaptacekdirgqoovlleeoqkkdukpadygfwavppohgdrmymmulgci",
"output": "YES"
},
{
"input": "100 93\nearrehrehenaddhdnrdddhdahnadndheeennrearrhraharddreaeraddhehhhrdnredanndneheddrraaneerreedhnadnerhdn",
"output": "YES"
},
{
"input": "100 48\nbmmaebaebmmmbbmxvmammbvvebvaemvbbaxvbvmaxvvmveaxmbbxaaemxmxvxxxvxbmmxaaaevvaxmvamvvmaxaxavexbmmbmmev",
"output": "YES"
},
{
"input": "100 55\nhsavbkehaaesffaeeffakhkhfehbbvbeasahbbbvkesbfvkefeesesevbsvfkbffakvshsbkahfkfakebsvafkbvsskfhfvaasss",
"output": "YES"
},
{
"input": "100 2\ncscffcffsccffsfsfffccssfsscfsfsssffcffsscfccssfffcfscfsscsccccfsssffffcfcfsfffcsfsccffscffcfccccfffs",
"output": "NO"
},
{
"input": "100 3\nzrgznxgdpgfoiifrrrsjfuhvtqxjlgochhyemismjnanfvvpzzvsgajcbsulxyeoepjfwvhkqogiiwqxjkrpsyaqdlwffoockxnc",
"output": "NO"
},
{
"input": "100 5\njbltyyfjakrjeodqepxpkjideulofbhqzxjwlarufwzwsoxhaexpydpqjvhybmvjvntuvhvflokhshpicbnfgsqsmrkrfzcrswwi",
"output": "NO"
},
{
"input": "100 1\nfnslnqktlbmxqpvcvnemxcutebdwepoxikifkzaaixzzydffpdxodmsxjribmxuqhueifdlwzytxkklwhljswqvlejedyrgguvah",
"output": "NO"
},
{
"input": "100 21\nddjenetwgwmdtjbpzssyoqrtirvoygkjlqhhdcjgeurqpunxpupwaepcqkbjjfhnvgpyqnozhhrmhfwararmlcvpgtnopvjqsrka",
"output": "YES"
},
{
"input": "100 100\nnjrhiauqlgkkpkuvciwzivjbbplipvhslqgdkfnmqrxuxnycmpheenmnrglotzuyxycosfediqcuadklsnzjqzfxnbjwvfljnlvq",
"output": "YES"
},
{
"input": "100 100\nbbbbbbbtbbttbtbbbttbttbtbbttttbbbtbttbbbtbttbtbbttttbbbbbtbbttbtbbtbttbbbtbtbtbtbtbtbbbttbbtbtbtbbtb",
"output": "YES"
},
{
"input": "14 5\nfssmmsfffmfmmm",
"output": "NO"
},
{
"input": "2 1\nff",
"output": "NO"
},
{
"input": "2 1\nhw",
"output": "YES"
},
{
"input": "2 2\nss",
"output": "YES"
},
{
"input": "1 1\nl",
"output": "YES"
},
{
"input": "100 50\nfffffttttttjjjuuuvvvvvdddxxxxwwwwgggbsssncccczzyyyyyhhhhhkrreeeeeeaaaaaiiillllllllooooqqqqqqmmpppppp",
"output": "YES"
},
{
"input": "100 50\nbbbbbbbbgggggggggggaaaaaaaahhhhhhhhhhpppppppppsssssssrrrrrrrrllzzzzzzzeeeeeeekkkkkkkwwwwwwwwjjjjjjjj",
"output": "YES"
},
{
"input": "100 50\nwwwwwwwwwwwwwwxxxxxxxxxxxxxxxxxxxxxxxxzzzzzzzzzzzzzzzzzzbbbbbbbbbbbbbbbbbbbbjjjjjjjjjjjjjjjjjjjjjjjj",
"output": "YES"
},
{
"input": "100 80\nbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbbmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmmm",
"output": "YES"
},
{
"input": "100 10\nbbttthhhhiiiiiiijjjjjvvvvpppssssseeeeeeewwwwgggkkkkkkkkmmmddddduuuzzzzllllnnnnnxxyyyffffccraaaaooooq",
"output": "YES"
},
{
"input": "100 20\nssssssssssbbbbbbbhhhhhhhyyyyyyyzzzzzzzzzzzzcccccxxxxxxxxxxddddmmmmmmmeeeeeeejjjjjjjjjwwwwwwwtttttttt",
"output": "YES"
},
{
"input": "1 2\na",
"output": "YES"
},
{
"input": "3 1\nabb",
"output": "NO"
},
{
"input": "2 1\naa",
"output": "NO"
},
{
"input": "2 1\nab",
"output": "YES"
},
{
"input": "6 2\naaaaaa",
"output": "NO"
},
{
"input": "8 4\naaaaaaaa",
"output": "NO"
},
{
"input": "4 2\naaaa",
"output": "NO"
},
{
"input": "4 3\naaaa",
"output": "NO"
},
{
"input": "1 3\na",
"output": "YES"
},
{
"input": "4 3\nzzzz",
"output": "NO"
},
{
"input": "4 1\naaaa",
"output": "NO"
},
{
"input": "3 4\nabc",
"output": "YES"
},
{
"input": "2 5\nab",
"output": "YES"
},
{
"input": "2 4\nab",
"output": "YES"
},
{
"input": "1 10\na",
"output": "YES"
},
{
"input": "5 2\nzzzzz",
"output": "NO"
},
{
"input": "53 26\naaaaaaaaaaaaaaaaaaaaaaaaaabbbbbbbbbbbbbbbbbbbbbbbbbbb",
"output": "NO"
},
{
"input": "4 1\nabab",
"output": "NO"
},
{
"input": "4 1\nabcb",
"output": "NO"
},
{
"input": "4 2\nabbb",
"output": "NO"
},
{
"input": "5 2\nabccc",
"output": "NO"
},
{
"input": "2 3\nab",
"output": "YES"
},
{
"input": "4 3\nbbbs",
"output": "YES"
},
{
"input": "10 2\nazzzzzzzzz",
"output": "NO"
},
{
"input": "1 2\nb",
"output": "YES"
},
{
"input": "1 3\nb",
"output": "YES"
},
{
"input": "4 5\nabcd",
"output": "YES"
},
{
"input": "4 6\naabb",
"output": "YES"
},
{
"input": "5 2\naaaab",
"output": "NO"
},
{
"input": "3 5\naaa",
"output": "YES"
},
{
"input": "5 3\nazzzz",
"output": "NO"
},
{
"input": "4 100\naabb",
"output": "YES"
},
{
"input": "3 10\naaa",
"output": "YES"
},
{
"input": "3 4\naaa",
"output": "YES"
},
{
"input": "12 5\naaaaabbbbbbb",
"output": "NO"
},
{
"input": "5 2\naabbb",
"output": "NO"
},
{
"input": "10 5\nzzzzzzzzzz",
"output": "NO"
},
{
"input": "2 4\naa",
"output": "YES"
},
{
"input": "1 5\na",
"output": "YES"
},
{
"input": "10 5\naaaaaaaaaa",
"output": "NO"
},
{
"input": "6 3\naaaaaa",
"output": "NO"
},
{
"input": "7 1\nabcdeee",
"output": "NO"
},
{
"input": "18 3\naaaaaabbbbbbcccccc",
"output": "NO"
},
{
"input": "8 2\naabbccdd",
"output": "YES"
},
{
"input": "4 2\nzzzz",
"output": "NO"
},
{
"input": "4 2\nabaa",
"output": "NO"
},
{
"input": "3 2\naaa",
"output": "NO"
},
{
"input": "3 1\nzzz",
"output": "NO"
},
{
"input": "5 4\nzzzzz",
"output": "NO"
},
{
"input": "6 2\naabbbc",
"output": "NO"
},
{
"input": "3 6\naaa",
"output": "YES"
},
{
"input": "2 1\nzz",
"output": "NO"
},
{
"input": "10 3\naaaeeeeeee",
"output": "NO"
},
{
"input": "4 5\naabb",
"output": "YES"
},
{
"input": "3 1\naaa",
"output": "NO"
},
{
"input": "5 2\naazzz",
"output": "NO"
},
{
"input": "6 2\nabbbbc",
"output": "NO"
},
{
"input": "4 2\nxxxx",
"output": "NO"
},
{
"input": "6 3\nzzzzzz",
"output": "NO"
},
{
"input": "3 2\nabb",
"output": "YES"
},
{
"input": "3 2\nzzz",
"output": "NO"
},
{
"input": "6 5\nzzzzzz",
"output": "NO"
},
{
"input": "6 3\nbcaaaa",
"output": "NO"
},
{
"input": "100 100\naaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaa",
"output": "YES"
},
{
"input": "3 6\nabc",
"output": "YES"
}
] | 1,633,250,371 | 2,147,483,647 | PyPy 3 | OK | TESTS | 114 | 108 | 20,172,800 | n,k=map(int,input().split())
s=input()
d=dict()
for i in s:
d[i]=d.get(i,0)+1
m=0
for _,i in d.items():
m=max(m,i)
if(m>k):
print('NO')
else:
print('YES')
| Title: Generous Kefa
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Kefa found *n* baloons. For convenience, we denote color of *i*-th baloon as *s**i* — lowercase letter of the Latin alphabet. Also Kefa has *k* friends. Friend will be upset, If he get two baloons of the same color. Kefa want to give out all baloons to his friends. Help Kefa to find out, can he give out all his baloons, such that no one of his friens will be upset — print «YES», if he can, and «NO», otherwise. Note, that Kefa's friend will not upset, if he doesn't get baloons at all.
Input Specification:
The first line contains two integers *n* and *k* (1<=≤<=*n*,<=*k*<=≤<=100) — the number of baloons and friends.
Next line contains string *s* — colors of baloons.
Output Specification:
Answer to the task — «YES» or «NO» in a single line.
You can choose the case (lower or upper) for each letter arbitrary.
Demo Input:
['4 2\naabb\n', '6 3\naacaab\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first sample Kefa can give 1-st and 3-rd baloon to the first friend, and 2-nd and 4-th to the second.
In the second sample Kefa needs to give to all his friends baloons of color a, but one baloon will stay, thats why answer is «NO». | ```python
n,k=map(int,input().split())
s=input()
d=dict()
for i in s:
d[i]=d.get(i,0)+1
m=0
for _,i in d.items():
m=max(m,i)
if(m>k):
print('NO')
else:
print('YES')
``` | 3 |
|
1 | A | Theatre Square | PROGRAMMING | 1,000 | [
"math"
] | A. Theatre Square | 1 | 256 | Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square. | The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109). | Write the needed number of flagstones. | [
"6 6 4\n"
] | [
"4\n"
] | none | 0 | [
{
"input": "6 6 4",
"output": "4"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "2 1 1",
"output": "2"
},
{
"input": "1 2 1",
"output": "2"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "1 1 3",
"output": "1"
},
{
"input": "2 3 4",
"output": "1"
},
{
"input": "1000000000 1000000000 1",
"output": "1000000000000000000"
},
{
"input": "12 13 4",
"output": "12"
},
{
"input": "222 332 5",
"output": "3015"
},
{
"input": "1000 1000 10",
"output": "10000"
},
{
"input": "1001 1000 10",
"output": "10100"
},
{
"input": "100 10001 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 999999999",
"output": "4"
},
{
"input": "1000000000 1000000000 192",
"output": "27126743055556"
},
{
"input": "1000000000 987654321 1",
"output": "987654321000000000"
},
{
"input": "456784567 1000000000 51",
"output": "175618850864484"
},
{
"input": "39916800 134217728 40320",
"output": "3295710"
}
] | 1,669,649,562 | 2,147,483,647 | Python 3 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | l=list(map(int,input().split())
for i in l:
if l.count(i)==1:
print(i)
break | Title: Theatre Square
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
Input Specification:
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Output Specification:
Write the needed number of flagstones.
Demo Input:
['6 6 4\n']
Demo Output:
['4\n']
Note:
none | ```python
l=list(map(int,input().split())
for i in l:
if l.count(i)==1:
print(i)
break
``` | -1 |
740 | A | Alyona and copybooks | PROGRAMMING | 1,300 | [
"brute force",
"implementation"
] | null | null | Little girl Alyona is in a shop to buy some copybooks for school. She study four subjects so she wants to have equal number of copybooks for each of the subjects. There are three types of copybook's packs in the shop: it is possible to buy one copybook for *a* rubles, a pack of two copybooks for *b* rubles, and a pack of three copybooks for *c* rubles. Alyona already has *n* copybooks.
What is the minimum amount of rubles she should pay to buy such number of copybooks *k* that *n*<=+<=*k* is divisible by 4? There are infinitely many packs of any type in the shop. Alyona can buy packs of different type in the same purchase. | The only line contains 4 integers *n*, *a*, *b*, *c* (1<=≤<=*n*,<=*a*,<=*b*,<=*c*<=≤<=109). | Print the minimum amount of rubles she should pay to buy such number of copybooks *k* that *n*<=+<=*k* is divisible by 4. | [
"1 1 3 4\n",
"6 2 1 1\n",
"4 4 4 4\n",
"999999999 1000000000 1000000000 1000000000\n"
] | [
"3\n",
"1\n",
"0\n",
"1000000000\n"
] | In the first example Alyona can buy 3 packs of 1 copybook for 3*a* = 3 rubles in total. After that she will have 4 copybooks which she can split between the subjects equally.
In the second example Alyuna can buy a pack of 2 copybooks for *b* = 1 ruble. She will have 8 copybooks in total.
In the third example Alyona can split the copybooks she already has between the 4 subject equally, so she doesn't need to buy anything.
In the fourth example Alyona should buy one pack of one copybook. | 500 | [
{
"input": "1 1 3 4",
"output": "3"
},
{
"input": "6 2 1 1",
"output": "1"
},
{
"input": "4 4 4 4",
"output": "0"
},
{
"input": "999999999 1000000000 1000000000 1000000000",
"output": "1000000000"
},
{
"input": "1016 3 2 1",
"output": "0"
},
{
"input": "17 100 100 1",
"output": "1"
},
{
"input": "17 2 3 100",
"output": "5"
},
{
"input": "18 1 3 3",
"output": "2"
},
{
"input": "19 1 1 1",
"output": "1"
},
{
"input": "999999997 999999990 1000000000 1000000000",
"output": "1000000000"
},
{
"input": "999999998 1000000000 999999990 1000000000",
"output": "999999990"
},
{
"input": "634074578 336470888 481199252 167959139",
"output": "335918278"
},
{
"input": "999999999 1000000000 1000000000 999999990",
"output": "1000000000"
},
{
"input": "804928248 75475634 54748096 641009859",
"output": "0"
},
{
"input": "535590429 374288891 923264237 524125987",
"output": "524125987"
},
{
"input": "561219907 673102149 496813081 702209411",
"output": "673102149"
},
{
"input": "291882089 412106895 365329221 585325539",
"output": "585325539"
},
{
"input": "757703054 5887448 643910770 58376259",
"output": "11774896"
},
{
"input": "783332532 449924898 72235422 941492387",
"output": "0"
},
{
"input": "513994713 43705451 940751563 824608515",
"output": "131116353"
},
{
"input": "539624191 782710197 514300407 2691939",
"output": "8075817"
},
{
"input": "983359971 640274071 598196518 802030518",
"output": "640274071"
},
{
"input": "8989449 379278816 26521171 685146646",
"output": "405799987"
},
{
"input": "34618927 678092074 895037311 863230070",
"output": "678092074"
},
{
"input": "205472596 417096820 468586155 41313494",
"output": "0"
},
{
"input": "19 5 1 2",
"output": "3"
},
{
"input": "17 1 2 2",
"output": "2"
},
{
"input": "18 3 3 1",
"output": "2"
},
{
"input": "19 4 3 1",
"output": "3"
},
{
"input": "936134778 715910077 747167704 219396918",
"output": "438793836"
},
{
"input": "961764255 454914823 615683844 102513046",
"output": "307539138"
},
{
"input": "692426437 48695377 189232688 985629174",
"output": "146086131"
},
{
"input": "863280107 347508634 912524637 458679894",
"output": "347508634"
},
{
"input": "593942288 86513380 486073481 341796022",
"output": "0"
},
{
"input": "914539062 680293934 764655030 519879446",
"output": "764655030"
},
{
"input": "552472140 509061481 586588704 452405440",
"output": "0"
},
{
"input": "723325809 807874739 160137548 335521569",
"output": "335521569"
},
{
"input": "748955287 546879484 733686393 808572289",
"output": "546879484"
},
{
"input": "774584765 845692742 162011045 691688417",
"output": "691688417"
},
{
"input": "505246946 439473295 30527185 869771841",
"output": "30527185"
},
{
"input": "676100616 178478041 604076030 752887969",
"output": "0"
},
{
"input": "701730093 477291299 177624874 930971393",
"output": "654916173"
},
{
"input": "432392275 216296044 751173719 109054817",
"output": "216296044"
},
{
"input": "458021753 810076598 324722563 992170945",
"output": "992170945"
},
{
"input": "188683934 254114048 48014511 170254369",
"output": "48014511"
},
{
"input": "561775796 937657403 280013594 248004555",
"output": "0"
},
{
"input": "1000000000 1000000000 1000000000 1000000000",
"output": "0"
},
{
"input": "3 10000 10000 3",
"output": "9"
},
{
"input": "3 12 3 4",
"output": "7"
},
{
"input": "3 10000 10000 1",
"output": "3"
},
{
"input": "3 1000 1000 1",
"output": "3"
},
{
"input": "3 10 10 1",
"output": "3"
},
{
"input": "3 100 100 1",
"output": "3"
},
{
"input": "3 100000 10000 1",
"output": "3"
},
{
"input": "7 10 2 3",
"output": "5"
},
{
"input": "3 1000 1000 2",
"output": "6"
},
{
"input": "1 100000 1 100000",
"output": "100000"
},
{
"input": "7 4 3 1",
"output": "3"
},
{
"input": "3 1000 1000 3",
"output": "9"
},
{
"input": "3 1000 1 1",
"output": "2"
},
{
"input": "3 10 1 1",
"output": "2"
},
{
"input": "3 100000 1 1",
"output": "2"
},
{
"input": "3 100 1 1",
"output": "2"
},
{
"input": "3 100000 100000 1",
"output": "3"
},
{
"input": "3 1000 1 100",
"output": "101"
},
{
"input": "3 1000000000 1 1000000000",
"output": "1000000000"
},
{
"input": "3 1000 1 10",
"output": "11"
},
{
"input": "3 200 1 100",
"output": "101"
},
{
"input": "7 4 1 1",
"output": "2"
},
{
"input": "7 4 12 1",
"output": "3"
},
{
"input": "3 9 1 1",
"output": "2"
},
{
"input": "3 10000000 1000000 1",
"output": "3"
},
{
"input": "7 1000 1000 1",
"output": "3"
},
{
"input": "3 10000 1 30",
"output": "31"
},
{
"input": "3 1000 1 2",
"output": "3"
},
{
"input": "7 12 6 1",
"output": "3"
},
{
"input": "3 100000 1 1000",
"output": "1001"
},
{
"input": "7 1000 1000 3",
"output": "9"
},
{
"input": "3 4 3 1",
"output": "3"
},
{
"input": "3 3000000 1 100000",
"output": "100001"
},
{
"input": "3 3 1 1",
"output": "2"
},
{
"input": "3 10 1 5",
"output": "6"
},
{
"input": "3 2000 2000 1",
"output": "3"
},
{
"input": "3 10000000 10000000 1",
"output": "3"
},
{
"input": "3 5 1 1",
"output": "2"
},
{
"input": "3 100 1 33",
"output": "34"
},
{
"input": "7 9 2 7",
"output": "9"
},
{
"input": "4448 2 3 6",
"output": "0"
},
{
"input": "2228 1 6 3",
"output": "0"
}
] | 1,479,919,702 | 802 | Python 3 | OK | TESTS | 89 | 109 | 1,228,800 | """
ATSTNG's ejudge Python3 solution template
(actual solution is below)
"""
import sys, queue
try:
import dev_act_ffc429465ab634 # empty file in directory
DEV = True
except:
DEV = False
def log(*s):
if DEV: print('LOG', *s)
class EJudge:
def __init__(self, problem="default", reclim=1<<30):
self.problem = problem
sys.setrecursionlimit(reclim)
def use_files(self, infile='', outfile=''):
if infile!='':
self.infile = open(infile)
sys.stdin = self.infile
if infile!='':
self.outfile = open(outfile, 'w')
sys.stdout = self.outfile
def use_bacs_files(self):
self.use_files(self.problem+'.in', self.problem+'.out')
def get_tl(self):
while True: pass
def get_ml(self):
tmp = [[[5]*100000 for _ in range(1000)]]
while True: tmp.append([[5]*100000 for _ in range(1000)])
def get_re(self):
s = (0,)[8]
def get_wa(self, wstr='blablalblah'):
for _ in range(3): print(wstr)
exit()
class IntReader:
def __init__(self):
self.ost = queue.Queue()
def get(self):
return int(self.sget())
def sget(self):
if self.ost.empty():
for el in input().split():
self.ost.put(el)
return self.ost.get()
def release(self):
res = []
while not self.ost.empty():
res.append(self.ost.get())
return res
###############################################################################
ej = EJudge( )
int_reader = IntReader()
fmap = lambda f,*l: list(map(f,*l))
parse_int = lambda: fmap(int, input().split())
# input
n,t1,t2,t3 = parse_int()
t3 = min(t3, t2+t1, t1*3)
t2 = min(t2, t1*2, t3*2)
t1 = min(t1, t3+t2, t3*3)
n = n%4
if n==0: ans = 0
if n==1: ans = t3
if n==2: ans = t2
if n==3: ans = t1
print(ans)
| Title: Alyona and copybooks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little girl Alyona is in a shop to buy some copybooks for school. She study four subjects so she wants to have equal number of copybooks for each of the subjects. There are three types of copybook's packs in the shop: it is possible to buy one copybook for *a* rubles, a pack of two copybooks for *b* rubles, and a pack of three copybooks for *c* rubles. Alyona already has *n* copybooks.
What is the minimum amount of rubles she should pay to buy such number of copybooks *k* that *n*<=+<=*k* is divisible by 4? There are infinitely many packs of any type in the shop. Alyona can buy packs of different type in the same purchase.
Input Specification:
The only line contains 4 integers *n*, *a*, *b*, *c* (1<=≤<=*n*,<=*a*,<=*b*,<=*c*<=≤<=109).
Output Specification:
Print the minimum amount of rubles she should pay to buy such number of copybooks *k* that *n*<=+<=*k* is divisible by 4.
Demo Input:
['1 1 3 4\n', '6 2 1 1\n', '4 4 4 4\n', '999999999 1000000000 1000000000 1000000000\n']
Demo Output:
['3\n', '1\n', '0\n', '1000000000\n']
Note:
In the first example Alyona can buy 3 packs of 1 copybook for 3*a* = 3 rubles in total. After that she will have 4 copybooks which she can split between the subjects equally.
In the second example Alyuna can buy a pack of 2 copybooks for *b* = 1 ruble. She will have 8 copybooks in total.
In the third example Alyona can split the copybooks she already has between the 4 subject equally, so she doesn't need to buy anything.
In the fourth example Alyona should buy one pack of one copybook. | ```python
"""
ATSTNG's ejudge Python3 solution template
(actual solution is below)
"""
import sys, queue
try:
import dev_act_ffc429465ab634 # empty file in directory
DEV = True
except:
DEV = False
def log(*s):
if DEV: print('LOG', *s)
class EJudge:
def __init__(self, problem="default", reclim=1<<30):
self.problem = problem
sys.setrecursionlimit(reclim)
def use_files(self, infile='', outfile=''):
if infile!='':
self.infile = open(infile)
sys.stdin = self.infile
if infile!='':
self.outfile = open(outfile, 'w')
sys.stdout = self.outfile
def use_bacs_files(self):
self.use_files(self.problem+'.in', self.problem+'.out')
def get_tl(self):
while True: pass
def get_ml(self):
tmp = [[[5]*100000 for _ in range(1000)]]
while True: tmp.append([[5]*100000 for _ in range(1000)])
def get_re(self):
s = (0,)[8]
def get_wa(self, wstr='blablalblah'):
for _ in range(3): print(wstr)
exit()
class IntReader:
def __init__(self):
self.ost = queue.Queue()
def get(self):
return int(self.sget())
def sget(self):
if self.ost.empty():
for el in input().split():
self.ost.put(el)
return self.ost.get()
def release(self):
res = []
while not self.ost.empty():
res.append(self.ost.get())
return res
###############################################################################
ej = EJudge( )
int_reader = IntReader()
fmap = lambda f,*l: list(map(f,*l))
parse_int = lambda: fmap(int, input().split())
# input
n,t1,t2,t3 = parse_int()
t3 = min(t3, t2+t1, t1*3)
t2 = min(t2, t1*2, t3*2)
t1 = min(t1, t3+t2, t3*3)
n = n%4
if n==0: ans = 0
if n==1: ans = t3
if n==2: ans = t2
if n==3: ans = t1
print(ans)
``` | 3 |
|
61 | A | Ultra-Fast Mathematician | PROGRAMMING | 800 | [
"implementation"
] | A. Ultra-Fast Mathematician | 2 | 256 | Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate. | There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100. | Write one line — the corresponding answer. Do not omit the leading 0s. | [
"1010100\n0100101\n",
"000\n111\n",
"1110\n1010\n",
"01110\n01100\n"
] | [
"1110001\n",
"111\n",
"0100\n",
"00010\n"
] | none | 500 | [
{
"input": "1010100\n0100101",
"output": "1110001"
},
{
"input": "000\n111",
"output": "111"
},
{
"input": "1110\n1010",
"output": "0100"
},
{
"input": "01110\n01100",
"output": "00010"
},
{
"input": "011101\n000001",
"output": "011100"
},
{
"input": "10\n01",
"output": "11"
},
{
"input": "00111111\n11011101",
"output": "11100010"
},
{
"input": "011001100\n101001010",
"output": "110000110"
},
{
"input": "1100100001\n0110101100",
"output": "1010001101"
},
{
"input": "00011101010\n10010100101",
"output": "10001001111"
},
{
"input": "100000101101\n111010100011",
"output": "011010001110"
},
{
"input": "1000001111010\n1101100110001",
"output": "0101101001011"
},
{
"input": "01011111010111\n10001110111010",
"output": "11010001101101"
},
{
"input": "110010000111100\n001100101011010",
"output": "111110101100110"
},
{
"input": "0010010111110000\n0000000011010110",
"output": "0010010100100110"
},
{
"input": "00111110111110000\n01111100001100000",
"output": "01000010110010000"
},
{
"input": "101010101111010001\n001001111101111101",
"output": "100011010010101100"
},
{
"input": "0110010101111100000\n0011000101000000110",
"output": "0101010000111100110"
},
{
"input": "11110100011101010111\n00001000011011000000",
"output": "11111100000110010111"
},
{
"input": "101010101111101101001\n111010010010000011111",
"output": "010000111101101110110"
},
{
"input": "0000111111100011000010\n1110110110110000001010",
"output": "1110001001010011001000"
},
{
"input": "10010010101000110111000\n00101110100110111000111",
"output": "10111100001110001111111"
},
{
"input": "010010010010111100000111\n100100111111100011001110",
"output": "110110101101011111001001"
},
{
"input": "0101110100100111011010010\n0101100011010111001010001",
"output": "0000010111110000010000011"
},
{
"input": "10010010100011110111111011\n10000110101100000001000100",
"output": "00010100001111110110111111"
},
{
"input": "000001111000000100001000000\n011100111101111001110110001",
"output": "011101000101111101111110001"
},
{
"input": "0011110010001001011001011100\n0000101101000011101011001010",
"output": "0011011111001010110010010110"
},
{
"input": "11111000000000010011001101111\n11101110011001010100010000000",
"output": "00010110011001000111011101111"
},
{
"input": "011001110000110100001100101100\n001010000011110000001000101001",
"output": "010011110011000100000100000101"
},
{
"input": "1011111010001100011010110101111\n1011001110010000000101100010101",
"output": "0000110100011100011111010111010"
},
{
"input": "10111000100001000001010110000001\n10111000001100101011011001011000",
"output": "00000000101101101010001111011001"
},
{
"input": "000001010000100001000000011011100\n111111111001010100100001100000111",
"output": "111110101001110101100001111011011"
},
{
"input": "1101000000000010011011101100000110\n1110000001100010011010000011011110",
"output": "0011000001100000000001101111011000"
},
{
"input": "01011011000010100001100100011110001\n01011010111000001010010100001110000",
"output": "00000001111010101011110000010000001"
},
{
"input": "000011111000011001000110111100000100\n011011000110000111101011100111000111",
"output": "011000111110011110101101011011000011"
},
{
"input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000",
"output": "1011001001111001001011101010101000010"
},
{
"input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011",
"output": "10001110000010101110000111000011111110"
},
{
"input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100",
"output": "000100001011110000011101110111010001110"
},
{
"input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001",
"output": "1101110101010110000011000000101011110011"
},
{
"input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100",
"output": "11001011110010010000010111001100001001110"
},
{
"input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110",
"output": "001100101000011111111101111011101010111001"
},
{
"input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001",
"output": "0111010010100110110101100010000100010100000"
},
{
"input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100",
"output": "11111110000000100101000100110111001100011001"
},
{
"input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011",
"output": "101011011100100010100011011001101010100100010"
},
{
"input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001",
"output": "1101001100111011010111110110101111001011110111"
},
{
"input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001",
"output": "10010101000101000000011010011110011110011110001"
},
{
"input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100",
"output": "011011011100000000010101110010000000101000111101"
},
{
"input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100",
"output": "0101010111101001011011110110011101010101010100011"
},
{
"input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011",
"output": "11001011010010111000010110011101100100001110111111"
},
{
"input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011",
"output": "111011101010011100001111101001101011110010010110001"
},
{
"input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001",
"output": "0100111110110011111110010010010000110111100101101101"
},
{
"input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100",
"output": "01011001110111010111001100010011010100010000111011000"
},
{
"input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111",
"output": "100011101001001000011011011001111000100000010100100100"
},
{
"input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110",
"output": "1100110010000101101010111111101001001001110101110010110"
},
{
"input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110",
"output": "01000111100111001011110010100011111111110010101100001101"
},
{
"input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010",
"output": "110001010001000011000101110101000100001011111001011001001"
},
{
"input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111",
"output": "1110100010111000101001001011101110011111100111000011011011"
},
{
"input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110",
"output": "01110110101110100100110011010000001000101100101111000111011"
},
{
"input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011",
"output": "111100101000000011101011011001110010101111000110010010000000"
},
{
"input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111",
"output": "0100100010111110010011101010000011111110001110010110010111001"
},
{
"input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111",
"output": "00110100000011001101101100100010110010001100000001100110011101"
},
{
"input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011",
"output": "000000011000111011110011101000010000010100101000000011010110010"
},
{
"input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010",
"output": "0010100110110100111100100100101101010100100111011010001001010101"
},
{
"input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111",
"output": "11010110111100101111101001100001110100010110010110110111100110100"
},
{
"input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111",
"output": "111111010011011100101110100110111111111001111110011010111111110000"
},
{
"input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110",
"output": "1010101010100010001001001001100000111000010010010100010011000100000"
},
{
"input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000",
"output": "00011111011111001000011100010011100011010100101011011000001001111110"
},
{
"input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111",
"output": "001111000011001110100111010101111111011100110011001010010010000111011"
},
{
"input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101",
"output": "0110001100110100010000110111000010011010011000011001010011010100010100"
},
{
"input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010",
"output": "00010000000110110101000011001000000100100110111010011111101010001010000"
},
{
"input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001",
"output": "000100100000000110011100100001010110101001100101110010010011111001110111"
},
{
"input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000",
"output": "1000111100010011010110011101000000101010101100011111100001101111001010010"
},
{
"input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011",
"output": "01000010011110111001011011110000001011000111101101101010010110001010100100"
},
{
"input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101",
"output": "101101110110110010011100001011111100100001110000101100110000100011011100110"
},
{
"input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001",
"output": "1110111111110010111000001100101010101011010100101010100101100011001001111111"
},
{
"input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111",
"output": "10111011000111000101110100101000100111011011100011110110000101010001111010111"
},
{
"input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110",
"output": "110100100110000101010010011010011001100110000111010000010100001011110111111101"
},
{
"input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111",
"output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111"
},
{
"input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001",
"output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001"
},
{
"input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110",
"output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011"
},
{
"input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111",
"output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101"
},
{
"input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010",
"output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101"
},
{
"input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000",
"output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001"
},
{
"input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011",
"output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110"
},
{
"input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011",
"output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011"
},
{
"input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011",
"output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011"
},
{
"input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010",
"output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011"
},
{
"input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001",
"output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110"
},
{
"input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111",
"output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010"
},
{
"input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011",
"output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011"
},
{
"input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100",
"output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000"
},
{
"input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001",
"output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101"
},
{
"input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110",
"output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101"
},
{
"input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011",
"output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110"
},
{
"input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111",
"output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110"
},
{
"input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000",
"output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001"
},
{
"input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010",
"output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101"
},
{
"input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101",
"output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011"
},
{
"input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011",
"output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010",
"output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011"
},
{
"input": "0\n0",
"output": "0"
},
{
"input": "0\n1",
"output": "1"
}
] | 1,573,872,972 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 0 | 124 | 0 | m = input()
n = int(input())
k = len(m)
m = int(m)
kn = len(str(n))
ans = ['', '0'*(k-kn)][kn<k] + str(m+n)
ans = ans.replace('2','0')
print(ans) | Title: Ultra-Fast Mathematician
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
Input Specification:
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Output Specification:
Write one line — the corresponding answer. Do not omit the leading 0s.
Demo Input:
['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n']
Demo Output:
['1110001\n', '111\n', '0100\n', '00010\n']
Note:
none | ```python
m = input()
n = int(input())
k = len(m)
m = int(m)
kn = len(str(n))
ans = ['', '0'*(k-kn)][kn<k] + str(m+n)
ans = ans.replace('2','0')
print(ans)
``` | 0 |
519 | A | A and B and Chess | PROGRAMMING | 900 | [
"implementation"
] | null | null | A and B are preparing themselves for programming contests.
To train their logical thinking and solve problems better, A and B decided to play chess. During the game A wondered whose position is now stronger.
For each chess piece we know its weight:
- the queen's weight is 9, - the rook's weight is 5, - the bishop's weight is 3, - the knight's weight is 3, - the pawn's weight is 1, - the king's weight isn't considered in evaluating position.
The player's weight equals to the sum of weights of all his pieces on the board.
As A doesn't like counting, he asked you to help him determine which player has the larger position weight. | The input contains eight lines, eight characters each — the board's description.
The white pieces on the board are marked with uppercase letters, the black pieces are marked with lowercase letters.
The white pieces are denoted as follows: the queen is represented is 'Q', the rook — as 'R', the bishop — as'B', the knight — as 'N', the pawn — as 'P', the king — as 'K'.
The black pieces are denoted as 'q', 'r', 'b', 'n', 'p', 'k', respectively.
An empty square of the board is marked as '.' (a dot).
It is not guaranteed that the given chess position can be achieved in a real game. Specifically, there can be an arbitrary (possibly zero) number pieces of each type, the king may be under attack and so on. | Print "White" (without quotes) if the weight of the position of the white pieces is more than the weight of the position of the black pieces, print "Black" if the weight of the black pieces is more than the weight of the white pieces and print "Draw" if the weights of the white and black pieces are equal. | [
"...QK...\n........\n........\n........\n........\n........\n........\n...rk...\n",
"rnbqkbnr\npppppppp\n........\n........\n........\n........\nPPPPPPPP\nRNBQKBNR\n",
"rppppppr\n...k....\n........\n........\n........\n........\nK...Q...\n........\n"
] | [
"White\n",
"Draw\n",
"Black\n"
] | In the first test sample the weight of the position of the white pieces equals to 9, the weight of the position of the black pieces equals 5.
In the second test sample the weights of the positions of the black and the white pieces are equal to 39.
In the third test sample the weight of the position of the white pieces equals to 9, the weight of the position of the black pieces equals to 16. | 500 | [
{
"input": "rnbqkbnr\npppppppp\n........\n........\n........\n........\nPPPPPPPP\nRNBQKBNR",
"output": "Draw"
},
{
"input": "....bQ.K\n.B......\n.....P..\n........\n........\n........\n...N.P..\n.....R..",
"output": "White"
},
{
"input": "b....p..\nR.......\n.pP...b.\npp......\nq.PPNpPR\n..K..rNn\nP.....p.\n...Q..B.",
"output": "White"
},
{
"input": "...Nn...\n........\n........\n........\n.R....b.\n........\n........\n......p.",
"output": "White"
},
{
"input": "qqqqqqqq\nqqqqqqqq\nqqqqqqqq\nqqqqqqqq\nqqqqqqqq\nqqqqqqqq\nqqqqqqqq\nqqqqqqqq",
"output": "Black"
},
{
"input": "QQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ",
"output": "White"
},
{
"input": "qqqqqqqq\nqqqqqqqq\nqqqqqqqq\nqqqqqqqq\nQQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ\nQQQQQQQQ",
"output": "Draw"
},
{
"input": "QQQQQQQQ\nQQQQQQQQ\n........\n........\n........\n........\nrrrrrr..\nrrrrrrrr",
"output": "White"
},
{
"input": "........\n........\n........\n........\n........\n........\n........\n.......n",
"output": "Black"
},
{
"input": "........\n...b....\n........\n........\n........\n........\n........\n.......K",
"output": "Black"
},
{
"input": "........\n........\n........\n........\n........\n........\n........\n......Kp",
"output": "Black"
},
{
"input": "........\n........\n........\n........\n........\n........\n........\n.......Q",
"output": "White"
},
{
"input": "........\n........\n........\n........\n........\n........\n........\n......Bp",
"output": "White"
},
{
"input": "........\n........\n........\n........\n........\n........\n........\nkkkkkB..",
"output": "White"
},
{
"input": "QqPQNN.Q\n.qBbr.qB\np.RKBpNK\nPknBr.nq\nKqKRNKKk\n.BqPqkb.\nPBNPr.rk\nBpBKrPRR",
"output": "Black"
},
{
"input": "........\n........\n........\n........\n........\n........\n........\n.......K",
"output": "Draw"
}
] | 1,676,484,070 | 2,147,483,647 | Python 3 | OK | TESTS | 65 | 46 | 0 | #519A
valW = 0
valB = 0
for _ in range(8):
a = input()
for i in range(8) :
if a[i] == 'Q':
valW = valW + 9
elif a[i] == 'R' :
valW = valW + 5
elif a[i] == 'B' :
valW = valW + 3
elif a[i] == 'N' :
valW = valW + 3
elif a[i] == 'P' :
valW = valW + 1
elif a[i] == 'K' :
valW = valW + 0
elif a[i] == 'q':
valB = valB + 9
elif a[i] == 'r' :
valB = valB + 5
elif a[i] == 'b' :
valB = valB + 3
elif a[i] == 'n' :
valB = valB + 3
elif a[i] == 'p' :
valB = valB + 1
elif a[i] == 'k' :
valB = valB + 0
if valW == valB :
print('Draw')
elif valW > valB :
print('White')
else :
print('Black')
#print(valW, valB)
#96 112
| Title: A and B and Chess
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A and B are preparing themselves for programming contests.
To train their logical thinking and solve problems better, A and B decided to play chess. During the game A wondered whose position is now stronger.
For each chess piece we know its weight:
- the queen's weight is 9, - the rook's weight is 5, - the bishop's weight is 3, - the knight's weight is 3, - the pawn's weight is 1, - the king's weight isn't considered in evaluating position.
The player's weight equals to the sum of weights of all his pieces on the board.
As A doesn't like counting, he asked you to help him determine which player has the larger position weight.
Input Specification:
The input contains eight lines, eight characters each — the board's description.
The white pieces on the board are marked with uppercase letters, the black pieces are marked with lowercase letters.
The white pieces are denoted as follows: the queen is represented is 'Q', the rook — as 'R', the bishop — as'B', the knight — as 'N', the pawn — as 'P', the king — as 'K'.
The black pieces are denoted as 'q', 'r', 'b', 'n', 'p', 'k', respectively.
An empty square of the board is marked as '.' (a dot).
It is not guaranteed that the given chess position can be achieved in a real game. Specifically, there can be an arbitrary (possibly zero) number pieces of each type, the king may be under attack and so on.
Output Specification:
Print "White" (without quotes) if the weight of the position of the white pieces is more than the weight of the position of the black pieces, print "Black" if the weight of the black pieces is more than the weight of the white pieces and print "Draw" if the weights of the white and black pieces are equal.
Demo Input:
['...QK...\n........\n........\n........\n........\n........\n........\n...rk...\n', 'rnbqkbnr\npppppppp\n........\n........\n........\n........\nPPPPPPPP\nRNBQKBNR\n', 'rppppppr\n...k....\n........\n........\n........\n........\nK...Q...\n........\n']
Demo Output:
['White\n', 'Draw\n', 'Black\n']
Note:
In the first test sample the weight of the position of the white pieces equals to 9, the weight of the position of the black pieces equals 5.
In the second test sample the weights of the positions of the black and the white pieces are equal to 39.
In the third test sample the weight of the position of the white pieces equals to 9, the weight of the position of the black pieces equals to 16. | ```python
#519A
valW = 0
valB = 0
for _ in range(8):
a = input()
for i in range(8) :
if a[i] == 'Q':
valW = valW + 9
elif a[i] == 'R' :
valW = valW + 5
elif a[i] == 'B' :
valW = valW + 3
elif a[i] == 'N' :
valW = valW + 3
elif a[i] == 'P' :
valW = valW + 1
elif a[i] == 'K' :
valW = valW + 0
elif a[i] == 'q':
valB = valB + 9
elif a[i] == 'r' :
valB = valB + 5
elif a[i] == 'b' :
valB = valB + 3
elif a[i] == 'n' :
valB = valB + 3
elif a[i] == 'p' :
valB = valB + 1
elif a[i] == 'k' :
valB = valB + 0
if valW == valB :
print('Draw')
elif valW > valB :
print('White')
else :
print('Black')
#print(valW, valB)
#96 112
``` | 3 |
|
61 | A | Ultra-Fast Mathematician | PROGRAMMING | 800 | [
"implementation"
] | A. Ultra-Fast Mathematician | 2 | 256 | Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate. | There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100. | Write one line — the corresponding answer. Do not omit the leading 0s. | [
"1010100\n0100101\n",
"000\n111\n",
"1110\n1010\n",
"01110\n01100\n"
] | [
"1110001\n",
"111\n",
"0100\n",
"00010\n"
] | none | 500 | [
{
"input": "1010100\n0100101",
"output": "1110001"
},
{
"input": "000\n111",
"output": "111"
},
{
"input": "1110\n1010",
"output": "0100"
},
{
"input": "01110\n01100",
"output": "00010"
},
{
"input": "011101\n000001",
"output": "011100"
},
{
"input": "10\n01",
"output": "11"
},
{
"input": "00111111\n11011101",
"output": "11100010"
},
{
"input": "011001100\n101001010",
"output": "110000110"
},
{
"input": "1100100001\n0110101100",
"output": "1010001101"
},
{
"input": "00011101010\n10010100101",
"output": "10001001111"
},
{
"input": "100000101101\n111010100011",
"output": "011010001110"
},
{
"input": "1000001111010\n1101100110001",
"output": "0101101001011"
},
{
"input": "01011111010111\n10001110111010",
"output": "11010001101101"
},
{
"input": "110010000111100\n001100101011010",
"output": "111110101100110"
},
{
"input": "0010010111110000\n0000000011010110",
"output": "0010010100100110"
},
{
"input": "00111110111110000\n01111100001100000",
"output": "01000010110010000"
},
{
"input": "101010101111010001\n001001111101111101",
"output": "100011010010101100"
},
{
"input": "0110010101111100000\n0011000101000000110",
"output": "0101010000111100110"
},
{
"input": "11110100011101010111\n00001000011011000000",
"output": "11111100000110010111"
},
{
"input": "101010101111101101001\n111010010010000011111",
"output": "010000111101101110110"
},
{
"input": "0000111111100011000010\n1110110110110000001010",
"output": "1110001001010011001000"
},
{
"input": "10010010101000110111000\n00101110100110111000111",
"output": "10111100001110001111111"
},
{
"input": "010010010010111100000111\n100100111111100011001110",
"output": "110110101101011111001001"
},
{
"input": "0101110100100111011010010\n0101100011010111001010001",
"output": "0000010111110000010000011"
},
{
"input": "10010010100011110111111011\n10000110101100000001000100",
"output": "00010100001111110110111111"
},
{
"input": "000001111000000100001000000\n011100111101111001110110001",
"output": "011101000101111101111110001"
},
{
"input": "0011110010001001011001011100\n0000101101000011101011001010",
"output": "0011011111001010110010010110"
},
{
"input": "11111000000000010011001101111\n11101110011001010100010000000",
"output": "00010110011001000111011101111"
},
{
"input": "011001110000110100001100101100\n001010000011110000001000101001",
"output": "010011110011000100000100000101"
},
{
"input": "1011111010001100011010110101111\n1011001110010000000101100010101",
"output": "0000110100011100011111010111010"
},
{
"input": "10111000100001000001010110000001\n10111000001100101011011001011000",
"output": "00000000101101101010001111011001"
},
{
"input": "000001010000100001000000011011100\n111111111001010100100001100000111",
"output": "111110101001110101100001111011011"
},
{
"input": "1101000000000010011011101100000110\n1110000001100010011010000011011110",
"output": "0011000001100000000001101111011000"
},
{
"input": "01011011000010100001100100011110001\n01011010111000001010010100001110000",
"output": "00000001111010101011110000010000001"
},
{
"input": "000011111000011001000110111100000100\n011011000110000111101011100111000111",
"output": "011000111110011110101101011011000011"
},
{
"input": "1001000010101110001000000011111110010\n0010001011010111000011101001010110000",
"output": "1011001001111001001011101010101000010"
},
{
"input": "00011101011001100101111111000000010101\n10010011011011001011111000000011101011",
"output": "10001110000010101110000111000011111110"
},
{
"input": "111011100110001001101111110010111001010\n111111101101111001110010000101101000100",
"output": "000100001011110000011101110111010001110"
},
{
"input": "1111001001101000001000000010010101001010\n0010111100111110001011000010111110111001",
"output": "1101110101010110000011000000101011110011"
},
{
"input": "00100101111000000101011111110010100011010\n11101110001010010101001000111110101010100",
"output": "11001011110010010000010111001100001001110"
},
{
"input": "101011001110110100101001000111010101101111\n100111100110101011010100111100111111010110",
"output": "001100101000011111111101111011101010111001"
},
{
"input": "1111100001100101000111101001001010011100001\n1000110011000011110010001011001110001000001",
"output": "0111010010100110110101100010000100010100000"
},
{
"input": "01100111011111010101000001101110000001110101\n10011001011111110000000101011001001101101100",
"output": "11111110000000100101000100110111001100011001"
},
{
"input": "110010100111000100100101100000011100000011001\n011001111011100110000110111001110110100111011",
"output": "101011011100100010100011011001101010100100010"
},
{
"input": "0001100111111011010110100100111000000111000110\n1100101011000000000001010010010111001100110001",
"output": "1101001100111011010111110110101111001011110111"
},
{
"input": "00000101110110110001110010100001110100000100000\n10010000110011110001101000111111101010011010001",
"output": "10010101000101000000011010011110011110011110001"
},
{
"input": "110000100101011100100011001111110011111110010001\n101011111001011100110110111101110011010110101100",
"output": "011011011100000000010101110010000000101000111101"
},
{
"input": "0101111101011111010101011101000011101100000000111\n0000101010110110001110101011011110111001010100100",
"output": "0101010111101001011011110110011101010101010100011"
},
{
"input": "11000100010101110011101000011111001010110111111100\n00001111000111001011111110000010101110111001000011",
"output": "11001011010010111000010110011101100100001110111111"
},
{
"input": "101000001101111101101111111000001110110010101101010\n010011100111100001100000010001100101000000111011011",
"output": "111011101010011100001111101001101011110010010110001"
},
{
"input": "0011111110010001010100010110111000110011001101010100\n0111000000100010101010000100101000000100101000111001",
"output": "0100111110110011111110010010010000110111100101101101"
},
{
"input": "11101010000110000011011010000001111101000111011111100\n10110011110001010100010110010010101001010111100100100",
"output": "01011001110111010111001100010011010100010000111011000"
},
{
"input": "011000100001000001101000010110100110011110100111111011\n111011001000001001110011001111011110111110110011011111",
"output": "100011101001001000011011011001111000100000010100100100"
},
{
"input": "0111010110010100000110111011010110100000000111110110000\n1011100100010001101100000100111111101001110010000100110",
"output": "1100110010000101101010111111101001001001110101110010110"
},
{
"input": "10101000100111000111010001011011011011110100110101100011\n11101111000000001100100011111000100100000110011001101110",
"output": "01000111100111001011110010100011111111110010101100001101"
},
{
"input": "000000111001010001000000110001001011100010011101010011011\n110001101000010010000101000100001111101001100100001010010",
"output": "110001010001000011000101110101000100001011111001011001001"
},
{
"input": "0101011100111010000111110010101101111111000000111100011100\n1011111110000010101110111001000011100000100111111111000111",
"output": "1110100010111000101001001011101110011111100111000011011011"
},
{
"input": "11001000001100100111100111100100101011000101001111001001101\n10111110100010000011010100110100100011101001100000001110110",
"output": "01110110101110100100110011010000001000101100101111000111011"
},
{
"input": "010111011011101000000110000110100110001110100001110110111011\n101011110011101011101101011111010100100001100111100100111011",
"output": "111100101000000011101011011001110010101111000110010010000000"
},
{
"input": "1001011110110110000100011001010110000100011010010111010101110\n1101111100001000010111110011010101111010010100000001000010111",
"output": "0100100010111110010011101010000011111110001110010110010111001"
},
{
"input": "10000010101111100111110101111000010100110111101101111111111010\n10110110101100101010011001011010100110111011101100011001100111",
"output": "00110100000011001101101100100010110010001100000001100110011101"
},
{
"input": "011111010011111000001010101001101001000010100010111110010100001\n011111001011000011111001000001111001010110001010111101000010011",
"output": "000000011000111011110011101000010000010100101000000011010110010"
},
{
"input": "1111000000110001011101000100100100001111011100001111001100011111\n1101100110000101100001100000001001011011111011010101000101001010",
"output": "0010100110110100111100100100101101010100100111011010001001010101"
},
{
"input": "01100000101010010011001110100110110010000110010011011001100100011\n10110110010110111100100111000111000110010000000101101110000010111",
"output": "11010110111100101111101001100001110100010110010110110111100110100"
},
{
"input": "001111111010000100001100001010011001111110011110010111110001100111\n110000101001011000100010101100100110000111100000001101001110010111",
"output": "111111010011011100101110100110111111111001111110011010111111110000"
},
{
"input": "1011101011101101011110101101011101011000010011100101010101000100110\n0001000001001111010111100100111101100000000001110001000110000000110",
"output": "1010101010100010001001001001100000111000010010010100010011000100000"
},
{
"input": "01000001011001010011011100010000100100110101111011011011110000001110\n01011110000110011011000000000011000111100001010000000011111001110000",
"output": "00011111011111001000011100010011100011010100101011011000001001111110"
},
{
"input": "110101010100110101000001111110110100010010000100111110010100110011100\n111010010111111011100110101011001011001110110111110100000110110100111",
"output": "001111000011001110100111010101111111011100110011001010010010000111011"
},
{
"input": "1001101011000001011111100110010010000011010001001111011100010100110001\n1111100111110101001111010001010000011001001001010110001111000000100101",
"output": "0110001100110100010000110111000010011010011000011001010011010100010100"
},
{
"input": "00000111110010110001110110001010010101000111011001111111100110011110010\n00010111110100000100110101000010010001100001100011100000001100010100010",
"output": "00010000000110110101000011001000000100100110111010011111101010001010000"
},
{
"input": "100101011100101101000011010001011001101110101110001100010001010111001110\n100001111100101011011111110000001111000111001011111110000010101110111001",
"output": "000100100000000110011100100001010110101001100101110010010011111001110111"
},
{
"input": "1101100001000111001101001011101000111000011110000001001101101001111011010\n0101011101010100011011010110101000010010110010011110101100000110110001000",
"output": "1000111100010011010110011101000000101010101100011111100001101111001010010"
},
{
"input": "01101101010011110101100001110101111011100010000010001101111000011110111111\n00101111001101001100111010000101110000100101101111100111101110010100011011",
"output": "01000010011110111001011011110000001011000111101101101010010110001010100100"
},
{
"input": "101100101100011001101111110110110010100110110010100001110010110011001101011\n000001011010101011110011111101001110000111000010001101000010010000010001101",
"output": "101101110110110010011100001011111100100001110000101100110000100011011100110"
},
{
"input": "0010001011001010001100000010010011110110011000100000000100110000101111001110\n1100110100111000110100001110111001011101001100001010100001010011100110110001",
"output": "1110111111110010111000001100101010101011010100101010100101100011001001111111"
},
{
"input": "00101101010000000101011001101011001100010001100000101011101110000001111001000\n10010110010111000000101101000011101011001010000011011101101011010000000011111",
"output": "10111011000111000101110100101000100111011011100011110110000101010001111010111"
},
{
"input": "111100000100100000101001100001001111001010001000001000000111010000010101101011\n001000100010100101111011111011010110101100001111011000010011011011100010010110",
"output": "110100100110000101010010011010011001100110000111010000010100001011110111111101"
},
{
"input": "0110001101100100001111110101101000100101010010101010011001101001001101110000000\n0111011000000010010111011110010000000001000110001000011001101000000001110100111",
"output": "0001010101100110011000101011111000100100010100100010000000000001001100000100111"
},
{
"input": "10001111111001000101001011110101111010100001011010101100111001010001010010001000\n10000111010010011110111000111010101100000011110001101111001000111010100000000001",
"output": "00001000101011011011110011001111010110100010101011000011110001101011110010001001"
},
{
"input": "100110001110110000100101001110000011110110000110000000100011110100110110011001101\n110001110101110000000100101001101011111100100100001001000110000001111100011110110",
"output": "010111111011000000100001100111101000001010100010001001100101110101001010000111011"
},
{
"input": "0000010100100000010110111100011111111010011101000000100000011001001101101100111010\n0100111110011101010110101011110110010111001111000110101100101110111100101000111111",
"output": "0100101010111101000000010111101001101101010010000110001100110111110001000100000101"
},
{
"input": "11000111001010100001110000001001011010010010110000001110100101000001010101100110111\n11001100100100100001101010110100000111100011101110011010110100001001000011011011010",
"output": "00001011101110000000011010111101011101110001011110010100010001001000010110111101101"
},
{
"input": "010110100010001000100010101001101010011010111110100001000100101000111011100010100001\n110000011111101101010011111000101010111010100001001100001001100101000000111000000000",
"output": "100110111101100101110001010001000000100000011111101101001101001101111011011010100001"
},
{
"input": "0000011110101110010101110110110101100001011001101010101001000010000010000000101001101\n1100111111011100000110000111101110011111100111110001011001000010011111100001001100011",
"output": "1100100001110010010011110001011011111110111110011011110000000000011101100001100101110"
},
{
"input": "10100000101101110001100010010010100101100011010010101000110011100000101010110010000000\n10001110011011010010111011011101101111000111110000111000011010010101001100000001010011",
"output": "00101110110110100011011001001111001010100100100010010000101001110101100110110011010011"
},
{
"input": "001110000011111101101010011111000101010111010100001001100001001100101000000111000000000\n111010000000000000101001110011001000111011001100101010011001000011101001001011110000011",
"output": "110100000011111101000011101100001101101100011000100011111000001111000001001100110000011"
},
{
"input": "1110111100111011010101011011001110001010010010110011110010011111000010011111010101100001\n1001010101011001001010100010101100000110111101011000100010101111111010111100001110010010",
"output": "0111101001100010011111111001100010001100101111101011010000110000111000100011011011110011"
},
{
"input": "11100010001100010011001100001100010011010001101110011110100101110010101101011101000111111\n01110000000110111010110100001010000101011110100101010011000110101110101101110111011110001",
"output": "10010010001010101001111000000110010110001111001011001101100011011100000000101010011001110"
},
{
"input": "001101011001100101101100110000111000101011001001100100000100101000100000110100010111111101\n101001111110000010111101111110001001111001111101111010000110111000100100110010010001011111",
"output": "100100100111100111010001001110110001010010110100011110000010010000000100000110000110100010"
},
{
"input": "1010110110010101000110010010110101011101010100011001101011000110000000100011100100011000000\n0011011111100010001111101101000111001011101110100000110111100100101111010110101111011100011",
"output": "1001101001110111001001111111110010010110111010111001011100100010101111110101001011000100011"
},
{
"input": "10010010000111010111011111110010100101100000001100011100111011100010000010010001011100001100\n00111010100010110010000100010111010001111110100100100011101000101111111111001101101100100100",
"output": "10101000100101100101011011100101110100011110101000111111010011001101111101011100110000101000"
},
{
"input": "010101110001010101100000010111010000000111110011001101100011001000000011001111110000000010100\n010010111011100101010101111110110000000111000100001101101001001000001100101110001010000100001",
"output": "000111001010110000110101101001100000000000110111000000001010000000001111100001111010000110101"
},
{
"input": "1100111110011001000111101001001011000110011010111111100010111111001100111111011101100111101011\n1100000011001000110100110111000001011001010111101000010010100011000001100100111101101000010110",
"output": "0000111101010001110011011110001010011111001101010111110000011100001101011011100000001111111101"
},
{
"input": "00011000100100110111100101100100000000010011110111110010101110110011100001010111010011110100101\n00011011111011111011100101100111100101001110010111000010000111000100100100000001110101111011011",
"output": "00000011011111001100000000000011100101011101100000110000101001110111000101010110100110001111110"
},
{
"input": "000101011001001100000111100010110101111011110101111101000110001101011010111110110011100100000001\n011000101010011111011000111000100000000011011000000001111110001000001111101010110000011100001111",
"output": "011101110011010011011111011010010101111000101101111100111000000101010101010100000011111000001110"
},
{
"input": "1000101001011010000100100100010010011101011001110101111011101111111110010101001101010001010101001\n0110110010011100011111011111110111000000010001110100001010111110101011010011111011111110000110000",
"output": "1110011011000110011011111011100101011101001000000001110001010001010101000110110110101111010011001"
},
{
"input": "01111010010101100111110111111011011010100001011101010000111100101101101110111011001100101011100111\n00001100110110100001111011000010001001001100000010111101000001111011100000010111010010000011000010",
"output": "01110110100011000110001100111001010011101101011111101101111101010110001110101100011110101000100101"
},
{
"input": "111101011101111000001011001101111010110111001101110100100011111011011101001101010101011010111000110\n101111100101101101001100110011000001111010011101110111110110101110011011110011111100001001110101101",
"output": "010010111000010101000111111110111011001101010000000011010101010101000110111110101001010011001101011"
},
{
"input": "1010000011010110011101001101110001110010000111011101110010110110111111001001110100101100010101010001\n0111101000111100101100000101111010100100001000011101010100110011100011010011010101000100101011100011",
"output": "1101101011101010110001001000001011010110001111000000100110000101011100011010100001101000111110110010"
},
{
"input": "0000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000000001\n1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111010",
"output": "1111111010111111101011111110101111111010111111101011111110101111111010111111101011111110101111111011"
},
{
"input": "0\n0",
"output": "0"
},
{
"input": "0\n1",
"output": "1"
}
] | 1,636,233,052 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 30 | 4,198,400 | x1=int(input())
x2= int(input())
z= x1^x2
print(z) | Title: Ultra-Fast Mathematician
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Shapur was an extremely gifted student. He was great at everything including Combinatorics, Algebra, Number Theory, Geometry, Calculus, etc. He was not only smart but extraordinarily fast! He could manage to sum 1018 numbers in a single second.
One day in 230 AD Shapur was trying to find out if any one can possibly do calculations faster than him. As a result he made a very great contest and asked every one to come and take part.
In his contest he gave the contestants many different pairs of numbers. Each number is made from digits 0 or 1. The contestants should write a new number corresponding to the given pair of numbers. The rule is simple: The *i*-th digit of the answer is 1 if and only if the *i*-th digit of the two given numbers differ. In the other case the *i*-th digit of the answer is 0.
Shapur made many numbers and first tried his own speed. He saw that he can perform these operations on numbers of length ∞ (length of a number is number of digits in it) in a glance! He always gives correct answers so he expects the contestants to give correct answers, too. He is a good fellow so he won't give anyone very big numbers and he always gives one person numbers of same length.
Now you are going to take part in Shapur's contest. See if you are faster and more accurate.
Input Specification:
There are two lines in each input. Each of them contains a single number. It is guaranteed that the numbers are made from 0 and 1 only and that their length is same. The numbers may start with 0. The length of each number doesn't exceed 100.
Output Specification:
Write one line — the corresponding answer. Do not omit the leading 0s.
Demo Input:
['1010100\n0100101\n', '000\n111\n', '1110\n1010\n', '01110\n01100\n']
Demo Output:
['1110001\n', '111\n', '0100\n', '00010\n']
Note:
none | ```python
x1=int(input())
x2= int(input())
z= x1^x2
print(z)
``` | 0 |
21 | C | Stripe 2 | PROGRAMMING | 2,000 | [
"binary search",
"dp",
"sortings"
] | C. Stripe 2 | 1 | 64 | Once Bob took a paper stripe of n squares (the height of the stripe is 1 square). In each square he wrote an integer number, possibly negative. He became interested in how many ways exist to cut this stripe into three pieces so that the sum of numbers from each piece is equal to the sum of numbers from any other piece, and each piece contains positive integer amount of squares. Would you help Bob solve this problem? | The first input line contains integer *n* (1<=≤<=*n*<=≤<=105) — amount of squares in the stripe. The second line contains n space-separated numbers — they are the numbers written in the squares of the stripe. These numbers are integer and do not exceed 10000 in absolute value. | Output the amount of ways to cut the stripe into three non-empty pieces so that the sum of numbers from each piece is equal to the sum of numbers from any other piece. Don't forget that it's allowed to cut the stripe along the squares' borders only. | [
"4\n1 2 3 3\n",
"5\n1 2 3 4 5\n"
] | [
"1\n",
"0\n"
] | none | 1,500 | [
{
"input": "1\n-3",
"output": "0"
},
{
"input": "2\n0 0",
"output": "0"
},
{
"input": "3\n0 0 0",
"output": "1"
},
{
"input": "4\n-2 3 3 2",
"output": "0"
},
{
"input": "5\n-6 3 -1 2 -7",
"output": "0"
},
{
"input": "6\n2 3 -3 0 -3 1",
"output": "0"
},
{
"input": "7\n-1 1 -3 4 3 0 2",
"output": "0"
},
{
"input": "8\n2 0 0 2 -1 3 4 5",
"output": "0"
},
{
"input": "9\n-5 -2 1 1 5 0 -4 4 0",
"output": "3"
},
{
"input": "10\n-1 5 2 3 1 5 0 2 2 5",
"output": "0"
},
{
"input": "100\n3 0 -5 2 -3 -1 -1 0 -2 -5 -4 2 1 2 -2 -1 -1 -4 3 -1 -3 -1 5 0 -4 -4 -1 0 -2 -2 0 1 -1 -2 -1 -5 -4 -2 3 1 -3 0 -1 1 0 -1 2 0 -2 -1 -3 1 -2 2 3 2 -3 -5 2 2 -2 -2 1 2 -2 -1 3 0 -4 7 -2 2 1 4 -9 -1 -2 -1 0 -1 0 -2 -2 -1 1 1 -4 2 -3 -3 7 1 1 -3 -7 0 -2 0 5 -2",
"output": "5"
}
] | 1,511,114,135 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 12 | 1,000 | 6,041,600 |
k = int(input())
X = []
sum_array= []
b=0
for i in input().strip().split():
X.append(int(i))
b+= int(i)
sum_array.append(b)
if ((sum_array[-1] % 3 != 0) or (k < 3)):
print(0)
quit()
i=0
b=1
while b< (k-1):
b1= b+ 1
while b1< k:
if sum_array[b1-1]== (2*sum_array[b-1]):
if sum_array[-1]== (2* sum_array[b1-1]- sum_array[b-1]): i+= 1
b1+= 1
b+= 1
print(i) | Title: Stripe 2
Time Limit: 1 seconds
Memory Limit: 64 megabytes
Problem Description:
Once Bob took a paper stripe of n squares (the height of the stripe is 1 square). In each square he wrote an integer number, possibly negative. He became interested in how many ways exist to cut this stripe into three pieces so that the sum of numbers from each piece is equal to the sum of numbers from any other piece, and each piece contains positive integer amount of squares. Would you help Bob solve this problem?
Input Specification:
The first input line contains integer *n* (1<=≤<=*n*<=≤<=105) — amount of squares in the stripe. The second line contains n space-separated numbers — they are the numbers written in the squares of the stripe. These numbers are integer and do not exceed 10000 in absolute value.
Output Specification:
Output the amount of ways to cut the stripe into three non-empty pieces so that the sum of numbers from each piece is equal to the sum of numbers from any other piece. Don't forget that it's allowed to cut the stripe along the squares' borders only.
Demo Input:
['4\n1 2 3 3\n', '5\n1 2 3 4 5\n']
Demo Output:
['1\n', '0\n']
Note:
none | ```python
k = int(input())
X = []
sum_array= []
b=0
for i in input().strip().split():
X.append(int(i))
b+= int(i)
sum_array.append(b)
if ((sum_array[-1] % 3 != 0) or (k < 3)):
print(0)
quit()
i=0
b=1
while b< (k-1):
b1= b+ 1
while b1< k:
if sum_array[b1-1]== (2*sum_array[b-1]):
if sum_array[-1]== (2* sum_array[b1-1]- sum_array[b-1]): i+= 1
b1+= 1
b+= 1
print(i)
``` | 0 |
743 | B | Chloe and the sequence | PROGRAMMING | 1,200 | [
"binary search",
"bitmasks",
"constructive algorithms",
"implementation"
] | null | null | Chloe, the same as Vladik, is a competitive programmer. She didn't have any problems to get to the olympiad like Vladik, but she was confused by the task proposed on the olympiad.
Let's consider the following algorithm of generating a sequence of integers. Initially we have a sequence consisting of a single element equal to 1. Then we perform (*n*<=-<=1) steps. On each step we take the sequence we've got on the previous step, append it to the end of itself and insert in the middle the minimum positive integer we haven't used before. For example, we get the sequence [1,<=2,<=1] after the first step, the sequence [1,<=2,<=1,<=3,<=1,<=2,<=1] after the second step.
The task is to find the value of the element with index *k* (the elements are numbered from 1) in the obtained sequence, i. e. after (*n*<=-<=1) steps.
Please help Chloe to solve the problem! | The only line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=50, 1<=≤<=*k*<=≤<=2*n*<=-<=1). | Print single integer — the integer at the *k*-th position in the obtained sequence. | [
"3 2\n",
"4 8\n"
] | [
"2",
"4"
] | In the first sample the obtained sequence is [1, 2, 1, 3, 1, 2, 1]. The number on the second position is 2.
In the second sample the obtained sequence is [1, 2, 1, 3, 1, 2, 1, 4, 1, 2, 1, 3, 1, 2, 1]. The number on the eighth position is 4. | 1,000 | [
{
"input": "3 2",
"output": "2"
},
{
"input": "4 8",
"output": "4"
},
{
"input": "5 27",
"output": "1"
},
{
"input": "7 44",
"output": "3"
},
{
"input": "15 18432",
"output": "12"
},
{
"input": "20 259676",
"output": "3"
},
{
"input": "30 671088640",
"output": "28"
},
{
"input": "38 137438953472",
"output": "38"
},
{
"input": "1 1",
"output": "1"
},
{
"input": "3 3",
"output": "1"
},
{
"input": "4 12",
"output": "3"
},
{
"input": "8 224",
"output": "6"
},
{
"input": "13 1368",
"output": "4"
},
{
"input": "16 49152",
"output": "15"
},
{
"input": "19 1024",
"output": "11"
},
{
"input": "24 15204352",
"output": "20"
},
{
"input": "27 6586544",
"output": "5"
},
{
"input": "31 536870912",
"output": "30"
},
{
"input": "38 94489280512",
"output": "34"
},
{
"input": "42 215268308020",
"output": "3"
},
{
"input": "42 3452074721280",
"output": "21"
},
{
"input": "46 34394312982528",
"output": "15"
},
{
"input": "48 133865540681728",
"output": "39"
},
{
"input": "49 76541041985542",
"output": "2"
},
{
"input": "49 104822971826176",
"output": "34"
},
{
"input": "49 351843720888320",
"output": "47"
},
{
"input": "50 743042492421629",
"output": "1"
},
{
"input": "50 666266740436818",
"output": "2"
},
{
"input": "50 704239287953456",
"output": "5"
},
{
"input": "50 116938486513664",
"output": "17"
},
{
"input": "50 806423059496960",
"output": "37"
},
{
"input": "50 985162418487296",
"output": "48"
},
{
"input": "50 844424930131968",
"output": "49"
},
{
"input": "50 562949953421312",
"output": "50"
},
{
"input": "50 1",
"output": "1"
},
{
"input": "50 1125899906842623",
"output": "1"
},
{
"input": "50 1125899906842620",
"output": "3"
},
{
"input": "39 549755813887",
"output": "1"
},
{
"input": "50 100000000000",
"output": "12"
}
] | 1,597,575,893 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 93 | 204,800 | from math import ceil, floor
n,k = input().split()
n = int(n)
k = int(k)
side_part = []
middle_part = []
sequence = [1]
for i in range(0,n-1):
side_part = sequence
max_el = max(side_part)
middle_part.append(max_el + 1)
sequence = side_part + middle_part + side_part
middle_part.clear()
length = 1
for i in range(0,n-1):
length = length * 2 + 1
index_max_el = length/2
iterr = 0
while index_max_el > 1:
index_max_el = floor(index_max_el / 2)
iterr = iterr + 2
print(iterr) | Title: Chloe and the sequence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Chloe, the same as Vladik, is a competitive programmer. She didn't have any problems to get to the olympiad like Vladik, but she was confused by the task proposed on the olympiad.
Let's consider the following algorithm of generating a sequence of integers. Initially we have a sequence consisting of a single element equal to 1. Then we perform (*n*<=-<=1) steps. On each step we take the sequence we've got on the previous step, append it to the end of itself and insert in the middle the minimum positive integer we haven't used before. For example, we get the sequence [1,<=2,<=1] after the first step, the sequence [1,<=2,<=1,<=3,<=1,<=2,<=1] after the second step.
The task is to find the value of the element with index *k* (the elements are numbered from 1) in the obtained sequence, i. e. after (*n*<=-<=1) steps.
Please help Chloe to solve the problem!
Input Specification:
The only line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=50, 1<=≤<=*k*<=≤<=2*n*<=-<=1).
Output Specification:
Print single integer — the integer at the *k*-th position in the obtained sequence.
Demo Input:
['3 2\n', '4 8\n']
Demo Output:
['2', '4']
Note:
In the first sample the obtained sequence is [1, 2, 1, 3, 1, 2, 1]. The number on the second position is 2.
In the second sample the obtained sequence is [1, 2, 1, 3, 1, 2, 1, 4, 1, 2, 1, 3, 1, 2, 1]. The number on the eighth position is 4. | ```python
from math import ceil, floor
n,k = input().split()
n = int(n)
k = int(k)
side_part = []
middle_part = []
sequence = [1]
for i in range(0,n-1):
side_part = sequence
max_el = max(side_part)
middle_part.append(max_el + 1)
sequence = side_part + middle_part + side_part
middle_part.clear()
length = 1
for i in range(0,n-1):
length = length * 2 + 1
index_max_el = length/2
iterr = 0
while index_max_el > 1:
index_max_el = floor(index_max_el / 2)
iterr = iterr + 2
print(iterr)
``` | 0 |
|
385 | B | Bear and Strings | PROGRAMMING | 1,200 | [
"brute force",
"greedy",
"implementation",
"math",
"strings"
] | null | null | The bear has a string *s*<==<=*s*1*s*2... *s*|*s*| (record |*s*| is the string's length), consisting of lowercase English letters. The bear wants to count the number of such pairs of indices *i*,<=*j* (1<=≤<=*i*<=≤<=*j*<=≤<=|*s*|), that string *x*(*i*,<=*j*)<==<=*s**i**s**i*<=+<=1... *s**j* contains at least one string "bear" as a substring.
String *x*(*i*,<=*j*) contains string "bear", if there is such index *k* (*i*<=≤<=*k*<=≤<=*j*<=-<=3), that *s**k*<==<=*b*, *s**k*<=+<=1<==<=*e*, *s**k*<=+<=2<==<=*a*, *s**k*<=+<=3<==<=*r*.
Help the bear cope with the given problem. | The first line contains a non-empty string *s* (1<=≤<=|*s*|<=≤<=5000). It is guaranteed that the string only consists of lowercase English letters. | Print a single number — the answer to the problem. | [
"bearbtear\n",
"bearaabearc\n"
] | [
"6\n",
"20\n"
] | In the first sample, the following pairs (*i*, *j*) match: (1, 4), (1, 5), (1, 6), (1, 7), (1, 8), (1, 9).
In the second sample, the following pairs (*i*, *j*) match: (1, 4), (1, 5), (1, 6), (1, 7), (1, 8), (1, 9), (1, 10), (1, 11), (2, 10), (2, 11), (3, 10), (3, 11), (4, 10), (4, 11), (5, 10), (5, 11), (6, 10), (6, 11), (7, 10), (7, 11). | 1,000 | [
{
"input": "bearbtear",
"output": "6"
},
{
"input": "bearaabearc",
"output": "20"
},
{
"input": "pbearbearhbearzqbearjkterasjhy",
"output": "291"
},
{
"input": "pbearjbearbebearnbabcffbearbearwubearjezpiorrbearbearjbdlbearbearqbearjbearwipmsbearoaftrsebearzsnqb",
"output": "4419"
},
{
"input": "bear",
"output": "1"
},
{
"input": "a",
"output": "0"
},
{
"input": "be",
"output": "0"
}
] | 1,683,255,319 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 43 | 62 | 1,843,200 | import sys
import math
def main():
read = sys.stdin.readline
word: str = read().strip()
prev = None
total = 0
for i, c in enumerate(word):
if i + 3 >= len(word):
break
if word[i] == 'b' and word[i + 1] == 'e' and word[i + 2] == 'a' and word[i + 3] == 'r':
prev_val = (prev if prev else 0) + 1
# Count all string starting from the left
l = i + 1
r = i + 3 + 1
left = l - 1 - (prev_val) + 1
right = len(word) - (r + 1) + 1
if l == 1:
total += 1 + right
elif r == len(word):
total += 1 + left
else:
total += left * (right + 1)
total += 1 + right
prev = l
print(total)
if __name__ == '__main__':
main()
| Title: Bear and Strings
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The bear has a string *s*<==<=*s*1*s*2... *s*|*s*| (record |*s*| is the string's length), consisting of lowercase English letters. The bear wants to count the number of such pairs of indices *i*,<=*j* (1<=≤<=*i*<=≤<=*j*<=≤<=|*s*|), that string *x*(*i*,<=*j*)<==<=*s**i**s**i*<=+<=1... *s**j* contains at least one string "bear" as a substring.
String *x*(*i*,<=*j*) contains string "bear", if there is such index *k* (*i*<=≤<=*k*<=≤<=*j*<=-<=3), that *s**k*<==<=*b*, *s**k*<=+<=1<==<=*e*, *s**k*<=+<=2<==<=*a*, *s**k*<=+<=3<==<=*r*.
Help the bear cope with the given problem.
Input Specification:
The first line contains a non-empty string *s* (1<=≤<=|*s*|<=≤<=5000). It is guaranteed that the string only consists of lowercase English letters.
Output Specification:
Print a single number — the answer to the problem.
Demo Input:
['bearbtear\n', 'bearaabearc\n']
Demo Output:
['6\n', '20\n']
Note:
In the first sample, the following pairs (*i*, *j*) match: (1, 4), (1, 5), (1, 6), (1, 7), (1, 8), (1, 9).
In the second sample, the following pairs (*i*, *j*) match: (1, 4), (1, 5), (1, 6), (1, 7), (1, 8), (1, 9), (1, 10), (1, 11), (2, 10), (2, 11), (3, 10), (3, 11), (4, 10), (4, 11), (5, 10), (5, 11), (6, 10), (6, 11), (7, 10), (7, 11). | ```python
import sys
import math
def main():
read = sys.stdin.readline
word: str = read().strip()
prev = None
total = 0
for i, c in enumerate(word):
if i + 3 >= len(word):
break
if word[i] == 'b' and word[i + 1] == 'e' and word[i + 2] == 'a' and word[i + 3] == 'r':
prev_val = (prev if prev else 0) + 1
# Count all string starting from the left
l = i + 1
r = i + 3 + 1
left = l - 1 - (prev_val) + 1
right = len(word) - (r + 1) + 1
if l == 1:
total += 1 + right
elif r == len(word):
total += 1 + left
else:
total += left * (right + 1)
total += 1 + right
prev = l
print(total)
if __name__ == '__main__':
main()
``` | 3 |
|
792 | B | Counting-out Rhyme | PROGRAMMING | 1,300 | [
"implementation"
] | null | null | *n* children are standing in a circle and playing the counting-out game. Children are numbered clockwise from 1 to *n*. In the beginning, the first child is considered the leader. The game is played in *k* steps. In the *i*-th step the leader counts out *a**i* people in clockwise order, starting from the next person. The last one to be pointed at by the leader is eliminated, and the next player after him becomes the new leader.
For example, if there are children with numbers [8,<=10,<=13,<=14,<=16] currently in the circle, the leader is child 13 and *a**i*<==<=12, then counting-out rhyme ends on child 16, who is eliminated. Child 8 becomes the leader.
You have to write a program which prints the number of the child to be eliminated on every step. | The first line contains two integer numbers *n* and *k* (2<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=*n*<=-<=1).
The next line contains *k* integer numbers *a*1,<=*a*2,<=...,<=*a**k* (1<=≤<=*a**i*<=≤<=109). | Print *k* numbers, the *i*-th one corresponds to the number of child to be eliminated at the *i*-th step. | [
"7 5\n10 4 11 4 1\n",
"3 2\n2 5\n"
] | [
"4 2 5 6 1 \n",
"3 2 \n"
] | Let's consider first example:
- In the first step child 4 is eliminated, child 5 becomes the leader. - In the second step child 2 is eliminated, child 3 becomes the leader. - In the third step child 5 is eliminated, child 6 becomes the leader. - In the fourth step child 6 is eliminated, child 7 becomes the leader. - In the final step child 1 is eliminated, child 3 becomes the leader. | 0 | [
{
"input": "7 5\n10 4 11 4 1",
"output": "4 2 5 6 1 "
},
{
"input": "3 2\n2 5",
"output": "3 2 "
},
{
"input": "2 1\n1",
"output": "2 "
},
{
"input": "2 1\n2",
"output": "1 "
},
{
"input": "2 1\n3",
"output": "2 "
},
{
"input": "10 7\n5 10 4 3 8 10 6",
"output": "6 8 3 9 2 4 10 "
},
{
"input": "10 8\n12 6 12 15 20 8 17 12",
"output": "3 10 6 8 2 9 4 5 "
},
{
"input": "12 10\n76 58 82 54 97 46 17 40 36 15",
"output": "5 9 12 1 3 10 8 11 2 4 "
},
{
"input": "12 6\n76 61 94 15 66 26",
"output": "5 12 6 2 7 3 "
},
{
"input": "90 10\n1045 8705 6077 3282 1459 9809 383 6206 2674 7274",
"output": "56 39 45 20 17 55 14 85 51 33 "
},
{
"input": "100 30\n601771 913885 829106 91674 465657 367068 142461 873149 294276 916519 720701 370006 551782 321506 68525 570684 81178 724855 564907 661130 10112 983124 799801 100639 766045 862312 513021 232094 979480 408554",
"output": "72 89 16 26 85 73 29 99 63 30 8 46 70 19 100 93 36 54 65 77 17 79 62 64 21 69 42 82 68 1 "
},
{
"input": "3 2\n20148340 81473314",
"output": "2 3 "
},
{
"input": "3 2\n301633543 643389490",
"output": "2 3 "
},
{
"input": "6 5\n532623340 628883728 583960589 690950241 488468353",
"output": "5 3 6 1 4 "
},
{
"input": "6 2\n458995521 294343587",
"output": "4 1 "
},
{
"input": "68 1\n5",
"output": "6 "
}
] | 1,490,627,610 | 2,310 | Python 3 | WRONG_ANSWER | TESTS | 0 | 46 | 5,017,600 | from collections import deque
n,k=map(int,input().split())
a=[int(i) for i in input().split()]
d=deque([i for i in range(1,n+1)])
res=[]
for i in range(k):
d.rotate(-(a[i]))
x=d.popleft()
res.append(x)
print(res)
| Title: Counting-out Rhyme
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
*n* children are standing in a circle and playing the counting-out game. Children are numbered clockwise from 1 to *n*. In the beginning, the first child is considered the leader. The game is played in *k* steps. In the *i*-th step the leader counts out *a**i* people in clockwise order, starting from the next person. The last one to be pointed at by the leader is eliminated, and the next player after him becomes the new leader.
For example, if there are children with numbers [8,<=10,<=13,<=14,<=16] currently in the circle, the leader is child 13 and *a**i*<==<=12, then counting-out rhyme ends on child 16, who is eliminated. Child 8 becomes the leader.
You have to write a program which prints the number of the child to be eliminated on every step.
Input Specification:
The first line contains two integer numbers *n* and *k* (2<=≤<=*n*<=≤<=100, 1<=≤<=*k*<=≤<=*n*<=-<=1).
The next line contains *k* integer numbers *a*1,<=*a*2,<=...,<=*a**k* (1<=≤<=*a**i*<=≤<=109).
Output Specification:
Print *k* numbers, the *i*-th one corresponds to the number of child to be eliminated at the *i*-th step.
Demo Input:
['7 5\n10 4 11 4 1\n', '3 2\n2 5\n']
Demo Output:
['4 2 5 6 1 \n', '3 2 \n']
Note:
Let's consider first example:
- In the first step child 4 is eliminated, child 5 becomes the leader. - In the second step child 2 is eliminated, child 3 becomes the leader. - In the third step child 5 is eliminated, child 6 becomes the leader. - In the fourth step child 6 is eliminated, child 7 becomes the leader. - In the final step child 1 is eliminated, child 3 becomes the leader. | ```python
from collections import deque
n,k=map(int,input().split())
a=[int(i) for i in input().split()]
d=deque([i for i in range(1,n+1)])
res=[]
for i in range(k):
d.rotate(-(a[i]))
x=d.popleft()
res.append(x)
print(res)
``` | 0 |
|
160 | A | Twins | PROGRAMMING | 900 | [
"greedy",
"sortings"
] | null | null | Imagine that you have a twin brother or sister. Having another person that looks exactly like you seems very unusual. It's hard to say if having something of an alter ego is good or bad. And if you do have a twin, then you very well know what it's like.
Now let's imagine a typical morning in your family. You haven't woken up yet, and Mom is already going to work. She has been so hasty that she has nearly forgotten to leave the two of her darling children some money to buy lunches in the school cafeteria. She fished in the purse and found some number of coins, or to be exact, *n* coins of arbitrary values *a*1,<=*a*2,<=...,<=*a**n*. But as Mom was running out of time, she didn't split the coins for you two. So she scribbled a note asking you to split the money equally.
As you woke up, you found Mom's coins and read her note. "But why split the money equally?" — you thought. After all, your twin is sleeping and he won't know anything. So you decided to act like that: pick for yourself some subset of coins so that the sum of values of your coins is strictly larger than the sum of values of the remaining coins that your twin will have. However, you correctly thought that if you take too many coins, the twin will suspect the deception. So, you've decided to stick to the following strategy to avoid suspicions: you take the minimum number of coins, whose sum of values is strictly more than the sum of values of the remaining coins. On this basis, determine what minimum number of coins you need to take to divide them in the described manner. | The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of coins. The second line contains a sequence of *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=100) — the coins' values. All numbers are separated with spaces. | In the single line print the single number — the minimum needed number of coins. | [
"2\n3 3\n",
"3\n2 1 2\n"
] | [
"2\n",
"2\n"
] | In the first sample you will have to take 2 coins (you and your twin have sums equal to 6, 0 correspondingly). If you take 1 coin, you get sums 3, 3. If you take 0 coins, you get sums 0, 6. Those variants do not satisfy you as your sum should be strictly more that your twins' sum.
In the second sample one coin isn't enough for us, too. You can pick coins with values 1, 2 or 2, 2. In any case, the minimum number of coins equals 2. | 500 | [
{
"input": "2\n3 3",
"output": "2"
},
{
"input": "3\n2 1 2",
"output": "2"
},
{
"input": "1\n5",
"output": "1"
},
{
"input": "5\n4 2 2 2 2",
"output": "3"
},
{
"input": "7\n1 10 1 2 1 1 1",
"output": "1"
},
{
"input": "5\n3 2 3 3 1",
"output": "3"
},
{
"input": "2\n2 1",
"output": "1"
},
{
"input": "3\n2 1 3",
"output": "2"
},
{
"input": "6\n1 1 1 1 1 1",
"output": "4"
},
{
"input": "7\n10 10 5 5 5 5 1",
"output": "3"
},
{
"input": "20\n2 1 2 2 2 1 1 2 1 2 2 1 1 1 1 2 1 1 1 1",
"output": "8"
},
{
"input": "20\n4 2 4 4 3 4 2 2 4 2 3 1 1 2 2 3 3 3 1 4",
"output": "8"
},
{
"input": "20\n35 26 41 40 45 46 22 26 39 23 11 15 47 42 18 15 27 10 45 40",
"output": "8"
},
{
"input": "20\n7 84 100 10 31 35 41 2 63 44 57 4 63 11 23 49 98 71 16 90",
"output": "6"
},
{
"input": "50\n19 2 12 26 17 27 10 26 17 17 5 24 11 15 3 9 16 18 19 1 25 23 18 6 2 7 25 7 21 25 13 29 16 9 25 3 14 30 18 4 10 28 6 10 8 2 2 4 8 28",
"output": "14"
},
{
"input": "70\n2 18 18 47 25 5 14 9 19 46 36 49 33 32 38 23 32 39 8 29 31 17 24 21 10 15 33 37 46 21 22 11 20 35 39 13 11 30 28 40 39 47 1 17 24 24 21 46 12 2 20 43 8 16 44 11 45 10 13 44 31 45 45 46 11 10 33 35 23 42",
"output": "22"
},
{
"input": "100\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "51"
},
{
"input": "100\n1 2 2 1 2 1 1 2 1 1 1 2 2 1 1 1 2 2 2 1 2 1 1 1 1 1 2 1 2 1 2 1 2 1 2 1 1 1 2 1 1 1 1 1 2 2 1 2 1 2 1 2 2 2 1 2 1 2 2 1 1 2 2 1 1 2 2 2 1 1 2 1 1 2 2 1 2 1 1 2 2 1 2 1 1 2 2 1 1 1 1 2 1 1 1 1 2 2 2 2",
"output": "37"
},
{
"input": "100\n1 2 3 2 1 2 2 3 1 3 3 2 2 1 1 2 2 1 1 1 1 2 3 3 2 1 1 2 2 2 3 3 3 2 1 3 1 3 3 2 3 1 2 2 2 3 2 1 1 3 3 3 3 2 1 1 2 3 2 2 3 2 3 2 2 3 2 2 2 2 3 3 3 1 3 3 1 1 2 3 2 2 2 2 3 3 3 2 1 2 3 1 1 2 3 3 1 3 3 2",
"output": "36"
},
{
"input": "100\n5 5 4 3 5 1 2 5 1 1 3 5 4 4 1 1 1 1 5 4 4 5 1 5 5 1 2 1 3 1 5 1 3 3 3 2 2 2 1 1 5 1 3 4 1 1 3 2 5 2 2 5 5 4 4 1 3 4 3 3 4 5 3 3 3 1 2 1 4 2 4 4 1 5 1 3 5 5 5 5 3 4 4 3 1 2 5 2 3 5 4 2 4 5 3 2 4 2 4 3",
"output": "33"
},
{
"input": "100\n3 4 8 10 8 6 4 3 7 7 6 2 3 1 3 10 1 7 9 3 5 5 2 6 2 9 1 7 4 2 4 1 6 1 7 10 2 5 3 7 6 4 6 2 8 8 8 6 6 10 3 7 4 3 4 1 7 9 3 6 3 6 1 4 9 3 8 1 10 1 4 10 7 7 9 5 3 8 10 2 1 10 8 7 10 8 5 3 1 2 1 10 6 1 5 3 3 5 7 2",
"output": "30"
},
{
"input": "100\n16 9 11 8 11 4 9 17 4 8 4 10 9 10 6 3 3 15 1 6 1 15 12 18 6 14 13 18 1 7 18 4 10 7 10 12 3 16 14 4 10 8 10 7 19 13 15 1 4 8 16 10 6 4 3 16 11 10 7 3 4 16 1 20 1 11 4 16 10 7 7 12 18 19 3 17 19 3 4 19 2 12 11 3 18 20 2 2 14 4 20 13 13 11 16 20 19 14 7 2",
"output": "29"
},
{
"input": "100\n2 46 4 6 38 19 15 34 10 35 37 30 3 25 5 45 40 45 33 31 6 20 10 44 11 9 2 14 35 5 9 23 20 2 48 22 25 35 38 31 24 33 35 16 4 30 27 10 12 22 6 24 12 30 23 21 14 12 32 21 7 12 25 43 18 34 34 28 47 13 28 43 18 39 44 42 35 26 35 14 8 29 32 20 29 3 20 6 20 9 9 27 8 42 10 37 42 27 8 1",
"output": "30"
},
{
"input": "100\n85 50 17 89 65 89 5 20 86 26 16 21 85 14 44 31 87 31 6 2 48 67 8 80 79 1 48 36 97 1 5 30 79 50 78 12 2 55 76 100 54 40 26 81 97 96 68 56 87 14 51 17 54 37 52 33 69 62 38 63 74 15 62 78 9 19 67 2 60 58 93 60 18 96 55 48 34 7 79 82 32 58 90 67 20 50 27 15 7 89 98 10 11 15 99 49 4 51 77 52",
"output": "29"
},
{
"input": "100\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100",
"output": "30"
},
{
"input": "1\n1",
"output": "1"
},
{
"input": "4\n4 1 2 3",
"output": "2"
},
{
"input": "5\n2 2 2 4 4",
"output": "2"
},
{
"input": "4\n100 99 99 100",
"output": "2"
}
] | 1,692,855,937 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 30 | 0 | n = int(input())
coins = list(map(int, input().split()))
coins.sort()
total_sum = sum(coins)
your_sum = 0
twin_sum = 0
for coin in coins:
if your_sum < total_sum / 2:
your_sum += coin
twin_sum = total_sum - your_sum
else:
break
print(your_sum)
| Title: Twins
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Imagine that you have a twin brother or sister. Having another person that looks exactly like you seems very unusual. It's hard to say if having something of an alter ego is good or bad. And if you do have a twin, then you very well know what it's like.
Now let's imagine a typical morning in your family. You haven't woken up yet, and Mom is already going to work. She has been so hasty that she has nearly forgotten to leave the two of her darling children some money to buy lunches in the school cafeteria. She fished in the purse and found some number of coins, or to be exact, *n* coins of arbitrary values *a*1,<=*a*2,<=...,<=*a**n*. But as Mom was running out of time, she didn't split the coins for you two. So she scribbled a note asking you to split the money equally.
As you woke up, you found Mom's coins and read her note. "But why split the money equally?" — you thought. After all, your twin is sleeping and he won't know anything. So you decided to act like that: pick for yourself some subset of coins so that the sum of values of your coins is strictly larger than the sum of values of the remaining coins that your twin will have. However, you correctly thought that if you take too many coins, the twin will suspect the deception. So, you've decided to stick to the following strategy to avoid suspicions: you take the minimum number of coins, whose sum of values is strictly more than the sum of values of the remaining coins. On this basis, determine what minimum number of coins you need to take to divide them in the described manner.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=100) — the number of coins. The second line contains a sequence of *n* integers *a*1, *a*2, ..., *a**n* (1<=≤<=*a**i*<=≤<=100) — the coins' values. All numbers are separated with spaces.
Output Specification:
In the single line print the single number — the minimum needed number of coins.
Demo Input:
['2\n3 3\n', '3\n2 1 2\n']
Demo Output:
['2\n', '2\n']
Note:
In the first sample you will have to take 2 coins (you and your twin have sums equal to 6, 0 correspondingly). If you take 1 coin, you get sums 3, 3. If you take 0 coins, you get sums 0, 6. Those variants do not satisfy you as your sum should be strictly more that your twins' sum.
In the second sample one coin isn't enough for us, too. You can pick coins with values 1, 2 or 2, 2. In any case, the minimum number of coins equals 2. | ```python
n = int(input())
coins = list(map(int, input().split()))
coins.sort()
total_sum = sum(coins)
your_sum = 0
twin_sum = 0
for coin in coins:
if your_sum < total_sum / 2:
your_sum += coin
twin_sum = total_sum - your_sum
else:
break
print(your_sum)
``` | 0 |
|
705 | A | Hulk | PROGRAMMING | 800 | [
"implementation"
] | null | null | Dr. Bruce Banner hates his enemies (like others don't). As we all know, he can barely talk when he turns into the incredible Hulk. That's why he asked you to help him to express his feelings.
Hulk likes the Inception so much, and like that his feelings are complicated. They have *n* layers. The first layer is hate, second one is love, third one is hate and so on...
For example if *n*<==<=1, then his feeling is "I hate it" or if *n*<==<=2 it's "I hate that I love it", and if *n*<==<=3 it's "I hate that I love that I hate it" and so on.
Please help Dr. Banner. | The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of layers of love and hate. | Print Dr.Banner's feeling in one line. | [
"1\n",
"2\n",
"3\n"
] | [
"I hate it\n",
"I hate that I love it\n",
"I hate that I love that I hate it\n"
] | none | 500 | [
{
"input": "1",
"output": "I hate it"
},
{
"input": "2",
"output": "I hate that I love it"
},
{
"input": "3",
"output": "I hate that I love that I hate it"
},
{
"input": "4",
"output": "I hate that I love that I hate that I love it"
},
{
"input": "5",
"output": "I hate that I love that I hate that I love that I hate it"
},
{
"input": "10",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it"
},
{
"input": "18",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it"
},
{
"input": "19",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate it"
},
{
"input": "76",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "77",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "81",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "82",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "85",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "86",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "100",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "99",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "98",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "33",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate it"
},
{
"input": "34",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love it"
},
{
"input": "57",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
},
{
"input": "100",
"output": "I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate that I love that I hate ..."
}
] | 1,699,810,576 | 2,147,483,647 | Python 3 | OK | TESTS | 21 | 46 | 0 | import sys
def inp():
return int(input())
def inlt():
return list(map(int, input().split()))
def insr():
return input().strip()
def out(x):
sys.stdout.write(str(x) + "\n")
def main():
count = inp()
ans = ""
feelings = [" I love", " I hate"]
for i in range(1, count + 1):
ans += feelings[i%2]
if i < count:
ans += " that"
ans += " it"
out(ans)
if __name__ == "__main__":
main()
| Title: Hulk
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Dr. Bruce Banner hates his enemies (like others don't). As we all know, he can barely talk when he turns into the incredible Hulk. That's why he asked you to help him to express his feelings.
Hulk likes the Inception so much, and like that his feelings are complicated. They have *n* layers. The first layer is hate, second one is love, third one is hate and so on...
For example if *n*<==<=1, then his feeling is "I hate it" or if *n*<==<=2 it's "I hate that I love it", and if *n*<==<=3 it's "I hate that I love that I hate it" and so on.
Please help Dr. Banner.
Input Specification:
The only line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100) — the number of layers of love and hate.
Output Specification:
Print Dr.Banner's feeling in one line.
Demo Input:
['1\n', '2\n', '3\n']
Demo Output:
['I hate it\n', 'I hate that I love it\n', 'I hate that I love that I hate it\n']
Note:
none | ```python
import sys
def inp():
return int(input())
def inlt():
return list(map(int, input().split()))
def insr():
return input().strip()
def out(x):
sys.stdout.write(str(x) + "\n")
def main():
count = inp()
ans = ""
feelings = [" I love", " I hate"]
for i in range(1, count + 1):
ans += feelings[i%2]
if i < count:
ans += " that"
ans += " it"
out(ans)
if __name__ == "__main__":
main()
``` | 3 |
|
270 | A | Fancy Fence | PROGRAMMING | 1,100 | [
"geometry",
"implementation",
"math"
] | null | null | Emuskald needs a fence around his farm, but he is too lazy to build it himself. So he purchased a fence-building robot.
He wants the fence to be a regular polygon. The robot builds the fence along a single path, but it can only make fence corners at a single angle *a*.
Will the robot be able to build the fence Emuskald wants? In other words, is there a regular polygon which angles are equal to *a*? | The first line of input contains an integer *t* (0<=<<=*t*<=<<=180) — the number of tests. Each of the following *t* lines contains a single integer *a* (0<=<<=*a*<=<<=180) — the angle the robot can make corners at measured in degrees. | For each test, output on a single line "YES" (without quotes), if the robot can build a fence Emuskald wants, and "NO" (without quotes), if it is impossible. | [
"3\n30\n60\n90\n"
] | [
"NO\nYES\nYES\n"
] | In the first test case, it is impossible to build the fence, since there is no regular polygon with angle <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/df5f4b07dd5316fde165b43657b2696e2919e791.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second test case, the fence is a regular triangle, and in the last test case — a square. | 500 | [
{
"input": "3\n30\n60\n90",
"output": "NO\nYES\nYES"
},
{
"input": "6\n1\n2\n3\n170\n179\n25",
"output": "NO\nNO\nNO\nYES\nYES\nNO"
}
] | 1,651,074,931 | 2,147,483,647 | Python 3 | OK | TESTS | 3 | 62 | 0 | def fence():
a = int(input())
n = 360 / (180 - a)
if n == int(n):
return "YES"
return "NO"
t = int(input())
for _ in range(t):
print(fence()) | Title: Fancy Fence
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Emuskald needs a fence around his farm, but he is too lazy to build it himself. So he purchased a fence-building robot.
He wants the fence to be a regular polygon. The robot builds the fence along a single path, but it can only make fence corners at a single angle *a*.
Will the robot be able to build the fence Emuskald wants? In other words, is there a regular polygon which angles are equal to *a*?
Input Specification:
The first line of input contains an integer *t* (0<=<<=*t*<=<<=180) — the number of tests. Each of the following *t* lines contains a single integer *a* (0<=<<=*a*<=<<=180) — the angle the robot can make corners at measured in degrees.
Output Specification:
For each test, output on a single line "YES" (without quotes), if the robot can build a fence Emuskald wants, and "NO" (without quotes), if it is impossible.
Demo Input:
['3\n30\n60\n90\n']
Demo Output:
['NO\nYES\nYES\n']
Note:
In the first test case, it is impossible to build the fence, since there is no regular polygon with angle <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/df5f4b07dd5316fde165b43657b2696e2919e791.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the second test case, the fence is a regular triangle, and in the last test case — a square. | ```python
def fence():
a = int(input())
n = 360 / (180 - a)
if n == int(n):
return "YES"
return "NO"
t = int(input())
for _ in range(t):
print(fence())
``` | 3 |
|
492 | B | Vanya and Lanterns | PROGRAMMING | 1,200 | [
"binary search",
"implementation",
"math",
"sortings"
] | null | null | Vanya walks late at night along a straight street of length *l*, lit by *n* lanterns. Consider the coordinate system with the beginning of the street corresponding to the point 0, and its end corresponding to the point *l*. Then the *i*-th lantern is at the point *a**i*. The lantern lights all points of the street that are at the distance of at most *d* from it, where *d* is some positive number, common for all lanterns.
Vanya wonders: what is the minimum light radius *d* should the lanterns have to light the whole street? | The first line contains two integers *n*, *l* (1<=≤<=*n*<=≤<=1000, 1<=≤<=*l*<=≤<=109) — the number of lanterns and the length of the street respectively.
The next line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=*l*). Multiple lanterns can be located at the same point. The lanterns may be located at the ends of the street. | Print the minimum light radius *d*, needed to light the whole street. The answer will be considered correct if its absolute or relative error doesn't exceed 10<=-<=9. | [
"7 15\n15 5 3 7 9 14 0\n",
"2 5\n2 5\n"
] | [
"2.5000000000\n",
"2.0000000000\n"
] | Consider the second sample. At *d* = 2 the first lantern will light the segment [0, 4] of the street, and the second lantern will light segment [3, 5]. Thus, the whole street will be lit. | 1,000 | [
{
"input": "7 15\n15 5 3 7 9 14 0",
"output": "2.5000000000"
},
{
"input": "2 5\n2 5",
"output": "2.0000000000"
},
{
"input": "46 615683844\n431749087 271781274 274974690 324606253 480870261 401650581 13285442 478090364 266585394 425024433 588791449 492057200 391293435 563090494 317950 173675329 473068378 356306865 311731938 192959832 321180686 141984626 578985584 512026637 175885185 590844074 47103801 212211134 330150 509886963 565955809 315640375 612907074 500474373 524310737 568681652 315339618 478782781 518873818 271322031 74600969 539099112 85129347 222068995 106014720 77282307",
"output": "22258199.5000000000"
},
{
"input": "2 1000000000\n0 1000000000",
"output": "500000000.0000000000"
},
{
"input": "2 555\n200 300",
"output": "255.0000000000"
},
{
"input": "1 1\n1",
"output": "1.0000000000"
},
{
"input": "1 1\n0",
"output": "1.0000000000"
},
{
"input": "1 1000000000\n0",
"output": "1000000000.0000000000"
},
{
"input": "1 1000000000\n1000000000",
"output": "1000000000.0000000000"
},
{
"input": "1 999999999\n499999999",
"output": "500000000.0000000000"
},
{
"input": "4 700\n0 250 475 700",
"output": "125.0000000000"
},
{
"input": "4 700\n0 225 450 700",
"output": "125.0000000000"
},
{
"input": "5 1000\n0 250 500 750 1000",
"output": "125.0000000000"
},
{
"input": "5 2000\n1001 1001 1001 1001 1001",
"output": "1001.0000000000"
},
{
"input": "1 999\n501",
"output": "501.0000000000"
},
{
"input": "2 1000\n400 600",
"output": "400.0000000000"
},
{
"input": "4 15\n1 3 9 11",
"output": "4.0000000000"
},
{
"input": "1 5\n2",
"output": "3.0000000000"
}
] | 1,684,147,191 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 1 | 31 | 0 | R=lambda:map(int,input().split())
n,l=R()
ll=sorted(list(R()))
ll.append(l)
lll=[]
for i in range(0,n):
lll.append(ll[i+1]-ll[i])
print(max(lll)/2) | Title: Vanya and Lanterns
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vanya walks late at night along a straight street of length *l*, lit by *n* lanterns. Consider the coordinate system with the beginning of the street corresponding to the point 0, and its end corresponding to the point *l*. Then the *i*-th lantern is at the point *a**i*. The lantern lights all points of the street that are at the distance of at most *d* from it, where *d* is some positive number, common for all lanterns.
Vanya wonders: what is the minimum light radius *d* should the lanterns have to light the whole street?
Input Specification:
The first line contains two integers *n*, *l* (1<=≤<=*n*<=≤<=1000, 1<=≤<=*l*<=≤<=109) — the number of lanterns and the length of the street respectively.
The next line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=*l*). Multiple lanterns can be located at the same point. The lanterns may be located at the ends of the street.
Output Specification:
Print the minimum light radius *d*, needed to light the whole street. The answer will be considered correct if its absolute or relative error doesn't exceed 10<=-<=9.
Demo Input:
['7 15\n15 5 3 7 9 14 0\n', '2 5\n2 5\n']
Demo Output:
['2.5000000000\n', '2.0000000000\n']
Note:
Consider the second sample. At *d* = 2 the first lantern will light the segment [0, 4] of the street, and the second lantern will light segment [3, 5]. Thus, the whole street will be lit. | ```python
R=lambda:map(int,input().split())
n,l=R()
ll=sorted(list(R()))
ll.append(l)
lll=[]
for i in range(0,n):
lll.append(ll[i+1]-ll[i])
print(max(lll)/2)
``` | 0 |
|
460 | A | Vasya and Socks | PROGRAMMING | 900 | [
"brute force",
"implementation",
"math"
] | null | null | Vasya has *n* pairs of socks. In the morning of each day Vasya has to put on a pair of socks before he goes to school. When he comes home in the evening, Vasya takes off the used socks and throws them away. Every *m*-th day (at days with numbers *m*,<=2*m*,<=3*m*,<=...) mom buys a pair of socks to Vasya. She does it late in the evening, so that Vasya cannot put on a new pair of socks before the next day. How many consecutive days pass until Vasya runs out of socks? | The single line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100; 2<=≤<=*m*<=≤<=100), separated by a space. | Print a single integer — the answer to the problem. | [
"2 2\n",
"9 3\n"
] | [
"3\n",
"13\n"
] | In the first sample Vasya spends the first two days wearing the socks that he had initially. Then on day three he puts on the socks that were bought on day two.
In the second sample Vasya spends the first nine days wearing the socks that he had initially. Then he spends three days wearing the socks that were bought on the third, sixth and ninth days. Than he spends another day wearing the socks that were bought on the twelfth day. | 500 | [
{
"input": "2 2",
"output": "3"
},
{
"input": "9 3",
"output": "13"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "2 3",
"output": "2"
},
{
"input": "1 99",
"output": "1"
},
{
"input": "4 4",
"output": "5"
},
{
"input": "10 2",
"output": "19"
},
{
"input": "10 9",
"output": "11"
},
{
"input": "100 100",
"output": "101"
},
{
"input": "2 27",
"output": "2"
},
{
"input": "99 100",
"output": "99"
},
{
"input": "99 2",
"output": "197"
},
{
"input": "100 3",
"output": "149"
},
{
"input": "98 3",
"output": "146"
},
{
"input": "4 4",
"output": "5"
},
{
"input": "100 2",
"output": "199"
},
{
"input": "62 4",
"output": "82"
},
{
"input": "99 10",
"output": "109"
},
{
"input": "100 5",
"output": "124"
},
{
"input": "80 80",
"output": "81"
},
{
"input": "95 16",
"output": "101"
},
{
"input": "75 16",
"output": "79"
},
{
"input": "99 74",
"output": "100"
},
{
"input": "20 21",
"output": "20"
},
{
"input": "52 96",
"output": "52"
},
{
"input": "24 5",
"output": "29"
}
] | 1,671,086,870 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 11 | 62 | 0 | def solve():
n,m = list(map(int,input().split()))
ans = n
curr = 0
while n:
ans += n//m
n //= m
curr += n % m
return ans + curr//m
print(solve()) | Title: Vasya and Socks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has *n* pairs of socks. In the morning of each day Vasya has to put on a pair of socks before he goes to school. When he comes home in the evening, Vasya takes off the used socks and throws them away. Every *m*-th day (at days with numbers *m*,<=2*m*,<=3*m*,<=...) mom buys a pair of socks to Vasya. She does it late in the evening, so that Vasya cannot put on a new pair of socks before the next day. How many consecutive days pass until Vasya runs out of socks?
Input Specification:
The single line contains two integers *n* and *m* (1<=≤<=*n*<=≤<=100; 2<=≤<=*m*<=≤<=100), separated by a space.
Output Specification:
Print a single integer — the answer to the problem.
Demo Input:
['2 2\n', '9 3\n']
Demo Output:
['3\n', '13\n']
Note:
In the first sample Vasya spends the first two days wearing the socks that he had initially. Then on day three he puts on the socks that were bought on day two.
In the second sample Vasya spends the first nine days wearing the socks that he had initially. Then he spends three days wearing the socks that were bought on the third, sixth and ninth days. Than he spends another day wearing the socks that were bought on the twelfth day. | ```python
def solve():
n,m = list(map(int,input().split()))
ans = n
curr = 0
while n:
ans += n//m
n //= m
curr += n % m
return ans + curr//m
print(solve())
``` | 0 |
|
349 | A | Cinema Line | PROGRAMMING | 1,100 | [
"greedy",
"implementation"
] | null | null | The new "Die Hard" movie has just been released! There are *n* people at the cinema box office standing in a huge line. Each of them has a single 100, 50 or 25 ruble bill. A "Die Hard" ticket costs 25 rubles. Can the booking clerk sell a ticket to each person and give the change if he initially has no money and sells the tickets strictly in the order people follow in the line? | The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of people in the line. The next line contains *n* integers, each of them equals 25, 50 or 100 — the values of the bills the people have. The numbers are given in the order from the beginning of the line (at the box office) to the end of the line. | Print "YES" (without the quotes) if the booking clerk can sell a ticket to each person and give the change. Otherwise print "NO". | [
"4\n25 25 50 50\n",
"2\n25 100\n",
"4\n50 50 25 25\n"
] | [
"YES\n",
"NO\n",
"NO\n"
] | none | 500 | [
{
"input": "4\n25 25 50 50",
"output": "YES"
},
{
"input": "2\n25 100",
"output": "NO"
},
{
"input": "4\n50 50 25 25",
"output": "NO"
},
{
"input": "3\n25 50 100",
"output": "NO"
},
{
"input": "10\n25 25 25 25 25 25 25 25 25 25",
"output": "YES"
},
{
"input": "10\n50 50 50 50 50 50 50 50 50 50",
"output": "NO"
},
{
"input": "10\n100 100 100 100 100 100 100 100 100 100",
"output": "NO"
},
{
"input": "7\n25 25 25 25 50 100 50",
"output": "YES"
},
{
"input": "2\n25 25",
"output": "YES"
},
{
"input": "3\n50 100 100",
"output": "NO"
},
{
"input": "3\n25 50 50",
"output": "NO"
},
{
"input": "2\n50 25",
"output": "NO"
},
{
"input": "14\n25 25 25 25 25 25 25 50 50 50 100 100 100 100",
"output": "NO"
},
{
"input": "5\n25 25 25 100 100",
"output": "NO"
},
{
"input": "7\n25 50 25 50 25 50 100",
"output": "NO"
},
{
"input": "5\n25 50 25 50 100",
"output": "NO"
},
{
"input": "5\n25 25 50 50 50",
"output": "NO"
},
{
"input": "5\n25 25 50 100 50",
"output": "NO"
},
{
"input": "5\n25 25 50 50 100",
"output": "NO"
},
{
"input": "1\n50",
"output": "NO"
}
] | 1,659,524,413 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 0 | 124 | 307,200 | from collections import defaultdict
n = int(input())
a = [int(i) for i in input().split()]
d = defaultdict(int)
d[0] = 1
ans = "YES"
for i in range(n):
if d[a[i] - 25] != 0: ans = "NO" ; break
d[a[i]-25]-=1
d[a[i]] += 1
print(ans) | Title: Cinema Line
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The new "Die Hard" movie has just been released! There are *n* people at the cinema box office standing in a huge line. Each of them has a single 100, 50 or 25 ruble bill. A "Die Hard" ticket costs 25 rubles. Can the booking clerk sell a ticket to each person and give the change if he initially has no money and sells the tickets strictly in the order people follow in the line?
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of people in the line. The next line contains *n* integers, each of them equals 25, 50 or 100 — the values of the bills the people have. The numbers are given in the order from the beginning of the line (at the box office) to the end of the line.
Output Specification:
Print "YES" (without the quotes) if the booking clerk can sell a ticket to each person and give the change. Otherwise print "NO".
Demo Input:
['4\n25 25 50 50\n', '2\n25 100\n', '4\n50 50 25 25\n']
Demo Output:
['YES\n', 'NO\n', 'NO\n']
Note:
none | ```python
from collections import defaultdict
n = int(input())
a = [int(i) for i in input().split()]
d = defaultdict(int)
d[0] = 1
ans = "YES"
for i in range(n):
if d[a[i] - 25] != 0: ans = "NO" ; break
d[a[i]-25]-=1
d[a[i]] += 1
print(ans)
``` | 0 |
|
361 | B | Levko and Permutation | PROGRAMMING | 1,200 | [
"constructive algorithms",
"math",
"number theory"
] | null | null | Levko loves permutations very much. A permutation of length *n* is a sequence of distinct positive integers, each is at most *n*.
Let’s assume that value *gcd*(*a*,<=*b*) shows the greatest common divisor of numbers *a* and *b*. Levko assumes that element *p**i* of permutation *p*1,<=*p*2,<=... ,<=*p**n* is good if *gcd*(*i*,<=*p**i*)<=><=1. Levko considers a permutation beautiful, if it has exactly *k* good elements. Unfortunately, he doesn’t know any beautiful permutation. Your task is to help him to find at least one of them. | The single line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=105, 0<=≤<=*k*<=≤<=*n*). | In a single line print either any beautiful permutation or -1, if such permutation doesn’t exist.
If there are multiple suitable permutations, you are allowed to print any of them. | [
"4 2\n",
"1 1\n"
] | [
"2 4 3 1",
"-1\n"
] | In the first sample elements 4 and 3 are good because *gcd*(2, 4) = 2 > 1 and *gcd*(3, 3) = 3 > 1. Elements 2 and 1 are not good because *gcd*(1, 2) = 1 and *gcd*(4, 1) = 1. As there are exactly 2 good elements, the permutation is beautiful.
The second sample has no beautiful permutations. | 1,000 | [
{
"input": "4 2",
"output": "2 1 3 4 "
},
{
"input": "1 1",
"output": "-1"
},
{
"input": "7 4",
"output": "3 1 2 4 5 6 7 "
},
{
"input": "10 9",
"output": "1 2 3 4 5 6 7 8 9 10 "
},
{
"input": "10000 5000",
"output": "5000 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "7 0",
"output": "7 1 2 3 4 5 6 "
},
{
"input": "1 0",
"output": "1 "
},
{
"input": "7 7",
"output": "-1"
},
{
"input": "100000 47",
"output": "99953 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "100000 100000",
"output": "-1"
},
{
"input": "100000 43425",
"output": "56575 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "7 6",
"output": "1 2 3 4 5 6 7 "
},
{
"input": "100000 99999",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "47 46",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 "
},
{
"input": "5 0",
"output": "5 1 2 3 4 "
},
{
"input": "4 2",
"output": "2 1 3 4 "
},
{
"input": "1533 1052",
"output": "481 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154..."
},
{
"input": "81314 52747",
"output": "28567 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "17767 145",
"output": "17622 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "18168 7942",
"output": "10226 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "26593 15915",
"output": "10678 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "26593 8877",
"output": "17716 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "13852 12727",
"output": "1125 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "4 1",
"output": "3 1 2 4 "
},
{
"input": "8834 8834",
"output": "-1"
},
{
"input": "8485 8484",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "14564 14564",
"output": "-1"
},
{
"input": "8254 8253",
"output": "1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "81314 81312",
"output": "2 1 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "5795 5792",
"output": "3 1 2 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 154 155..."
},
{
"input": "6417 3",
"output": "6414 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "6896 0",
"output": "6896 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "6778 1",
"output": "6777 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "9448 1",
"output": "9447 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "5938 2",
"output": "5936 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "3072 0",
"output": "3072 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "8576 0",
"output": "8576 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "2 1",
"output": "1 2 "
},
{
"input": "4 4",
"output": "-1"
},
{
"input": "5 5",
"output": "-1"
},
{
"input": "2 2",
"output": "-1"
},
{
"input": "100000 1",
"output": "99999 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "100000 50000",
"output": "50000 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "4 1",
"output": "3 1 2 4 "
},
{
"input": "100000 9999",
"output": "90001 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
},
{
"input": "100000 99000",
"output": "1000 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 15..."
},
{
"input": "100000 12347",
"output": "87653 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 101 102 103 104 105 106 107 108 109 110 111 112 113 114 115 116 117 118 119 120 121 122 123 124 125 126 127 128 129 130 131 132 133 134 135 136 137 138 139 140 141 142 143 144 145 146 147 148 149 150 151 152 153 1..."
}
] | 1,597,943,844 | 2,147,483,647 | PyPy 3 | OK | TESTS | 47 | 202 | 8,089,600 | import sys
n,k=map(int,input().split())
a=[]
if(n==k):
print("-1")
sys.exit()
for i in range(n):
a.append(i+1)
for j in range(n-k-1):
a[j],a[j+1]=a[j+1],a[j]
print(*a) | Title: Levko and Permutation
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Levko loves permutations very much. A permutation of length *n* is a sequence of distinct positive integers, each is at most *n*.
Let’s assume that value *gcd*(*a*,<=*b*) shows the greatest common divisor of numbers *a* and *b*. Levko assumes that element *p**i* of permutation *p*1,<=*p*2,<=... ,<=*p**n* is good if *gcd*(*i*,<=*p**i*)<=><=1. Levko considers a permutation beautiful, if it has exactly *k* good elements. Unfortunately, he doesn’t know any beautiful permutation. Your task is to help him to find at least one of them.
Input Specification:
The single line contains two integers *n* and *k* (1<=≤<=*n*<=≤<=105, 0<=≤<=*k*<=≤<=*n*).
Output Specification:
In a single line print either any beautiful permutation or -1, if such permutation doesn’t exist.
If there are multiple suitable permutations, you are allowed to print any of them.
Demo Input:
['4 2\n', '1 1\n']
Demo Output:
['2 4 3 1', '-1\n']
Note:
In the first sample elements 4 and 3 are good because *gcd*(2, 4) = 2 > 1 and *gcd*(3, 3) = 3 > 1. Elements 2 and 1 are not good because *gcd*(1, 2) = 1 and *gcd*(4, 1) = 1. As there are exactly 2 good elements, the permutation is beautiful.
The second sample has no beautiful permutations. | ```python
import sys
n,k=map(int,input().split())
a=[]
if(n==k):
print("-1")
sys.exit()
for i in range(n):
a.append(i+1)
for j in range(n-k-1):
a[j],a[j+1]=a[j+1],a[j]
print(*a)
``` | 3 |
|
1,000 | B | Light It Up | PROGRAMMING | 1,500 | [
"greedy"
] | null | null | Recently, you bought a brand new smart lamp with programming features. At first, you set up a schedule to the lamp. Every day it will turn power on at moment $0$ and turn power off at moment $M$. Moreover, the lamp allows you to set a program of switching its state (states are "lights on" and "lights off"). Unfortunately, some program is already installed into the lamp.
The lamp allows only good programs. Good program can be represented as a non-empty array $a$, where $0 < a_1 < a_2 < \dots < a_{|a|} < M$. All $a_i$ must be integers. Of course, preinstalled program is a good program.
The lamp follows program $a$ in next manner: at moment $0$ turns power and light on. Then at moment $a_i$ the lamp flips its state to opposite (if it was lit, it turns off, and vice versa). The state of the lamp flips instantly: for example, if you turn the light off at moment $1$ and then do nothing, the total time when the lamp is lit will be $1$. Finally, at moment $M$ the lamp is turning its power off regardless of its state.
Since you are not among those people who read instructions, and you don't understand the language it's written in, you realize (after some testing) the only possible way to alter the preinstalled program. You can insert at most one element into the program $a$, so it still should be a good program after alteration. Insertion can be done between any pair of consecutive elements of $a$, or even at the begining or at the end of $a$.
Find such a way to alter the program that the total time when the lamp is lit is maximum possible. Maybe you should leave program untouched. If the lamp is lit from $x$ till moment $y$, then its lit for $y - x$ units of time. Segments of time when the lamp is lit are summed up. | First line contains two space separated integers $n$ and $M$ ($1 \le n \le 10^5$, $2 \le M \le 10^9$) — the length of program $a$ and the moment when power turns off.
Second line contains $n$ space separated integers $a_1, a_2, \dots, a_n$ ($0 < a_1 < a_2 < \dots < a_n < M$) — initially installed program $a$. | Print the only integer — maximum possible total time when the lamp is lit. | [
"3 10\n4 6 7\n",
"2 12\n1 10\n",
"2 7\n3 4\n"
] | [
"8\n",
"9\n",
"6\n"
] | In the first example, one of possible optimal solutions is to insert value $x = 3$ before $a_1$, so program will be $[3, 4, 6, 7]$ and time of lamp being lit equals $(3 - 0) + (6 - 4) + (10 - 7) = 8$. Other possible solution is to insert $x = 5$ in appropriate place.
In the second example, there is only one optimal solution: to insert $x = 2$ between $a_1$ and $a_2$. Program will become $[1, 2, 10]$, and answer will be $(1 - 0) + (10 - 2) = 9$.
In the third example, optimal answer is to leave program untouched, so answer will be $(3 - 0) + (7 - 4) = 6$. | 0 | [
{
"input": "3 10\n4 6 7",
"output": "8"
},
{
"input": "2 12\n1 10",
"output": "9"
},
{
"input": "2 7\n3 4",
"output": "6"
},
{
"input": "1 2\n1",
"output": "1"
},
{
"input": "5 10\n1 3 5 6 8",
"output": "6"
},
{
"input": "7 1000000000\n1 10001 10011 20011 20021 40021 40031",
"output": "999999969"
},
{
"input": "7 1000000000\n3 10001 10011 20011 20021 40021 40031",
"output": "999999969"
},
{
"input": "1 10\n1",
"output": "9"
},
{
"input": "1 10000000\n1",
"output": "9999999"
},
{
"input": "1 8\n1",
"output": "7"
},
{
"input": "7 17\n1 5 9 10 11 14 16",
"output": "9"
},
{
"input": "4 17\n1 5 9 10",
"output": "12"
},
{
"input": "5 12\n1 2 3 4 5",
"output": "9"
},
{
"input": "2 1000000000\n100 111",
"output": "999999989"
},
{
"input": "3 90591\n90579 90580 90581",
"output": "90589"
},
{
"input": "5 16\n1 2 3 4 5",
"output": "13"
},
{
"input": "6 981231233\n1 6 15 30 130 1875",
"output": "981229468"
},
{
"input": "1 3\n1",
"output": "2"
},
{
"input": "3 12\n4 7 11",
"output": "8"
},
{
"input": "1 100000\n1",
"output": "99999"
},
{
"input": "2 5\n1 3",
"output": "3"
},
{
"input": "1 1000000000\n1",
"output": "999999999"
},
{
"input": "1 1000000000\n999999999",
"output": "999999999"
},
{
"input": "3 4\n1 2 3",
"output": "2"
},
{
"input": "3 5\n1 2 3",
"output": "3"
},
{
"input": "1 4\n2",
"output": "3"
},
{
"input": "3 5\n1 3 4",
"output": "3"
},
{
"input": "9 20\n5 9 11 12 14 15 16 17 19",
"output": "12"
},
{
"input": "2 4\n1 2",
"output": "3"
},
{
"input": "1 10\n2",
"output": "9"
},
{
"input": "2 6\n2 4",
"output": "4"
},
{
"input": "2 4\n1 3",
"output": "2"
},
{
"input": "3 6\n1 2 4",
"output": "4"
},
{
"input": "7 9863\n65 96 97 98 101 112 1115",
"output": "9819"
}
] | 1,666,147,166 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 46 | 0 | n, M = map(int,input().split())
a = [0]
for i in list(map(int, input().split())):
a.append(i)
a.append(M)
c=[0]
for x in range(0,M):
b=0
if x not in a:
a.append(x)
a=sorted(a)
for j in range(0,len(a)-1,2):
b+=a[j+1]-a[j]
c.append(b)
a.remove(x)
a=sorted(a)
print(max(c)) | Title: Light It Up
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Recently, you bought a brand new smart lamp with programming features. At first, you set up a schedule to the lamp. Every day it will turn power on at moment $0$ and turn power off at moment $M$. Moreover, the lamp allows you to set a program of switching its state (states are "lights on" and "lights off"). Unfortunately, some program is already installed into the lamp.
The lamp allows only good programs. Good program can be represented as a non-empty array $a$, where $0 < a_1 < a_2 < \dots < a_{|a|} < M$. All $a_i$ must be integers. Of course, preinstalled program is a good program.
The lamp follows program $a$ in next manner: at moment $0$ turns power and light on. Then at moment $a_i$ the lamp flips its state to opposite (if it was lit, it turns off, and vice versa). The state of the lamp flips instantly: for example, if you turn the light off at moment $1$ and then do nothing, the total time when the lamp is lit will be $1$. Finally, at moment $M$ the lamp is turning its power off regardless of its state.
Since you are not among those people who read instructions, and you don't understand the language it's written in, you realize (after some testing) the only possible way to alter the preinstalled program. You can insert at most one element into the program $a$, so it still should be a good program after alteration. Insertion can be done between any pair of consecutive elements of $a$, or even at the begining or at the end of $a$.
Find such a way to alter the program that the total time when the lamp is lit is maximum possible. Maybe you should leave program untouched. If the lamp is lit from $x$ till moment $y$, then its lit for $y - x$ units of time. Segments of time when the lamp is lit are summed up.
Input Specification:
First line contains two space separated integers $n$ and $M$ ($1 \le n \le 10^5$, $2 \le M \le 10^9$) — the length of program $a$ and the moment when power turns off.
Second line contains $n$ space separated integers $a_1, a_2, \dots, a_n$ ($0 < a_1 < a_2 < \dots < a_n < M$) — initially installed program $a$.
Output Specification:
Print the only integer — maximum possible total time when the lamp is lit.
Demo Input:
['3 10\n4 6 7\n', '2 12\n1 10\n', '2 7\n3 4\n']
Demo Output:
['8\n', '9\n', '6\n']
Note:
In the first example, one of possible optimal solutions is to insert value $x = 3$ before $a_1$, so program will be $[3, 4, 6, 7]$ and time of lamp being lit equals $(3 - 0) + (6 - 4) + (10 - 7) = 8$. Other possible solution is to insert $x = 5$ in appropriate place.
In the second example, there is only one optimal solution: to insert $x = 2$ between $a_1$ and $a_2$. Program will become $[1, 2, 10]$, and answer will be $(1 - 0) + (10 - 2) = 9$.
In the third example, optimal answer is to leave program untouched, so answer will be $(3 - 0) + (7 - 4) = 6$. | ```python
n, M = map(int,input().split())
a = [0]
for i in list(map(int, input().split())):
a.append(i)
a.append(M)
c=[0]
for x in range(0,M):
b=0
if x not in a:
a.append(x)
a=sorted(a)
for j in range(0,len(a)-1,2):
b+=a[j+1]-a[j]
c.append(b)
a.remove(x)
a=sorted(a)
print(max(c))
``` | 0 |
|
746 | A | Compote | PROGRAMMING | 800 | [
"implementation",
"math"
] | null | null | Nikolay has *a* lemons, *b* apples and *c* pears. He decided to cook a compote. According to the recipe the fruits should be in the ratio 1:<=2:<=4. It means that for each lemon in the compote should be exactly 2 apples and exactly 4 pears. You can't crumble up, break up or cut these fruits into pieces. These fruits — lemons, apples and pears — should be put in the compote as whole fruits.
Your task is to determine the maximum total number of lemons, apples and pears from which Nikolay can cook the compote. It is possible that Nikolay can't use any fruits, in this case print 0. | The first line contains the positive integer *a* (1<=≤<=*a*<=≤<=1000) — the number of lemons Nikolay has.
The second line contains the positive integer *b* (1<=≤<=*b*<=≤<=1000) — the number of apples Nikolay has.
The third line contains the positive integer *c* (1<=≤<=*c*<=≤<=1000) — the number of pears Nikolay has. | Print the maximum total number of lemons, apples and pears from which Nikolay can cook the compote. | [
"2\n5\n7\n",
"4\n7\n13\n",
"2\n3\n2\n"
] | [
"7\n",
"21\n",
"0\n"
] | In the first example Nikolay can use 1 lemon, 2 apples and 4 pears, so the answer is 1 + 2 + 4 = 7.
In the second example Nikolay can use 3 lemons, 6 apples and 12 pears, so the answer is 3 + 6 + 12 = 21.
In the third example Nikolay don't have enough pears to cook any compote, so the answer is 0. | 500 | [
{
"input": "2\n5\n7",
"output": "7"
},
{
"input": "4\n7\n13",
"output": "21"
},
{
"input": "2\n3\n2",
"output": "0"
},
{
"input": "1\n1\n1",
"output": "0"
},
{
"input": "1\n2\n4",
"output": "7"
},
{
"input": "1000\n1000\n1000",
"output": "1750"
},
{
"input": "1\n1\n4",
"output": "0"
},
{
"input": "1\n2\n3",
"output": "0"
},
{
"input": "1\n1000\n1000",
"output": "7"
},
{
"input": "1000\n1\n1000",
"output": "0"
},
{
"input": "1000\n2\n1000",
"output": "7"
},
{
"input": "1000\n500\n1000",
"output": "1750"
},
{
"input": "1000\n1000\n4",
"output": "7"
},
{
"input": "1000\n1000\n3",
"output": "0"
},
{
"input": "4\n8\n12",
"output": "21"
},
{
"input": "10\n20\n40",
"output": "70"
},
{
"input": "100\n200\n399",
"output": "693"
},
{
"input": "200\n400\n800",
"output": "1400"
},
{
"input": "199\n400\n800",
"output": "1393"
},
{
"input": "201\n400\n800",
"output": "1400"
},
{
"input": "200\n399\n800",
"output": "1393"
},
{
"input": "200\n401\n800",
"output": "1400"
},
{
"input": "200\n400\n799",
"output": "1393"
},
{
"input": "200\n400\n801",
"output": "1400"
},
{
"input": "139\n252\n871",
"output": "882"
},
{
"input": "109\n346\n811",
"output": "763"
},
{
"input": "237\n487\n517",
"output": "903"
},
{
"input": "161\n331\n725",
"output": "1127"
},
{
"input": "39\n471\n665",
"output": "273"
},
{
"input": "9\n270\n879",
"output": "63"
},
{
"input": "137\n422\n812",
"output": "959"
},
{
"input": "15\n313\n525",
"output": "105"
},
{
"input": "189\n407\n966",
"output": "1323"
},
{
"input": "18\n268\n538",
"output": "126"
},
{
"input": "146\n421\n978",
"output": "1022"
},
{
"input": "70\n311\n685",
"output": "490"
},
{
"input": "244\n405\n625",
"output": "1092"
},
{
"input": "168\n454\n832",
"output": "1176"
},
{
"input": "46\n344\n772",
"output": "322"
},
{
"input": "174\n438\n987",
"output": "1218"
},
{
"input": "144\n387\n693",
"output": "1008"
},
{
"input": "22\n481\n633",
"output": "154"
},
{
"input": "196\n280\n848",
"output": "980"
},
{
"input": "190\n454\n699",
"output": "1218"
},
{
"input": "231\n464\n928",
"output": "1617"
},
{
"input": "151\n308\n616",
"output": "1057"
},
{
"input": "88\n182\n364",
"output": "616"
},
{
"input": "12\n26\n52",
"output": "84"
},
{
"input": "204\n412\n824",
"output": "1428"
},
{
"input": "127\n256\n512",
"output": "889"
},
{
"input": "224\n446\n896",
"output": "1561"
},
{
"input": "146\n291\n584",
"output": "1015"
},
{
"input": "83\n164\n332",
"output": "574"
},
{
"input": "20\n38\n80",
"output": "133"
},
{
"input": "198\n393\n792",
"output": "1372"
},
{
"input": "120\n239\n480",
"output": "833"
},
{
"input": "208\n416\n831",
"output": "1449"
},
{
"input": "130\n260\n517",
"output": "903"
},
{
"input": "67\n134\n267",
"output": "462"
},
{
"input": "245\n490\n979",
"output": "1708"
},
{
"input": "182\n364\n727",
"output": "1267"
},
{
"input": "104\n208\n413",
"output": "721"
},
{
"input": "10\n2\n100",
"output": "7"
},
{
"input": "2\n100\n100",
"output": "14"
},
{
"input": "2\n3\n8",
"output": "7"
},
{
"input": "1\n2\n8",
"output": "7"
},
{
"input": "1\n2\n200",
"output": "7"
},
{
"input": "5\n4\n16",
"output": "14"
},
{
"input": "1\n10\n10",
"output": "7"
},
{
"input": "1\n4\n8",
"output": "7"
},
{
"input": "100\n4\n1000",
"output": "14"
},
{
"input": "2\n6\n12",
"output": "14"
},
{
"input": "10\n7\n4",
"output": "7"
},
{
"input": "2\n10\n100",
"output": "14"
},
{
"input": "2\n3\n4",
"output": "7"
},
{
"input": "1\n2\n999",
"output": "7"
},
{
"input": "1\n10\n20",
"output": "7"
},
{
"input": "100\n18\n20",
"output": "35"
},
{
"input": "100\n1\n100",
"output": "0"
},
{
"input": "3\n7\n80",
"output": "21"
},
{
"input": "2\n8\n24",
"output": "14"
},
{
"input": "1\n100\n100",
"output": "7"
},
{
"input": "2\n1\n8",
"output": "0"
},
{
"input": "10\n5\n23",
"output": "14"
}
] | 1,680,179,905 | 2,147,483,647 | Python 3 | OK | TESTS | 84 | 46 | 0 | l = int(input())
a = int(input())
p = int(input())
a, p = a//2, p//4
m = min(a,l,p)
print(m*1 + m*2 + m*4) | Title: Compote
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Nikolay has *a* lemons, *b* apples and *c* pears. He decided to cook a compote. According to the recipe the fruits should be in the ratio 1:<=2:<=4. It means that for each lemon in the compote should be exactly 2 apples and exactly 4 pears. You can't crumble up, break up or cut these fruits into pieces. These fruits — lemons, apples and pears — should be put in the compote as whole fruits.
Your task is to determine the maximum total number of lemons, apples and pears from which Nikolay can cook the compote. It is possible that Nikolay can't use any fruits, in this case print 0.
Input Specification:
The first line contains the positive integer *a* (1<=≤<=*a*<=≤<=1000) — the number of lemons Nikolay has.
The second line contains the positive integer *b* (1<=≤<=*b*<=≤<=1000) — the number of apples Nikolay has.
The third line contains the positive integer *c* (1<=≤<=*c*<=≤<=1000) — the number of pears Nikolay has.
Output Specification:
Print the maximum total number of lemons, apples and pears from which Nikolay can cook the compote.
Demo Input:
['2\n5\n7\n', '4\n7\n13\n', '2\n3\n2\n']
Demo Output:
['7\n', '21\n', '0\n']
Note:
In the first example Nikolay can use 1 lemon, 2 apples and 4 pears, so the answer is 1 + 2 + 4 = 7.
In the second example Nikolay can use 3 lemons, 6 apples and 12 pears, so the answer is 3 + 6 + 12 = 21.
In the third example Nikolay don't have enough pears to cook any compote, so the answer is 0. | ```python
l = int(input())
a = int(input())
p = int(input())
a, p = a//2, p//4
m = min(a,l,p)
print(m*1 + m*2 + m*4)
``` | 3 |
|
43 | A | Football | PROGRAMMING | 1,000 | [
"strings"
] | A. Football | 2 | 256 | One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams. | Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner. | [
"1\nABC\n",
"5\nA\nABA\nABA\nA\nA\n"
] | [
"ABC\n",
"A\n"
] | none | 500 | [
{
"input": "1\nABC",
"output": "ABC"
},
{
"input": "5\nA\nABA\nABA\nA\nA",
"output": "A"
},
{
"input": "2\nXTSJEP\nXTSJEP",
"output": "XTSJEP"
},
{
"input": "3\nXZYDJAEDZ\nXZYDJAEDZ\nXZYDJAEDZ",
"output": "XZYDJAEDZ"
},
{
"input": "3\nQCCYXL\nQCCYXL\nAXGLFQDD",
"output": "QCCYXL"
},
{
"input": "3\nAZID\nEERWBC\nEERWBC",
"output": "EERWBC"
},
{
"input": "3\nHNCGYL\nHNCGYL\nHNCGYL",
"output": "HNCGYL"
},
{
"input": "4\nZZWZTG\nZZWZTG\nZZWZTG\nZZWZTG",
"output": "ZZWZTG"
},
{
"input": "4\nA\nA\nKUDLJMXCSE\nA",
"output": "A"
},
{
"input": "5\nPHBTW\nPHBTW\nPHBTW\nPHBTW\nPHBTW",
"output": "PHBTW"
},
{
"input": "5\nPKUZYTFYWN\nPKUZYTFYWN\nSTC\nPKUZYTFYWN\nPKUZYTFYWN",
"output": "PKUZYTFYWN"
},
{
"input": "5\nHH\nHH\nNTQWPA\nNTQWPA\nHH",
"output": "HH"
},
{
"input": "10\nW\nW\nW\nW\nW\nD\nW\nD\nD\nW",
"output": "W"
},
{
"input": "19\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nXBCP\nXBCP\nXBCP\nTGACNIH\nXBCP\nXBCP\nTGACNIH\nTGACNIH\nXBCP",
"output": "XBCP"
},
{
"input": "33\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nOWQWCKLLF\nOWQWCKLLF\nPYPAS\nPYPAS\nOWQWCKLLF\nPYPAS\nPYPAS",
"output": "PYPAS"
},
{
"input": "51\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC\nNC",
"output": "NC"
},
{
"input": "89\nH\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nVOCI\nVOCI\nH\nH\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nVOCI\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI\nH\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nVOCI\nH\nH\nH\nH\nH\nVOCI\nH\nVOCI\nH\nVOCI\nVOCI",
"output": "VOCI"
},
{
"input": "100\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nM\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA\nHA",
"output": "HA"
},
{
"input": "100\nG\nG\nS\nS\nG\nG\nS\nS\nG\nS\nS\nS\nG\nS\nG\nG\nS\nG\nS\nS\nG\nS\nS\nS\nS\nS\nG\nS\nG\nS\nS\nG\nG\nG\nS\nS\nS\nS\nG\nS\nS\nG\nG\nG\nG\nG\nS\nG\nG\nS\nS\nS\nS\nS\nG\nG\nS\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nS\nS\nG\nS\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nG\nS\nS\nG\nS\nS\nS\nS\nG\nG\nG\nS\nG\nG\nG\nS",
"output": "G"
},
{
"input": "100\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nOBH\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL\nWL",
"output": "WL"
}
] | 1,685,721,793 | 2,147,483,647 | PyPy 3-64 | RUNTIME_ERROR | TESTS | 0 | 124 | 2,764,800 | n=int(input())
team={}
for _ in range(n):
s=input()
if s not in team:
team[s]=1
else:
team[s]+=1
print(sorted(team,lambda x:team[x],reverse=True)[0])
| Title: Football
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
One day Vasya decided to have a look at the results of Berland 1910 Football Championship’s finals. Unfortunately he didn't find the overall score of the match; however, he got hold of a profound description of the match's process. On the whole there are *n* lines in that description each of which described one goal. Every goal was marked with the name of the team that had scored it. Help Vasya, learn the name of the team that won the finals. It is guaranteed that the match did not end in a tie.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=100) — the number of lines in the description. Then follow *n* lines — for each goal the names of the teams that scored it. The names are non-empty lines consisting of uppercase Latin letters whose lengths do not exceed 10 symbols. It is guaranteed that the match did not end in a tie and the description contains no more than two different teams.
Output Specification:
Print the name of the winning team. We remind you that in football the team that scores more goals is considered the winner.
Demo Input:
['1\nABC\n', '5\nA\nABA\nABA\nA\nA\n']
Demo Output:
['ABC\n', 'A\n']
Note:
none | ```python
n=int(input())
team={}
for _ in range(n):
s=input()
if s not in team:
team[s]=1
else:
team[s]+=1
print(sorted(team,lambda x:team[x],reverse=True)[0])
``` | -1 |
59 | A | Word | PROGRAMMING | 800 | [
"implementation",
"strings"
] | A. Word | 2 | 256 | Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word. | The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100. | Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one. | [
"HoUse\n",
"ViP\n",
"maTRIx\n"
] | [
"house\n",
"VIP\n",
"matrix\n"
] | none | 500 | [
{
"input": "HoUse",
"output": "house"
},
{
"input": "ViP",
"output": "VIP"
},
{
"input": "maTRIx",
"output": "matrix"
},
{
"input": "BNHWpnpawg",
"output": "bnhwpnpawg"
},
{
"input": "VTYGP",
"output": "VTYGP"
},
{
"input": "CHNenu",
"output": "chnenu"
},
{
"input": "ERPZGrodyu",
"output": "erpzgrodyu"
},
{
"input": "KSXBXWpebh",
"output": "KSXBXWPEBH"
},
{
"input": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv",
"output": "qvxpqullmcbegsdskddortcvxyqlbvxmmkhevovnezubvpvnrcajpxraeaxizgaowtfkzywvhnbgzsxbhkaipcmoumtikkiyyaiv"
},
{
"input": "Amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd",
"output": "amnhaxtaopjzrkqlbroiyipitndczpunwygstmzevgyjdzyanxkdqnvgkikfabwouwkkbzuiuvgvxgpizsvqsbwepktpdrgdkmfd"
},
{
"input": "ISAGFJFARYFBLOPQDSHWGMCNKMFTLVFUGNJEWGWNBLXUIATXEkqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv",
"output": "isagfjfaryfblopqdshwgmcnkmftlvfugnjewgwnblxuiatxekqiettmmjgydwcpafqrppdsrrrtguinqbgmzzfqwonkpgpcwenv"
},
{
"input": "XHRPXZEGHSOCJPICUIXSKFUZUPYTSGJSDIYBCMNMNBPNDBXLXBzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg",
"output": "xhrpxzeghsocjpicuixskfuzupytsgjsdiybcmnmnbpndbxlxbzhbfnqvwcffvrdhtickyqhupmcehlsyvncqmfhautvxudqdhgg"
},
{
"input": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGAdkcetqjljtmttlonpekcovdzebzdkzggwfsxhapmjkdbuceak",
"output": "RJIQZMJCIMSNDBOHBRAWIENODSALETAKGKPYUFGVEFGCBRENZGADKCETQJLJTMTTLONPEKCOVDZEBZDKZGGWFSXHAPMJKDBUCEAK"
},
{
"input": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFw",
"output": "DWLWOBHNMMGTFOLFAECKBRNNGLYLYDXTGTVRLMEESZOIUATZZZXUFUZDLSJXMEVRTESSFBWLNZZCLCQWEVNNUCXYVHNGNXHCBDFW"
},
{
"input": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB",
"output": "NYCNHJWGBOCOTSPETKKHVWFGAQYNHOVJWJHCIEFOUQZXOYUIEQDZALFKTEHTVDBVJMEUBJUBCMNVPWGDPNCHQHZJRCHYRFPVIGUB"
},
{
"input": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge",
"output": "igxoixiecetohtgjgbqzvlaobkhstejxdklghowtvwunnnvauriohuspsdmpzckprwajyxldoyckgjivjpmbfqtszmtocovxwge"
},
{
"input": "Ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw",
"output": "ykkekrsqolzryiwsmdlnbmfautxxxauoojrddvwklgnlyrfcvhorrzbmtcrvpaypqhcffdqhwziipyyskcmztjprjqvmzzqhqnw"
},
{
"input": "YQOMLKYAORUQQUCQZCDYMIVDHGWZFFRMUVTAWCHERFPMNRYRIkgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks",
"output": "yqomlkyaoruqqucqzcdymivdhgwzffrmuvtawcherfpmnryrikgqrciokgajamehmcxgerpudvsqyonjonsxgbnefftzmygncks"
},
{
"input": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJcuusigdqfkumewjtdyitveeiaybwrhomrwmpdipjwiuxfnwuz",
"output": "CDOZDPBVVVHNBJVBYHEOXWFLJKRWJCAJMIFCOZWWYFKVWOGTVJCUUSIGDQFKUMEWJTDYITVEEIAYBWRHOMRWMPDIPJWIUXFNWUZ"
},
{
"input": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWuckzcpxosodcjaaakvlxpbiigsiauviilylnnqlyucziihqg",
"output": "WHIUVEXHVOOIJIDVJVPQUBJMEVPMPDKQWJKFBZSGSKUXMIPPMJWUCKZCPXOSODCJAAAKVLXPBIIGSIAUVIILYLNNQLYUCZIIHQG"
},
{
"input": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO",
"output": "VGHUNFOXKETUYMZDJNGTAOIOANYXSGYNFOGOFFLDAWEUKYFOZXCJTCAFXZYLQZERYZLRSQXYQGAPCSUDPMEYTNCTTTMFAGVDWBO"
},
{
"input": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDd",
"output": "EDUANHCQDOCJHFONTTSWBUJSTTIXBIXMAIUFSGFLXWAYIURTVAVZPYQDLAWIGCLMPHXCEFCJPFAAHXVNGQUFNHADAIUAZIDMHDD"
},
{
"input": "EBWOVSNLYTWWXrnovgugogtjahnmatomubebyxakas",
"output": "ebwovsnlytwwxrnovgugogtjahnmatomubebyxakas"
},
{
"input": "AORNNDKTRLRVGDPXJKXFTPFpopuzrlqumrxssskvbm",
"output": "AORNNDKTRLRVGDPXJKXFTPFPOPUZRLQUMRXSSSKVBM"
},
{
"input": "DBBZJCWQEVGYHEEUHJAWRHBDPsnplijbwtdibqrrheebfxqcvn",
"output": "dbbzjcwqevgyheeuhjawrhbdpsnplijbwtdibqrrheebfxqcvn"
},
{
"input": "t",
"output": "t"
},
{
"input": "N",
"output": "N"
},
{
"input": "kv",
"output": "kv"
},
{
"input": "Ur",
"output": "ur"
},
{
"input": "CN",
"output": "CN"
}
] | 1,589,806,022 | 2,147,483,647 | Python 3 | OK | TESTS | 30 | 248 | 6,656,000 | n = input()
up_letters = 0
lower_letters = 0
for i in n:
if i.lower() == i:
lower_letters += 1
else:
up_letters +=1
if up_letters>lower_letters:
n = n.upper()
else:
n = n.lower()
print(n) | Title: Word
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Vasya is very upset that many people on the Net mix uppercase and lowercase letters in one word. That's why he decided to invent an extension for his favorite browser that would change the letters' register in every word so that it either only consisted of lowercase letters or, vice versa, only of uppercase ones. At that as little as possible letters should be changed in the word. For example, the word HoUse must be replaced with house, and the word ViP — with VIP. If a word contains an equal number of uppercase and lowercase letters, you should replace all the letters with lowercase ones. For example, maTRIx should be replaced by matrix. Your task is to use the given method on one given word.
Input Specification:
The first line contains a word *s* — it consists of uppercase and lowercase Latin letters and possesses the length from 1 to 100.
Output Specification:
Print the corrected word *s*. If the given word *s* has strictly more uppercase letters, make the word written in the uppercase register, otherwise - in the lowercase one.
Demo Input:
['HoUse\n', 'ViP\n', 'maTRIx\n']
Demo Output:
['house\n', 'VIP\n', 'matrix\n']
Note:
none | ```python
n = input()
up_letters = 0
lower_letters = 0
for i in n:
if i.lower() == i:
lower_letters += 1
else:
up_letters +=1
if up_letters>lower_letters:
n = n.upper()
else:
n = n.lower()
print(n)
``` | 3.925602 |
197 | B | Limit | PROGRAMMING | 1,400 | [
"math"
] | null | null | You are given two polynomials:
- *P*(*x*)<==<=*a*0·*x**n*<=+<=*a*1·*x**n*<=-<=1<=+<=...<=+<=*a**n*<=-<=1·*x*<=+<=*a**n* and - *Q*(*x*)<==<=*b*0·*x**m*<=+<=*b*1·*x**m*<=-<=1<=+<=...<=+<=*b**m*<=-<=1·*x*<=+<=*b**m*.
Calculate limit . | The first line contains two space-separated integers *n* and *m* (0<=≤<=*n*,<=*m*<=≤<=100) — degrees of polynomials *P*(*x*) and *Q*(*x*) correspondingly.
The second line contains *n*<=+<=1 space-separated integers — the factors of polynomial *P*(*x*): *a*0, *a*1, ..., *a**n*<=-<=1, *a**n* (<=-<=100<=≤<=*a**i*<=≤<=100,<=*a*0<=≠<=0).
The third line contains *m*<=+<=1 space-separated integers — the factors of polynomial *Q*(*x*): *b*0, *b*1, ..., *b**m*<=-<=1, *b**m* (<=-<=100<=≤<=*b**i*<=≤<=100,<=*b*0<=≠<=0). | If the limit equals <=+<=∞, print "Infinity" (without quotes). If the limit equals <=-<=∞, print "-Infinity" (without the quotes).
If the value of the limit equals zero, print "0/1" (without the quotes).
Otherwise, print an irreducible fraction — the value of limit , in the format "p/q" (without the quotes), where *p* is the — numerator, *q* (*q*<=><=0) is the denominator of the fraction. | [
"2 1\n1 1 1\n2 5\n",
"1 0\n-1 3\n2\n",
"0 1\n1\n1 0\n",
"2 2\n2 1 6\n4 5 -7\n",
"1 1\n9 0\n-5 2\n"
] | [
"Infinity\n",
"-Infinity\n",
"0/1\n",
"1/2\n",
"-9/5\n"
] | Let's consider all samples:
1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c28febca257452afdfcbd6984ba8623911f9bdbc.png" style="max-width: 100.0%;max-height: 100.0%;"/> 1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/1e55ecd04e54a45e5e0092ec9a5c1ea03bb29255.png" style="max-width: 100.0%;max-height: 100.0%;"/> 1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/2c95fb684d373fcc1a481cfabeda4d5c2f3673ee.png" style="max-width: 100.0%;max-height: 100.0%;"/> 1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4dc40cb8b3cd6375c42445366e50369649a2801a.png" style="max-width: 100.0%;max-height: 100.0%;"/> 1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c6455aba35cfb3c4397505121d1f77afcd17c98e.png" style="max-width: 100.0%;max-height: 100.0%;"/>
You can learn more about the definition and properties of limits if you follow the link: http://en.wikipedia.org/wiki/Limit_of_a_function | 500 | [
{
"input": "2 1\n1 1 1\n2 5",
"output": "Infinity"
},
{
"input": "1 0\n-1 3\n2",
"output": "-Infinity"
},
{
"input": "0 1\n1\n1 0",
"output": "0/1"
},
{
"input": "2 2\n2 1 6\n4 5 -7",
"output": "1/2"
},
{
"input": "1 1\n9 0\n-5 2",
"output": "-9/5"
},
{
"input": "1 2\n5 3\n-3 2 -1",
"output": "0/1"
},
{
"input": "1 2\n-4 8\n-2 5 -3",
"output": "0/1"
},
{
"input": "3 2\n4 3 1 2\n-5 7 0",
"output": "-Infinity"
},
{
"input": "2 1\n-3 5 1\n-8 0",
"output": "Infinity"
},
{
"input": "1 1\n-5 7\n3 1",
"output": "-5/3"
},
{
"input": "2 2\n-4 2 1\n-5 8 -19",
"output": "4/5"
},
{
"input": "0 100\n1\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "0/1"
},
{
"input": "100 0\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100\n1",
"output": "Infinity"
},
{
"input": "0 0\n36\n-54",
"output": "-2/3"
},
{
"input": "0 0\n36\n-8",
"output": "-9/2"
},
{
"input": "0 0\n-6\n-8",
"output": "3/4"
},
{
"input": "0 2\n-3\n1 4 6",
"output": "0/1"
},
{
"input": "0 0\n-21\n13",
"output": "-21/13"
},
{
"input": "0 0\n-34\n21",
"output": "-34/21"
},
{
"input": "0 0\n-55\n34",
"output": "-55/34"
},
{
"input": "33 100\n-15 -90 -84 57 67 60 -40 -82 83 -80 43 -15 -36 -14 -37 -49 42 -79 49 -7 -12 53 -44 -21 87 -91 -73 -27 13 65 5 74 -21 -52\n-67 -17 36 -46 -5 31 -45 -35 -49 13 -7 -82 92 -55 -67 -96 31 -70 76 24 -29 26 96 19 -40 99 -26 74 -17 -56 -72 24 -71 -62 10 -56 -74 75 -48 -98 -67 -26 47 7 63 -38 99 66 -25 -31 -24 -42 -49 -27 -45 -2 -37 -16 5 -21 97 33 85 -33 93 30 84 73 -48 18 -36 71 -38 -41 28 1 -7 -15 60 59 -20 -38 -86 90 2 -12 72 -43 26 76 97 7 -2 -47 -4 100 -40 -48 53 -54 0",
"output": "0/1"
},
{
"input": "39 87\n78 -50 18 -32 -12 -65 83 41 -6 53 -26 64 -19 -53 -61 91 -49 -66 67 69 100 -39 95 99 86 -67 -66 63 48 26 -4 95 -54 -71 26 -74 -93 79 -91 -45\n-18 23 48 59 76 82 95 2 -26 18 -39 -74 44 -92 40 -44 1 -97 -100 -63 -54 -3 -86 85 28 -50 41 -53 -74 -29 -91 87 27 -42 -90 -15 -26 -15 -100 -70 -10 -41 16 85 71 -39 -31 -65 80 98 9 23 -40 14 -88 15 -34 10 -67 -94 -58 -24 75 48 -42 56 -77 -13 -25 -79 -100 -57 89 45 22 85 78 -93 -79 69 63 44 74 94 35 -65 -12 -88",
"output": "0/1"
},
{
"input": "47 56\n31 -99 -97 6 -45 -5 89 35 -77 69 57 91 -32 -66 -36 16 30 61 -36 32 48 67 5 -85 65 -11 -51 -63 -51 -16 39 -26 -60 -28 91 43 -90 32 44 83 70 -53 51 56 68 -81 76 79\n61 -21 -75 -36 -24 -19 80 26 -28 93 27 72 -39 -46 -38 68 -29 -16 -63 84 -13 64 55 63 77 5 68 70 15 99 12 -69 50 -48 -82 -3 52 -54 68 91 -37 -100 -5 74 24 91 -1 74 28 29 -87 -13 -88 82 -13 58 23",
"output": "0/1"
},
{
"input": "9 100\n-34 88 33 -80 87 31 -53 -3 8 -70\n31 -25 46 78 8 82 -92 -36 -30 85 -93 86 -87 75 8 -71 44 -41 -83 19 89 -28 81 42 79 86 41 -23 64 -31 46 24 -79 23 71 63 99 90 -16 -70 -1 88 10 65 3 -99 95 52 -80 53 -24 -43 -30 -7 51 40 -47 44 -10 -18 -61 -67 -84 37 45 93 -5 68 32 3 -61 -100 38 -21 -91 90 83 -45 75 89 17 -44 75 14 -28 1 -84 -100 -36 84 -40 88 -84 -54 2 -32 92 -49 77 85 91",
"output": "0/1"
},
{
"input": "28 87\n-77 49 37 46 -92 65 89 100 53 76 -43 47 -80 -46 -94 -4 20 46 81 -41 86 25 69 60 15 -78 -98 -7 -42\n-85 96 59 -40 90 -72 41 -17 -40 -15 -98 66 47 9 -33 -63 59 -25 -31 25 -94 35 28 -36 -41 -38 -38 -54 -40 90 7 -10 98 -19 54 -10 46 -58 -88 -21 90 82 37 -70 -98 -63 41 75 -50 -59 -69 79 -93 -3 -45 14 76 28 -28 -98 -44 -39 71 44 90 91 0 45 7 65 68 39 -27 58 68 -47 -41 100 14 -95 -80 69 -88 -51 -89 -70 -23 95",
"output": "0/1"
},
{
"input": "100 4\n-5 -93 89 -26 -79 14 -28 13 -45 69 50 -84 21 -68 62 30 -26 99 -12 39 20 -74 -39 -41 -28 -72 -55 28 20 31 -92 -20 76 -65 57 72 -36 4 33 -28 -19 -41 -40 40 84 -36 -83 75 -74 -80 32 -50 -56 72 16 75 57 90 -19 -10 67 -71 69 -48 -48 23 37 -31 -64 -86 20 67 97 14 82 -41 2 87 65 -81 -27 9 -79 -1 -5 84 -8 29 -34 31 82 40 21 -53 -31 -45 17 -33 79 50 -94\n56 -4 -90 36 84",
"output": "-Infinity"
},
{
"input": "77 51\n89 45 -33 -87 33 -61 -79 40 -76 16 -17 31 27 25 99 82 51 -40 85 -66 19 89 -62 24 -61 -53 -77 17 21 83 53 -18 -56 75 9 -78 33 -11 -6 96 -33 -2 -57 97 30 20 -41 42 -13 45 -99 67 37 -20 51 -33 88 -62 2 40 17 36 45 71 4 -44 24 20 -2 29 -12 -84 -7 -84 -38 48 -73 79\n60 -43 60 1 90 -1 19 -18 -21 31 -76 51 79 91 12 39 -33 -14 71 -90 -65 -93 -58 93 49 17 77 19 32 -8 14 58 -9 85 -95 -73 0 85 -91 -99 -30 -43 61 20 -89 93 53 20 -33 -38 79 54",
"output": "Infinity"
},
{
"input": "84 54\n82 -54 28 68 74 -61 54 98 59 67 -65 -1 16 65 -78 -16 61 -79 2 14 44 96 -62 77 51 87 37 66 65 28 88 -99 -21 -83 24 80 39 64 -65 45 86 -53 -49 94 -75 -31 -42 -1 -35 -18 74 30 31 -40 30 -6 47 58 -71 -21 20 13 75 -79 15 -98 -26 76 99 -77 -9 85 48 51 -87 56 -53 37 47 -3 94 64 -7 74 86\n72 51 -74 20 41 -76 98 58 24 -61 -97 -73 62 29 6 42 -92 -6 -65 89 -32 -9 82 -13 -88 -70 -97 25 -48 12 -54 33 -92 -29 48 60 -21 86 -17 -86 45 -34 -3 -9 -62 12 25 -74 -76 -89 48 55 -30 86 51",
"output": "Infinity"
},
{
"input": "73 15\n-70 78 51 -33 -95 46 87 -33 16 62 67 -85 -57 75 -93 -59 98 -45 -90 -88 9 53 35 37 28 3 40 -87 28 5 18 11 9 1 72 69 -65 -62 1 73 -3 3 35 17 -28 -31 -45 60 64 18 60 38 -47 12 2 -90 -4 33 -51 -55 -54 90 38 -65 39 32 -70 0 -5 3 -12 100 78 55\n46 33 41 52 -89 -9 53 -81 34 -45 -11 -41 14 -28 95 -50",
"output": "-Infinity"
},
{
"input": "33 1\n-75 -83 87 -27 -48 47 -90 -84 -18 -4 14 -1 -83 -98 -68 -85 -86 28 2 45 96 -59 86 -25 -2 -64 -92 65 69 72 72 -58 -99 90\n-1 72",
"output": "Infinity"
},
{
"input": "58 58\n-25 40 -34 23 -52 94 -30 -99 -71 -90 -44 -71 69 48 -45 -59 0 66 -70 -96 95 91 82 90 -95 87 3 -77 -77 -26 15 87 -82 5 -24 82 -11 99 35 49 22 44 18 -60 -26 79 67 71 -13 29 -23 9 58 -90 88 18 77 5 -7\n-30 -11 -13 -50 61 -78 11 -74 -73 13 -66 -65 -82 38 58 25 -64 -24 78 -87 6 6 -80 -96 47 -25 -54 10 -41 -22 -50 -1 -6 -22 27 54 -32 30 93 88 -70 -100 -69 -47 -20 -92 -24 70 -93 42 78 42 -35 41 31 75 -67 -62 -83",
"output": "5/6"
},
{
"input": "20 20\n5 4 91 -66 -57 55 -79 -2 -54 -72 -49 21 -23 -5 57 -48 70 -16 -86 -26 -19\n51 -60 64 -8 89 27 -96 4 95 -24 -2 -27 -41 -14 -88 -19 24 68 -31 34 -62",
"output": "5/51"
},
{
"input": "69 69\n-90 -63 -21 23 23 -14 -82 65 42 -60 -42 -39 67 34 96 93 -42 -24 21 -80 44 -81 45 -74 -19 -88 39 58 90 87 16 48 -19 -2 36 87 4 -66 -82 -49 -32 -43 -65 12 34 -29 -58 46 -67 -20 -30 91 21 65 15 2 3 -92 -67 -68 39 -24 77 76 -17 -34 5 63 88 83\n-55 98 -79 18 -100 -67 -79 -85 -75 -44 -6 -73 -11 -12 -24 -78 47 -51 25 -29 -34 25 27 11 -87 15 -44 41 -44 46 -67 70 -35 41 62 -36 27 -41 -42 -50 96 31 26 -66 9 74 34 31 25 6 -84 41 74 -7 49 5 35 -5 -71 -37 28 58 -8 -40 -19 -83 -34 64 7 15",
"output": "18/11"
},
{
"input": "0 0\n46\n-33",
"output": "-46/33"
},
{
"input": "67 67\n-8 11 55 80 -26 -38 58 73 -48 -10 35 75 16 -84 55 -51 98 58 -28 98 77 81 51 -86 -46 68 -87 -80 -49 81 96 -97 -42 25 6 -8 -55 -25 93 -29 -33 -6 -26 -85 73 97 63 57 51 92 -6 -8 4 86 46 -45 36 -19 -71 1 71 39 97 -44 -34 -1 2 -46\n91 -32 -76 11 -40 91 -8 -100 73 80 47 82 24 0 -71 82 -93 38 -54 1 -55 -53 90 -86 0 10 -35 49 90 56 25 17 46 -43 13 16 -82 -33 64 -83 -56 22 12 -74 4 -68 85 -27 60 -28 -47 73 -93 69 -37 54 -3 90 -56 56 78 61 7 -79 48 -42 -10 -48",
"output": "-8/91"
},
{
"input": "69 69\n-7 38 -3 -22 65 -78 -65 -99 -76 63 0 -4 -78 -51 54 -61 -53 60 80 34 -96 99 -78 -96 21 -10 -86 33 -9 -81 -19 -2 -76 -3 -66 -80 -55 -21 -50 37 -86 -37 47 44 76 -39 54 -25 41 -86 -3 -25 -67 94 18 67 27 -5 -30 -69 2 -76 7 -97 -52 -35 -55 -20 92 2\n90 -94 37 41 -27 -54 96 -15 -60 -29 -75 -93 -57 62 48 -88 -99 -62 4 -9 85 33 65 -95 -30 16 -29 -89 -33 -83 -35 -21 53 -52 80 -40 76 -33 86 47 18 43 -67 -36 -99 -42 1 -94 -78 34 -41 73 96 2 -60 29 68 -96 -21 -61 -98 -67 1 40 85 55 66 -25 -50 -83",
"output": "-7/90"
},
{
"input": "17 17\n-54 59 -95 87 3 -27 -30 49 -87 74 45 78 36 60 -95 41 -53 -70\n-27 16 -67 -24 10 -73 -41 12 -52 53 -73 -17 -56 -74 -33 -8 100 -39",
"output": "2/1"
},
{
"input": "1 1\n36 -49\n-32 -40",
"output": "-9/8"
},
{
"input": "1 1\n1 1\n1 1",
"output": "1/1"
},
{
"input": "1 1\n-2 1\n4 1",
"output": "-1/2"
},
{
"input": "0 0\n2\n1",
"output": "2/1"
},
{
"input": "0 0\n4\n-3",
"output": "-4/3"
},
{
"input": "0 0\n2\n2",
"output": "1/1"
},
{
"input": "0 0\n17\n-10",
"output": "-17/10"
},
{
"input": "0 0\n-1\n2",
"output": "-1/2"
},
{
"input": "0 0\n1\n1",
"output": "1/1"
},
{
"input": "0 0\n50\n20",
"output": "5/2"
},
{
"input": "0 0\n20\n20",
"output": "1/1"
},
{
"input": "0 0\n4\n-2",
"output": "-2/1"
},
{
"input": "0 0\n4\n-6",
"output": "-2/3"
},
{
"input": "0 0\n1\n-2",
"output": "-1/2"
},
{
"input": "0 0\n4\n2",
"output": "2/1"
},
{
"input": "0 0\n2\n-4",
"output": "-1/2"
},
{
"input": "1 1\n4 1\n2 1",
"output": "2/1"
},
{
"input": "2 2\n-13 1 3\n6 3 2",
"output": "-13/6"
},
{
"input": "99 99\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2 2",
"output": "1/2"
},
{
"input": "0 0\n5\n5",
"output": "1/1"
},
{
"input": "0 0\n2\n-1",
"output": "-2/1"
}
] | 1,617,268,201 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 30 | 0 | import math
n,m=map(int,input().split())
l=list(map(int,input().split()))
q=list(map(int,input().split()))
if m>n:
print("0/1")
elif n>m:
if (l[0]>0 and q[0]>0) or (l[0]<0 and q[0]<0):
print("Infinite")
else:
print("-Infinite")
else:
a=abs(l[0])
b=abs(q[0])
while math.gcd(a,b) >1:
c=math.gcd(a,b)
a=a//c
b=b//c
if l[0]>0 and q[0]>0:
print(str(a)+"/"+str(b))
elif l[0]<0 and q[0]<0:
print(str(a)+"/"+str(b))
else:
print("-"+str(a)+"/"+str(b))
| Title: Limit
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given two polynomials:
- *P*(*x*)<==<=*a*0·*x**n*<=+<=*a*1·*x**n*<=-<=1<=+<=...<=+<=*a**n*<=-<=1·*x*<=+<=*a**n* and - *Q*(*x*)<==<=*b*0·*x**m*<=+<=*b*1·*x**m*<=-<=1<=+<=...<=+<=*b**m*<=-<=1·*x*<=+<=*b**m*.
Calculate limit .
Input Specification:
The first line contains two space-separated integers *n* and *m* (0<=≤<=*n*,<=*m*<=≤<=100) — degrees of polynomials *P*(*x*) and *Q*(*x*) correspondingly.
The second line contains *n*<=+<=1 space-separated integers — the factors of polynomial *P*(*x*): *a*0, *a*1, ..., *a**n*<=-<=1, *a**n* (<=-<=100<=≤<=*a**i*<=≤<=100,<=*a*0<=≠<=0).
The third line contains *m*<=+<=1 space-separated integers — the factors of polynomial *Q*(*x*): *b*0, *b*1, ..., *b**m*<=-<=1, *b**m* (<=-<=100<=≤<=*b**i*<=≤<=100,<=*b*0<=≠<=0).
Output Specification:
If the limit equals <=+<=∞, print "Infinity" (without quotes). If the limit equals <=-<=∞, print "-Infinity" (without the quotes).
If the value of the limit equals zero, print "0/1" (without the quotes).
Otherwise, print an irreducible fraction — the value of limit , in the format "p/q" (without the quotes), where *p* is the — numerator, *q* (*q*<=><=0) is the denominator of the fraction.
Demo Input:
['2 1\n1 1 1\n2 5\n', '1 0\n-1 3\n2\n', '0 1\n1\n1 0\n', '2 2\n2 1 6\n4 5 -7\n', '1 1\n9 0\n-5 2\n']
Demo Output:
['Infinity\n', '-Infinity\n', '0/1\n', '1/2\n', '-9/5\n']
Note:
Let's consider all samples:
1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c28febca257452afdfcbd6984ba8623911f9bdbc.png" style="max-width: 100.0%;max-height: 100.0%;"/> 1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/1e55ecd04e54a45e5e0092ec9a5c1ea03bb29255.png" style="max-width: 100.0%;max-height: 100.0%;"/> 1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/2c95fb684d373fcc1a481cfabeda4d5c2f3673ee.png" style="max-width: 100.0%;max-height: 100.0%;"/> 1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/4dc40cb8b3cd6375c42445366e50369649a2801a.png" style="max-width: 100.0%;max-height: 100.0%;"/> 1. <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/c6455aba35cfb3c4397505121d1f77afcd17c98e.png" style="max-width: 100.0%;max-height: 100.0%;"/>
You can learn more about the definition and properties of limits if you follow the link: http://en.wikipedia.org/wiki/Limit_of_a_function | ```python
import math
n,m=map(int,input().split())
l=list(map(int,input().split()))
q=list(map(int,input().split()))
if m>n:
print("0/1")
elif n>m:
if (l[0]>0 and q[0]>0) or (l[0]<0 and q[0]<0):
print("Infinite")
else:
print("-Infinite")
else:
a=abs(l[0])
b=abs(q[0])
while math.gcd(a,b) >1:
c=math.gcd(a,b)
a=a//c
b=b//c
if l[0]>0 and q[0]>0:
print(str(a)+"/"+str(b))
elif l[0]<0 and q[0]<0:
print(str(a)+"/"+str(b))
else:
print("-"+str(a)+"/"+str(b))
``` | 0 |
|
558 | C | Amr and Chemistry | PROGRAMMING | 1,900 | [
"brute force",
"graphs",
"greedy",
"math",
"shortest paths"
] | null | null | Amr loves Chemistry, and specially doing experiments. He is preparing for a new interesting experiment.
Amr has *n* different types of chemicals. Each chemical *i* has an initial volume of *a**i* liters. For this experiment, Amr has to mix all the chemicals together, but all the chemicals volumes must be equal first. So his task is to make all the chemicals volumes equal.
To do this, Amr can do two different kind of operations.
- Choose some chemical *i* and double its current volume so the new volume will be 2*a**i* - Choose some chemical *i* and divide its volume by two (integer division) so the new volume will be
Suppose that each chemical is contained in a vessel of infinite volume. Now Amr wonders what is the minimum number of operations required to make all the chemicals volumes equal? | The first line contains one number *n* (1<=≤<=*n*<=≤<=105), the number of chemicals.
The second line contains *n* space separated integers *a**i* (1<=≤<=*a**i*<=≤<=105), representing the initial volume of the *i*-th chemical in liters. | Output one integer the minimum number of operations required to make all the chemicals volumes equal. | [
"3\n4 8 2\n",
"3\n3 5 6\n"
] | [
"2",
"5"
] | In the first sample test, the optimal solution is to divide the second chemical volume by two, and multiply the third chemical volume by two to make all the volumes equal 4.
In the second sample test, the optimal solution is to divide the first chemical volume by two, and divide the second and the third chemical volumes by two twice to make all the volumes equal 1. | 1,500 | [
{
"input": "3\n4 8 2",
"output": "2"
},
{
"input": "3\n3 5 6",
"output": "5"
},
{
"input": "2\n50000 100000",
"output": "1"
},
{
"input": "2\n99999 99998",
"output": "2"
},
{
"input": "17\n1 2 4 8 16 32 64 128 256 512 1024 2048 4096 8192 16384 32768 65536",
"output": "72"
},
{
"input": "19\n1 2 3 4 6 8 16 32 64 128 256 512 1024 2048 4096 8192 16384 32768 65536",
"output": "90"
},
{
"input": "20\n1 2 3 4 6 8 16 20 32 64 128 256 512 1024 2048 4096 8192 16384 32768 65536",
"output": "99"
},
{
"input": "20\n1 2 3 4 6 8 16 32 64 128 256 512 1024 2048 4096 8192 16384 32768 65536 100000",
"output": "113"
},
{
"input": "7\n7 4096 8192 16384 32768 65536 100000",
"output": "51"
},
{
"input": "9\n7 4096 8192 16384 32768 65536 100000 100000 100000",
"output": "108"
},
{
"input": "10\n7 4096 8192 16384 32768 65536 100000 100000 100000 100000",
"output": "136"
},
{
"input": "7\n99994 99995 99996 99997 99998 99999 100000",
"output": "37"
},
{
"input": "16\n100000 50000 25000 12500 6250 3125 1562 781 390 195 97 48 24 12 6 3",
"output": "76"
},
{
"input": "17\n100000 99999 49999 24999 12499 6249 3124 1562 781 390 195 97 48 24 12 6 3",
"output": "87"
},
{
"input": "2\n99999 100000",
"output": "12"
},
{
"input": "1\n100000",
"output": "0"
}
] | 1,437,661,805 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 8 | 1,000 | 7,782,400 | L = 100001; n = int(input())
c = [0] * L; d = [0] * L; u = [0] * L; v = [0] * L
for i in list(map(int, input().split())):
x = i
t = 0
if x * 2 <= 100000:
u[x * 2] += 1
v[x * 2] += 1
while x > 0:
if x % 2:
u[x - 1] += t + 2
v[x - 1] += 1
c[x] += t
d[x] += 1
x //= 2
t += 1
c[x] += t
d[x] += 1
for i in range(1, L):
if v[i] == 0: continue
x = i
while x < L:
c[x] += u[i]
d[x] += v[i]
u[i] += v[i]
x *= 2
print(min(j for i, j in zip(d, c) if i == n)) | Title: Amr and Chemistry
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Amr loves Chemistry, and specially doing experiments. He is preparing for a new interesting experiment.
Amr has *n* different types of chemicals. Each chemical *i* has an initial volume of *a**i* liters. For this experiment, Amr has to mix all the chemicals together, but all the chemicals volumes must be equal first. So his task is to make all the chemicals volumes equal.
To do this, Amr can do two different kind of operations.
- Choose some chemical *i* and double its current volume so the new volume will be 2*a**i* - Choose some chemical *i* and divide its volume by two (integer division) so the new volume will be
Suppose that each chemical is contained in a vessel of infinite volume. Now Amr wonders what is the minimum number of operations required to make all the chemicals volumes equal?
Input Specification:
The first line contains one number *n* (1<=≤<=*n*<=≤<=105), the number of chemicals.
The second line contains *n* space separated integers *a**i* (1<=≤<=*a**i*<=≤<=105), representing the initial volume of the *i*-th chemical in liters.
Output Specification:
Output one integer the minimum number of operations required to make all the chemicals volumes equal.
Demo Input:
['3\n4 8 2\n', '3\n3 5 6\n']
Demo Output:
['2', '5']
Note:
In the first sample test, the optimal solution is to divide the second chemical volume by two, and multiply the third chemical volume by two to make all the volumes equal 4.
In the second sample test, the optimal solution is to divide the first chemical volume by two, and divide the second and the third chemical volumes by two twice to make all the volumes equal 1. | ```python
L = 100001; n = int(input())
c = [0] * L; d = [0] * L; u = [0] * L; v = [0] * L
for i in list(map(int, input().split())):
x = i
t = 0
if x * 2 <= 100000:
u[x * 2] += 1
v[x * 2] += 1
while x > 0:
if x % 2:
u[x - 1] += t + 2
v[x - 1] += 1
c[x] += t
d[x] += 1
x //= 2
t += 1
c[x] += t
d[x] += 1
for i in range(1, L):
if v[i] == 0: continue
x = i
while x < L:
c[x] += u[i]
d[x] += v[i]
u[i] += v[i]
x *= 2
print(min(j for i, j in zip(d, c) if i == n))
``` | 0 |
|
478 | B | Random Teams | PROGRAMMING | 1,300 | [
"combinatorics",
"constructive algorithms",
"greedy",
"math"
] | null | null | *n* participants of the competition were split into *m* teams in some manner so that each team has at least one participant. After the competition each pair of participants from the same team became friends.
Your task is to write a program that will find the minimum and the maximum number of pairs of friends that could have formed by the end of the competition. | The only line of input contains two integers *n* and *m*, separated by a single space (1<=≤<=*m*<=≤<=*n*<=≤<=109) — the number of participants and the number of teams respectively. | The only line of the output should contain two integers *k**min* and *k**max* — the minimum possible number of pairs of friends and the maximum possible number of pairs of friends respectively. | [
"5 1\n",
"3 2\n",
"6 3\n"
] | [
"10 10\n",
"1 1\n",
"3 6\n"
] | In the first sample all the participants get into one team, so there will be exactly ten pairs of friends.
In the second sample at any possible arrangement one team will always have two participants and the other team will always have one participant. Thus, the number of pairs of friends will always be equal to one.
In the third sample minimum number of newly formed friendships can be achieved if participants were split on teams consisting of 2 people, maximum number can be achieved if participants were split on teams of 1, 1 and 4 people. | 1,000 | [
{
"input": "5 1",
"output": "10 10"
},
{
"input": "3 2",
"output": "1 1"
},
{
"input": "6 3",
"output": "3 6"
},
{
"input": "5 3",
"output": "2 3"
},
{
"input": "10 2",
"output": "20 36"
},
{
"input": "10 6",
"output": "4 10"
},
{
"input": "1000000000 1",
"output": "499999999500000000 499999999500000000"
},
{
"input": "5000000 12",
"output": "1041664166668 12499942500066"
},
{
"input": "1833 195",
"output": "7722 1342341"
},
{
"input": "1000000000 1000000000",
"output": "0 0"
},
{
"input": "1000000000 1000000",
"output": "499500000000 499000500499500000"
},
{
"input": "1000000000 32170",
"output": "15541930838100 499967831017438365"
},
{
"input": "1000000 1000",
"output": "499500000 499000999500"
},
{
"input": "1234 1123",
"output": "111 6216"
},
{
"input": "599222887 298488",
"output": "601178656545 179355218158217800"
},
{
"input": "999999999 500000000",
"output": "499999999 124999999750000000"
},
{
"input": "1000000000 384842119",
"output": "845473643 189209609585784021"
},
{
"input": "1000000000 384842119",
"output": "845473643 189209609585784021"
},
{
"input": "1000000000 2",
"output": "249999999500000000 499999998500000001"
},
{
"input": "1000000000 999999999",
"output": "1 1"
},
{
"input": "38447 383",
"output": "1910550 724453080"
},
{
"input": "100000000 99999799",
"output": "201 20301"
},
{
"input": "1 1",
"output": "0 0"
},
{
"input": "2 1",
"output": "1 1"
},
{
"input": "2 2",
"output": "0 0"
},
{
"input": "10 10",
"output": "0 0"
}
] | 1,660,522,167 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 26 | 62 | 0 | n,m=map(int,input().split())
r=n//m
print(m*r*(r-1)//2+n%m*r,(n-m+1)*(n-m)//2) | Title: Random Teams
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
*n* participants of the competition were split into *m* teams in some manner so that each team has at least one participant. After the competition each pair of participants from the same team became friends.
Your task is to write a program that will find the minimum and the maximum number of pairs of friends that could have formed by the end of the competition.
Input Specification:
The only line of input contains two integers *n* and *m*, separated by a single space (1<=≤<=*m*<=≤<=*n*<=≤<=109) — the number of participants and the number of teams respectively.
Output Specification:
The only line of the output should contain two integers *k**min* and *k**max* — the minimum possible number of pairs of friends and the maximum possible number of pairs of friends respectively.
Demo Input:
['5 1\n', '3 2\n', '6 3\n']
Demo Output:
['10 10\n', '1 1\n', '3 6\n']
Note:
In the first sample all the participants get into one team, so there will be exactly ten pairs of friends.
In the second sample at any possible arrangement one team will always have two participants and the other team will always have one participant. Thus, the number of pairs of friends will always be equal to one.
In the third sample minimum number of newly formed friendships can be achieved if participants were split on teams consisting of 2 people, maximum number can be achieved if participants were split on teams of 1, 1 and 4 people. | ```python
n,m=map(int,input().split())
r=n//m
print(m*r*(r-1)//2+n%m*r,(n-m+1)*(n-m)//2)
``` | 3 |
|
281 | A | Word Capitalization | PROGRAMMING | 800 | [
"implementation",
"strings"
] | null | null | Capitalization is writing a word with its first letter as a capital letter. Your task is to capitalize the given word.
Note, that during capitalization all the letters except the first one remains unchanged. | A single line contains a non-empty word. This word consists of lowercase and uppercase English letters. The length of the word will not exceed 103. | Output the given word after capitalization. | [
"ApPLe\n",
"konjac\n"
] | [
"ApPLe\n",
"Konjac\n"
] | none | 500 | [
{
"input": "ApPLe",
"output": "ApPLe"
},
{
"input": "konjac",
"output": "Konjac"
},
{
"input": "a",
"output": "A"
},
{
"input": "A",
"output": "A"
},
{
"input": "z",
"output": "Z"
},
{
"input": "ABACABA",
"output": "ABACABA"
},
{
"input": "xYaPxPxHxGePfGtQySlNrLxSjDtNnTaRaEpAhPaQpWnDzMqGgRgEwJxGiBdZnMtHxFbObCaGiCeZkUqIgBhHtNvAqAlHpMnQhNeQbMyZrCdElVwHtKrPpJjIaHuIlYwHaRkAkUpPlOhNlBtXwDsKzPyHrPiUwNlXtTaPuMwTqYtJySgFoXvLiHbQwMjSvXsQfKhVlOxGdQkWjBhEyQvBjPoFkThNeRhTuIzFjInJtEfPjOlOsJpJuLgLzFnZmKvFgFrNsOnVqFcNiMfCqTpKnVyLwNqFiTySpWeTdFnWuTwDkRjVxNyQvTrOoEiExYiFaIrLoFmJfZcDkHuWjYfCeEqCvEsZiWnJaEmFbMjDvYwEeJeGcKbVbChGsIzNlExHzHiTlHcSaKxLuZxX",
"output": "XYaPxPxHxGePfGtQySlNrLxSjDtNnTaRaEpAhPaQpWnDzMqGgRgEwJxGiBdZnMtHxFbObCaGiCeZkUqIgBhHtNvAqAlHpMnQhNeQbMyZrCdElVwHtKrPpJjIaHuIlYwHaRkAkUpPlOhNlBtXwDsKzPyHrPiUwNlXtTaPuMwTqYtJySgFoXvLiHbQwMjSvXsQfKhVlOxGdQkWjBhEyQvBjPoFkThNeRhTuIzFjInJtEfPjOlOsJpJuLgLzFnZmKvFgFrNsOnVqFcNiMfCqTpKnVyLwNqFiTySpWeTdFnWuTwDkRjVxNyQvTrOoEiExYiFaIrLoFmJfZcDkHuWjYfCeEqCvEsZiWnJaEmFbMjDvYwEeJeGcKbVbChGsIzNlExHzHiTlHcSaKxLuZxX"
},
{
"input": "rZhIcQlXpNcPgXrOjTiOlMoTgXgIhCfMwZfWoFzGhEkQlOoMjIuShPlZfWkNnMyQfYdUhVgQuSmYoElEtZpDyHtOxXgCpWbZqSbYnPqBcNqRtPgCnJnAyIvNsAhRbNeVlMwZyRyJnFgIsCnSbOdLvUyIeOzQvRpMoMoHfNhHwKvTcHuYnYySfPmAiNwAiWdZnWlLvGfBbRbRrCrBqIgIdWkWiBsNyYkKdNxZdGaToSsDnXpRaGrKxBpQsCzBdQgZzBkGeHgGxNrIyQlSzWsTmSnZwOcHqQpNcQvJlPvKaPiQaMaYsQjUeCqQdCjPgUbDmWiJmNiXgExLqOcCtSwSePnUxIuZfIfBeWbEiVbXnUsPwWyAiXyRbZgKwOqFfCtQuKxEmVeRlAkOeXkO",
"output": "RZhIcQlXpNcPgXrOjTiOlMoTgXgIhCfMwZfWoFzGhEkQlOoMjIuShPlZfWkNnMyQfYdUhVgQuSmYoElEtZpDyHtOxXgCpWbZqSbYnPqBcNqRtPgCnJnAyIvNsAhRbNeVlMwZyRyJnFgIsCnSbOdLvUyIeOzQvRpMoMoHfNhHwKvTcHuYnYySfPmAiNwAiWdZnWlLvGfBbRbRrCrBqIgIdWkWiBsNyYkKdNxZdGaToSsDnXpRaGrKxBpQsCzBdQgZzBkGeHgGxNrIyQlSzWsTmSnZwOcHqQpNcQvJlPvKaPiQaMaYsQjUeCqQdCjPgUbDmWiJmNiXgExLqOcCtSwSePnUxIuZfIfBeWbEiVbXnUsPwWyAiXyRbZgKwOqFfCtQuKxEmVeRlAkOeXkO"
},
{
"input": "hDgZlUmLhYbLkLcNcKeOwJwTePbOvLaRvNzQbSbLsPeHqLhUqWtUbNdQfQqFfXeJqJwWuOrFnDdZiPxIkDyVmHbHvXfIlFqSgAcSyWbOlSlRuPhWdEpEzEeLnXwCtWuVcHaUeRgCiYsIvOaIgDnFuDbRnMoCmPrZfLeFpSjQaTfHgZwZvAzDuSeNwSoWuJvLqKqAuUxFaCxFfRcEjEsJpOfCtDiVrBqNsNwPuGoRgPzRpLpYnNyQxKaNnDnYiJrCrVcHlOxPiPcDbEgKfLwBjLhKcNeMgJhJmOiJvPfOaPaEuGqWvRbErKrIpDkEoQnKwJnTlStLyNsHyOjZfKoIjXwUvRrWpSyYhRpQdLqGmErAiNcGqAqIrTeTiMuPmCrEkHdBrLyCxPtYpRqD",
"output": "HDgZlUmLhYbLkLcNcKeOwJwTePbOvLaRvNzQbSbLsPeHqLhUqWtUbNdQfQqFfXeJqJwWuOrFnDdZiPxIkDyVmHbHvXfIlFqSgAcSyWbOlSlRuPhWdEpEzEeLnXwCtWuVcHaUeRgCiYsIvOaIgDnFuDbRnMoCmPrZfLeFpSjQaTfHgZwZvAzDuSeNwSoWuJvLqKqAuUxFaCxFfRcEjEsJpOfCtDiVrBqNsNwPuGoRgPzRpLpYnNyQxKaNnDnYiJrCrVcHlOxPiPcDbEgKfLwBjLhKcNeMgJhJmOiJvPfOaPaEuGqWvRbErKrIpDkEoQnKwJnTlStLyNsHyOjZfKoIjXwUvRrWpSyYhRpQdLqGmErAiNcGqAqIrTeTiMuPmCrEkHdBrLyCxPtYpRqD"
},
{
"input": "qUdLgGrJeGmIzIeZrCjUtBpYfRvNdXdRpGsThIsEmJjTiMqEwRxBeBaSxEuWrNvExKePjPnXhPzBpWnHiDhTvZhBuIjDnZpTcEkCvRkAcTmMuXhGgErWgFyGyToOyVwYlCuQpTfJkVdWmFyBqQhJjYtXrBbFdHzDlGsFbHmHbFgXgFhIyDhZyEqEiEwNxSeByBwLiVeSnCxIdHbGjOjJrZeVkOzGeMmQrJkVyGhDtCzOlPeAzGrBlWwEnAdUfVaIjNrRyJjCnHkUvFuKuKeKbLzSbEmUcXtVkZzXzKlOrPgQiDmCcCvIyAdBwOeUuLbRmScNcWxIkOkJuIsBxTrIqXhDzLcYdVtPgZdZfAxTmUtByGiTsJkSySjXdJvEwNmSmNoWsChPdAzJrBoW",
"output": "QUdLgGrJeGmIzIeZrCjUtBpYfRvNdXdRpGsThIsEmJjTiMqEwRxBeBaSxEuWrNvExKePjPnXhPzBpWnHiDhTvZhBuIjDnZpTcEkCvRkAcTmMuXhGgErWgFyGyToOyVwYlCuQpTfJkVdWmFyBqQhJjYtXrBbFdHzDlGsFbHmHbFgXgFhIyDhZyEqEiEwNxSeByBwLiVeSnCxIdHbGjOjJrZeVkOzGeMmQrJkVyGhDtCzOlPeAzGrBlWwEnAdUfVaIjNrRyJjCnHkUvFuKuKeKbLzSbEmUcXtVkZzXzKlOrPgQiDmCcCvIyAdBwOeUuLbRmScNcWxIkOkJuIsBxTrIqXhDzLcYdVtPgZdZfAxTmUtByGiTsJkSySjXdJvEwNmSmNoWsChPdAzJrBoW"
},
{
"input": "kHbApGoBcLmIwUlXkVgUmWzYeLoDbGaOkWbIuXoRwMfKuOoMzAoXrBoTvYxGrMbRjDuRxAbGsTnErIiHnHoLeRnTbFiRfDdOkNlWiAcOsChLdLqFqXlDpDoDtPxXqAmSvYgPvOcCpOlWtOjYwFkGkHuCaHwZcFdOfHjBmIxTeSiHkWjXyFcCtOlSuJsZkDxUgPeZkJwMmNpErUlBcGuMlJwKkWnOzFeFiSiPsEvMmQiCsYeHlLuHoMgBjFoZkXlObDkSoQcVyReTmRsFzRhTuIvCeBqVsQdQyTyZjStGrTyDcEcAgTgMiIcVkLbZbGvWeHtXwEqWkXfTcPyHhHjYwIeVxLyVmHmMkUsGiHmNnQuMsXaFyPpVqNrBhOiWmNkBbQuHvQdOjPjKiZcL",
"output": "KHbApGoBcLmIwUlXkVgUmWzYeLoDbGaOkWbIuXoRwMfKuOoMzAoXrBoTvYxGrMbRjDuRxAbGsTnErIiHnHoLeRnTbFiRfDdOkNlWiAcOsChLdLqFqXlDpDoDtPxXqAmSvYgPvOcCpOlWtOjYwFkGkHuCaHwZcFdOfHjBmIxTeSiHkWjXyFcCtOlSuJsZkDxUgPeZkJwMmNpErUlBcGuMlJwKkWnOzFeFiSiPsEvMmQiCsYeHlLuHoMgBjFoZkXlObDkSoQcVyReTmRsFzRhTuIvCeBqVsQdQyTyZjStGrTyDcEcAgTgMiIcVkLbZbGvWeHtXwEqWkXfTcPyHhHjYwIeVxLyVmHmMkUsGiHmNnQuMsXaFyPpVqNrBhOiWmNkBbQuHvQdOjPjKiZcL"
},
{
"input": "aHmRbLgNuWkLxLnWvUbYwTeZeYiOlLhTuOvKfLnVmCiPcMkSgVrYjZiLuRjCiXhAnVzVcTlVeJdBvPdDfFvHkTuIhCdBjEsXbVmGcLrPfNvRdFsZkSdNpYsJeIhIcNqSoLkOjUlYlDmXsOxPbQtIoUxFjGnRtBhFaJvBeEzHsAtVoQbAfYjJqReBiKeUwRqYrUjPjBoHkOkPzDwEwUgTxQxAvKzUpMhKyOhPmEhYhItQwPeKsKaKlUhGuMcTtSwFtXfJsDsFlTtOjVvVfGtBtFlQyIcBaMsPaJlPqUcUvLmReZiFbXxVtRhTzJkLkAjVqTyVuFeKlTyQgUzMsXjOxQnVfTaWmThEnEoIhZeZdStBkKeLpAhJnFoJvQyGwDiStLjEwGfZwBuWsEfC",
"output": "AHmRbLgNuWkLxLnWvUbYwTeZeYiOlLhTuOvKfLnVmCiPcMkSgVrYjZiLuRjCiXhAnVzVcTlVeJdBvPdDfFvHkTuIhCdBjEsXbVmGcLrPfNvRdFsZkSdNpYsJeIhIcNqSoLkOjUlYlDmXsOxPbQtIoUxFjGnRtBhFaJvBeEzHsAtVoQbAfYjJqReBiKeUwRqYrUjPjBoHkOkPzDwEwUgTxQxAvKzUpMhKyOhPmEhYhItQwPeKsKaKlUhGuMcTtSwFtXfJsDsFlTtOjVvVfGtBtFlQyIcBaMsPaJlPqUcUvLmReZiFbXxVtRhTzJkLkAjVqTyVuFeKlTyQgUzMsXjOxQnVfTaWmThEnEoIhZeZdStBkKeLpAhJnFoJvQyGwDiStLjEwGfZwBuWsEfC"
},
{
"input": "sLlZkDiDmEdNaXuUuJwHqYvRtOdGfTiTpEpAoSqAbJaChOiCvHgSwZwEuPkMmXiLcKdXqSsEyViEbZpZsHeZpTuXoGcRmOiQfBfApPjDqSqElWeSeOhUyWjLyNoRuYeGfGwNqUsQoTyVvWeNgNdZfDxGwGfLsDjIdInSqDlMuNvFaHbScZkTlVwNcJpEjMaPaOtFgJjBjOcLlLmDnQrShIrJhOcUmPnZhTxNeClQsZaEaVaReLyQpLwEqJpUwYhLiRzCzKfOoFeTiXzPiNbOsZaZaLgCiNnMkBcFwGgAwPeNyTxJcCtBgXcToKlWaWcBaIvBpNxPeClQlWeQqRyEtAkJdBtSrFdDvAbUlKyLdCuTtXxFvRcKnYnWzVdYqDeCmOqPxUaFjQdTdCtN",
"output": "SLlZkDiDmEdNaXuUuJwHqYvRtOdGfTiTpEpAoSqAbJaChOiCvHgSwZwEuPkMmXiLcKdXqSsEyViEbZpZsHeZpTuXoGcRmOiQfBfApPjDqSqElWeSeOhUyWjLyNoRuYeGfGwNqUsQoTyVvWeNgNdZfDxGwGfLsDjIdInSqDlMuNvFaHbScZkTlVwNcJpEjMaPaOtFgJjBjOcLlLmDnQrShIrJhOcUmPnZhTxNeClQsZaEaVaReLyQpLwEqJpUwYhLiRzCzKfOoFeTiXzPiNbOsZaZaLgCiNnMkBcFwGgAwPeNyTxJcCtBgXcToKlWaWcBaIvBpNxPeClQlWeQqRyEtAkJdBtSrFdDvAbUlKyLdCuTtXxFvRcKnYnWzVdYqDeCmOqPxUaFjQdTdCtN"
},
{
"input": "iRuStKvVhJdJbQwRoIuLiVdTpKaOqKfYlYwAzIpPtUwUtMeKyCaOlXmVrKwWeImYmVuXdLkRlHwFxKqZbZtTzNgOzDbGqTfZnKmUzAcIjDcEmQgYyFbEfWzRpKvCkDmAqDiIiRcLvMxWaJqCgYqXgIcLdNaZlBnXtJyKaMnEaWfXfXwTbDnAiYnWqKbAtDpYdUbZrCzWgRnHzYxFgCdDbOkAgTqBuLqMeStHcDxGnVhSgMzVeTaZoTfLjMxQfRuPcFqVlRyYdHyOdJsDoCeWrUuJyIiAqHwHyVpEeEoMaJwAoUfPtBeJqGhMaHiBjKwAlXoZpUsDhHgMxBkVbLcEvNtJbGnPsUwAvXrAkTlXwYvEnOpNeWyIkRnEnTrIyAcLkRgMyYcKrGiDaAyE",
"output": "IRuStKvVhJdJbQwRoIuLiVdTpKaOqKfYlYwAzIpPtUwUtMeKyCaOlXmVrKwWeImYmVuXdLkRlHwFxKqZbZtTzNgOzDbGqTfZnKmUzAcIjDcEmQgYyFbEfWzRpKvCkDmAqDiIiRcLvMxWaJqCgYqXgIcLdNaZlBnXtJyKaMnEaWfXfXwTbDnAiYnWqKbAtDpYdUbZrCzWgRnHzYxFgCdDbOkAgTqBuLqMeStHcDxGnVhSgMzVeTaZoTfLjMxQfRuPcFqVlRyYdHyOdJsDoCeWrUuJyIiAqHwHyVpEeEoMaJwAoUfPtBeJqGhMaHiBjKwAlXoZpUsDhHgMxBkVbLcEvNtJbGnPsUwAvXrAkTlXwYvEnOpNeWyIkRnEnTrIyAcLkRgMyYcKrGiDaAyE"
},
{
"input": "cRtJkOxHzUbJcDdHzJtLbVmSoWuHoTkVrPqQaVmXeBrHxJbQfNrQbAaMrEhVdQnPxNyCjErKxPoEdWkVrBbDeNmEgBxYiBtWdAfHiLuSwIxJuHpSkAxPoYdNkGoLySsNhUmGoZhDzAfWhJdPlJzQkZbOnMtTkClIoCqOlIcJcMlGjUyOiEmHdYfIcPtTgQhLlLcPqQjAnQnUzHpCaQsCnYgQsBcJrQwBnWsIwFfSfGuYgTzQmShFpKqEeRlRkVfMuZbUsDoFoPrNuNwTtJqFkRiXxPvKyElDzLoUnIwAaBaOiNxMpEvPzSpGpFhMtGhGdJrFnZmNiMcUfMtBnDuUnXqDcMsNyGoLwLeNnLfRsIwRfBtXkHrFcPsLdXaAoYaDzYnZuQeVcZrElWmP",
"output": "CRtJkOxHzUbJcDdHzJtLbVmSoWuHoTkVrPqQaVmXeBrHxJbQfNrQbAaMrEhVdQnPxNyCjErKxPoEdWkVrBbDeNmEgBxYiBtWdAfHiLuSwIxJuHpSkAxPoYdNkGoLySsNhUmGoZhDzAfWhJdPlJzQkZbOnMtTkClIoCqOlIcJcMlGjUyOiEmHdYfIcPtTgQhLlLcPqQjAnQnUzHpCaQsCnYgQsBcJrQwBnWsIwFfSfGuYgTzQmShFpKqEeRlRkVfMuZbUsDoFoPrNuNwTtJqFkRiXxPvKyElDzLoUnIwAaBaOiNxMpEvPzSpGpFhMtGhGdJrFnZmNiMcUfMtBnDuUnXqDcMsNyGoLwLeNnLfRsIwRfBtXkHrFcPsLdXaAoYaDzYnZuQeVcZrElWmP"
},
{
"input": "wVaCsGxZrBbFnTbKsCoYlAvUkIpBaYpYmJkMlPwCaFvUkDxAiJgIqWsFqZlFvTtAnGzEwXbYiBdFfFxRiDoUkLmRfAwOlKeOlKgXdUnVqLkTuXtNdQpBpXtLvZxWoBeNePyHcWmZyRiUkPlRqYiQdGeXwOhHbCqVjDcEvJmBkRwWnMqPjXpUsIyXqGjHsEsDwZiFpIbTkQaUlUeFxMwJzSaHdHnDhLaLdTuYgFuJsEcMmDvXyPjKsSeBaRwNtPuOuBtNeOhQdVgKzPzOdYtPjPfDzQzHoWcYjFbSvRgGdGsCmGnQsErToBkCwGeQaCbBpYkLhHxTbUvRnJpZtXjKrHdRiUmUbSlJyGaLnWsCrJbBnSjFaZrIzIrThCmGhQcMsTtOxCuUcRaEyPaG",
"output": "WVaCsGxZrBbFnTbKsCoYlAvUkIpBaYpYmJkMlPwCaFvUkDxAiJgIqWsFqZlFvTtAnGzEwXbYiBdFfFxRiDoUkLmRfAwOlKeOlKgXdUnVqLkTuXtNdQpBpXtLvZxWoBeNePyHcWmZyRiUkPlRqYiQdGeXwOhHbCqVjDcEvJmBkRwWnMqPjXpUsIyXqGjHsEsDwZiFpIbTkQaUlUeFxMwJzSaHdHnDhLaLdTuYgFuJsEcMmDvXyPjKsSeBaRwNtPuOuBtNeOhQdVgKzPzOdYtPjPfDzQzHoWcYjFbSvRgGdGsCmGnQsErToBkCwGeQaCbBpYkLhHxTbUvRnJpZtXjKrHdRiUmUbSlJyGaLnWsCrJbBnSjFaZrIzIrThCmGhQcMsTtOxCuUcRaEyPaG"
},
{
"input": "kEiLxLmPjGzNoGkJdBlAfXhThYhMsHmZoZbGyCvNiUoLoZdAxUbGyQiEfXvPzZzJrPbEcMpHsMjIkRrVvDvQtHuKmXvGpQtXbPzJpFjJdUgWcPdFxLjLtXgVpEiFhImHnKkGiWnZbJqRjCyEwHsNbYfYfTyBaEuKlCtWnOqHmIgGrFmQiYrBnLiFcGuZxXlMfEuVoCxPkVrQvZoIpEhKsYtXrPxLcSfQqXsWaDgVlOnAzUvAhOhMrJfGtWcOwQfRjPmGhDyAeXrNqBvEiDfCiIvWxPjTwPlXpVsMjVjUnCkXgBuWnZaDyJpWkCfBrWnHxMhJgItHdRqNrQaEeRjAuUwRkUdRhEeGlSqVqGmOjNcUhFfXjCmWzBrGvIuZpRyWkWiLyUwFpYjNmNfV",
"output": "KEiLxLmPjGzNoGkJdBlAfXhThYhMsHmZoZbGyCvNiUoLoZdAxUbGyQiEfXvPzZzJrPbEcMpHsMjIkRrVvDvQtHuKmXvGpQtXbPzJpFjJdUgWcPdFxLjLtXgVpEiFhImHnKkGiWnZbJqRjCyEwHsNbYfYfTyBaEuKlCtWnOqHmIgGrFmQiYrBnLiFcGuZxXlMfEuVoCxPkVrQvZoIpEhKsYtXrPxLcSfQqXsWaDgVlOnAzUvAhOhMrJfGtWcOwQfRjPmGhDyAeXrNqBvEiDfCiIvWxPjTwPlXpVsMjVjUnCkXgBuWnZaDyJpWkCfBrWnHxMhJgItHdRqNrQaEeRjAuUwRkUdRhEeGlSqVqGmOjNcUhFfXjCmWzBrGvIuZpRyWkWiLyUwFpYjNmNfV"
},
{
"input": "eIhDoLmDeReKqXsHcVgFxUqNfScAiQnFrTlCgSuTtXiYvBxKaPaGvUeYfSgHqEaWcHxKpFaSlCxGqAmNeFcIzFcZsBiVoZhUjXaDaIcKoBzYdIlEnKfScRqSkYpPtVsVhXsBwUsUfAqRoCkBxWbHgDiCkRtPvUwVgDjOzObYwNiQwXlGnAqEkHdSqLgUkOdZiWaHqQnOhUnDhIzCiQtVcJlGoRfLuVlFjWqSuMsLgLwOdZvKtWdRuRqDoBoInKqPbJdXpIqLtFlMlDaWgSiKbFpCxOnQeNeQzXeKsBzIjCyPxCmBnYuHzQoYxZgGzSgGtZiTeQmUeWlNzZeKiJbQmEjIiDhPeSyZlNdHpZnIkPdJzSeJpPiXxToKyBjJfPwNzZpWzIzGySqPxLtI",
"output": "EIhDoLmDeReKqXsHcVgFxUqNfScAiQnFrTlCgSuTtXiYvBxKaPaGvUeYfSgHqEaWcHxKpFaSlCxGqAmNeFcIzFcZsBiVoZhUjXaDaIcKoBzYdIlEnKfScRqSkYpPtVsVhXsBwUsUfAqRoCkBxWbHgDiCkRtPvUwVgDjOzObYwNiQwXlGnAqEkHdSqLgUkOdZiWaHqQnOhUnDhIzCiQtVcJlGoRfLuVlFjWqSuMsLgLwOdZvKtWdRuRqDoBoInKqPbJdXpIqLtFlMlDaWgSiKbFpCxOnQeNeQzXeKsBzIjCyPxCmBnYuHzQoYxZgGzSgGtZiTeQmUeWlNzZeKiJbQmEjIiDhPeSyZlNdHpZnIkPdJzSeJpPiXxToKyBjJfPwNzZpWzIzGySqPxLtI"
},
{
"input": "uOoQzIeTwYeKpJtGoUdNiXbPgEwVsZkAnJcArHxIpEnEhZwQhZvAiOuLeMkVqLeDsAyKeYgFxGmRoLaRsZjAeXgNfYhBkHeDrHdPuTuYhKmDlAvYzYxCdYgYfVaYlGeVqTeSfBxQePbQrKsTaIkGzMjFrQlJuYaMxWpQkLdEcDsIiMnHnDtThRvAcKyGwBsHqKdXpJfIeTeZtYjFbMeUoXoXzGrShTwSwBpQlKeDrZdCjRqNtXoTsIzBkWbMsObTtDvYaPhUeLeHqHeMpZmTaCcIqXzAmGnPfNdDaFhOqWqDrWuFiBpRjZrQmAdViOuMbFfRyXyWfHgRkGpPnDrEqQcEmHcKpEvWlBrOtJbUaXbThJaSxCbVoGvTmHvZrHvXpCvLaYbRiHzYuQyX",
"output": "UOoQzIeTwYeKpJtGoUdNiXbPgEwVsZkAnJcArHxIpEnEhZwQhZvAiOuLeMkVqLeDsAyKeYgFxGmRoLaRsZjAeXgNfYhBkHeDrHdPuTuYhKmDlAvYzYxCdYgYfVaYlGeVqTeSfBxQePbQrKsTaIkGzMjFrQlJuYaMxWpQkLdEcDsIiMnHnDtThRvAcKyGwBsHqKdXpJfIeTeZtYjFbMeUoXoXzGrShTwSwBpQlKeDrZdCjRqNtXoTsIzBkWbMsObTtDvYaPhUeLeHqHeMpZmTaCcIqXzAmGnPfNdDaFhOqWqDrWuFiBpRjZrQmAdViOuMbFfRyXyWfHgRkGpPnDrEqQcEmHcKpEvWlBrOtJbUaXbThJaSxCbVoGvTmHvZrHvXpCvLaYbRiHzYuQyX"
},
{
"input": "lZqBqKeGvNdSeYuWxRiVnFtYbKuJwQtUcKnVtQhAlOeUzMaAuTaEnDdPfDcNyHgEoBmYjZyFePeJrRiKyAzFnBfAuGiUyLrIeLrNhBeBdVcEeKgCcBrQzDsPwGcNnZvTsEaYmFfMeOmMdNuZbUtDoQoNcGwDqEkEjIdQaPwAxJbXeNxOgKgXoEbZiIsVkRrNpNyAkLeHkNfEpLuQvEcMbIoGaDzXbEtNsLgGfOkZaFiUsOvEjVeCaMcZqMzKeAdXxJsVeCrZaFpJtZxInQxFaSmGgSsVyGeLlFgFqTpIbAvPkIfJrVcJeBxSdEvPyVwIjHpYrLrKqLnAmCuGmPoZrSbOtGaLaTmBmSuUyAmAsRiMqOtRjJhPhAfXaJnTpLbFqPmJgFcBxImTqIiJ",
"output": "LZqBqKeGvNdSeYuWxRiVnFtYbKuJwQtUcKnVtQhAlOeUzMaAuTaEnDdPfDcNyHgEoBmYjZyFePeJrRiKyAzFnBfAuGiUyLrIeLrNhBeBdVcEeKgCcBrQzDsPwGcNnZvTsEaYmFfMeOmMdNuZbUtDoQoNcGwDqEkEjIdQaPwAxJbXeNxOgKgXoEbZiIsVkRrNpNyAkLeHkNfEpLuQvEcMbIoGaDzXbEtNsLgGfOkZaFiUsOvEjVeCaMcZqMzKeAdXxJsVeCrZaFpJtZxInQxFaSmGgSsVyGeLlFgFqTpIbAvPkIfJrVcJeBxSdEvPyVwIjHpYrLrKqLnAmCuGmPoZrSbOtGaLaTmBmSuUyAmAsRiMqOtRjJhPhAfXaJnTpLbFqPmJgFcBxImTqIiJ"
},
{
"input": "P",
"output": "P"
},
{
"input": "Xyzzy",
"output": "Xyzzy"
},
{
"input": "Zzz",
"output": "Zzz"
},
{
"input": "Zp",
"output": "Zp"
}
] | 1,695,933,396 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 6 | 62 | 0 | my_word = input()
if my_word[0].islower():
my_word = my_word.replace(my_word[0], my_word[0].upper())
print(my_word)
| Title: Word Capitalization
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Capitalization is writing a word with its first letter as a capital letter. Your task is to capitalize the given word.
Note, that during capitalization all the letters except the first one remains unchanged.
Input Specification:
A single line contains a non-empty word. This word consists of lowercase and uppercase English letters. The length of the word will not exceed 103.
Output Specification:
Output the given word after capitalization.
Demo Input:
['ApPLe\n', 'konjac\n']
Demo Output:
['ApPLe\n', 'Konjac\n']
Note:
none | ```python
my_word = input()
if my_word[0].islower():
my_word = my_word.replace(my_word[0], my_word[0].upper())
print(my_word)
``` | 0 |
|
540 | A | Combination Lock | PROGRAMMING | 800 | [
"implementation"
] | null | null | Scrooge McDuck keeps his most treasured savings in a home safe with a combination lock. Each time he wants to put there the treasures that he's earned fair and square, he has to open the lock.
The combination lock is represented by *n* rotating disks with digits from 0 to 9 written on them. Scrooge McDuck has to turn some disks so that the combination of digits on the disks forms a secret combination. In one move, he can rotate one disk one digit forwards or backwards. In particular, in one move he can go from digit 0 to digit 9 and vice versa. What minimum number of actions does he need for that? | The first line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of disks on the combination lock.
The second line contains a string of *n* digits — the original state of the disks.
The third line contains a string of *n* digits — Scrooge McDuck's combination that opens the lock. | Print a single integer — the minimum number of moves Scrooge McDuck needs to open the lock. | [
"5\n82195\n64723\n"
] | [
"13\n"
] | In the sample he needs 13 moves:
- 1 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/b8967f65a723782358b93eff9ce69f336817cf70.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 2 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/07fa58573ece0d32c4d555e498d2b24d2f70f36a.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 3 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/cc2275d9252aae35a6867c6a5b4ba7596e9a7626.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 4 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/b100aea470fcaaab4e9529b234ba0d7875943c10.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 5 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/eb2cbe4324cebca65b85816262a85e473cd65967.png" style="max-width: 100.0%;max-height: 100.0%;"/> | 500 | [
{
"input": "5\n82195\n64723",
"output": "13"
},
{
"input": "12\n102021090898\n010212908089",
"output": "16"
},
{
"input": "1\n8\n1",
"output": "3"
},
{
"input": "2\n83\n57",
"output": "7"
},
{
"input": "10\n0728592530\n1362615763",
"output": "27"
},
{
"input": "100\n4176196363694273682807653052945037727131821799902563705176501742060696655282954944720643131654235909\n3459912084922154505910287499879975659298239371519889866585472674423008837878123067103005344986554746",
"output": "245"
},
{
"input": "1\n8\n1",
"output": "3"
},
{
"input": "2\n83\n57",
"output": "7"
},
{
"input": "3\n607\n684",
"output": "5"
},
{
"input": "4\n0809\n0636",
"output": "8"
},
{
"input": "5\n84284\n08941",
"output": "16"
},
{
"input": "25\n8037856825987124762280548\n9519431339078678836940020",
"output": "72"
},
{
"input": "125\n23269567683904664184142384849516523616863461607751021071772615078579713054027902974007001544768640273491193035874486891541257\n47635110303703399505805044019026243695451609639556649012447370081552870340011971572363458960190590266459684717415349529509024",
"output": "305"
},
{
"input": "5\n84284\n08941",
"output": "16"
},
{
"input": "25\n8037856825987124762285484\n9519431339078678836940202",
"output": "74"
},
{
"input": "125\n23269567689466418414238845152168634610771021717726157879713054270294007001544768647391193035874486891412573389247025830678706\n47635110307339950580504010224954516093956649124473708152870340117152363458960190596659684717415349529090241694059599629136831",
"output": "357"
},
{
"input": "5\n84284\n08941",
"output": "16"
},
{
"input": "25\n8378525987476228048406972\n9194339078883694020217816",
"output": "55"
},
{
"input": "125\n23269576839046618414238484916523616863461607750210717761078579713054027902974007015447686027349193035874486891541257338624472\n47635103037033950580504401926243695451609639556490124437081552870340011971572363489601905026645984717415349529509024169604599",
"output": "274"
},
{
"input": "1\n0\n0",
"output": "0"
},
{
"input": "1\n7\n7",
"output": "0"
},
{
"input": "1\n0\n5",
"output": "5"
},
{
"input": "1\n2\n7",
"output": "5"
},
{
"input": "1\n7\n9",
"output": "2"
},
{
"input": "1\n9\n7",
"output": "2"
},
{
"input": "1\n2\n9",
"output": "3"
},
{
"input": "1\n9\n2",
"output": "3"
},
{
"input": "25\n3164978461316464614169874\n9413979197249127496597357",
"output": "66"
},
{
"input": "4\n9999\n9999",
"output": "0"
},
{
"input": "2\n11\n11",
"output": "0"
}
] | 1,609,711,825 | 2,147,483,647 | Python 3 | OK | TESTS | 43 | 108 | 307,200 | def main():
n = int(input())
o = [int(c) for c in input()]
a = [int(c) for c in input()]
moves = 0
for i in range(n):
x, y = (o[i], a[i]) if o[i] > a[i] else (a[i], o[i])
moves += min(x - y, y + 10 - x)
print(moves)
if __name__ == "__main__":
main()
| Title: Combination Lock
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Scrooge McDuck keeps his most treasured savings in a home safe with a combination lock. Each time he wants to put there the treasures that he's earned fair and square, he has to open the lock.
The combination lock is represented by *n* rotating disks with digits from 0 to 9 written on them. Scrooge McDuck has to turn some disks so that the combination of digits on the disks forms a secret combination. In one move, he can rotate one disk one digit forwards or backwards. In particular, in one move he can go from digit 0 to digit 9 and vice versa. What minimum number of actions does he need for that?
Input Specification:
The first line contains a single integer *n* (1<=≤<=*n*<=≤<=1000) — the number of disks on the combination lock.
The second line contains a string of *n* digits — the original state of the disks.
The third line contains a string of *n* digits — Scrooge McDuck's combination that opens the lock.
Output Specification:
Print a single integer — the minimum number of moves Scrooge McDuck needs to open the lock.
Demo Input:
['5\n82195\n64723\n']
Demo Output:
['13\n']
Note:
In the sample he needs 13 moves:
- 1 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/b8967f65a723782358b93eff9ce69f336817cf70.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 2 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/07fa58573ece0d32c4d555e498d2b24d2f70f36a.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 3 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/cc2275d9252aae35a6867c6a5b4ba7596e9a7626.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 4 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/b100aea470fcaaab4e9529b234ba0d7875943c10.png" style="max-width: 100.0%;max-height: 100.0%;"/> - 5 disk: <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/eb2cbe4324cebca65b85816262a85e473cd65967.png" style="max-width: 100.0%;max-height: 100.0%;"/> | ```python
def main():
n = int(input())
o = [int(c) for c in input()]
a = [int(c) for c in input()]
moves = 0
for i in range(n):
x, y = (o[i], a[i]) if o[i] > a[i] else (a[i], o[i])
moves += min(x - y, y + 10 - x)
print(moves)
if __name__ == "__main__":
main()
``` | 3 |
|
68 | A | Irrational problem | PROGRAMMING | 1,100 | [
"implementation",
"number theory"
] | A. Irrational problem | 2 | 256 | Little Petya was given this problem for homework:
You are given function (here represents the operation of taking the remainder). His task is to count the number of integers *x* in range [*a*;*b*] with property *f*(*x*)<==<=*x*.
It is a pity that Petya forgot the order in which the remainders should be taken and wrote down only 4 numbers. Each of 24 possible orders of taking the remainder has equal probability of being chosen. For example, if Petya has numbers 1, 2, 3, 4 then he can take remainders in that order or first take remainder modulo 4, then modulo 2, 3, 1. There also are 22 other permutations of these numbers that represent orders in which remainder can be taken. In this problem 4 numbers wrote down by Petya will be pairwise distinct.
Now it is impossible for Petya to complete the task given by teacher but just for fun he decided to find the number of integers with property that probability that *f*(*x*)<==<=*x* is not less than 31.4159265352718281828459045%. In other words, Petya will pick up the number *x* if there exist at least 7 permutations of numbers *p*1,<=*p*2,<=*p*3,<=*p*4, for which *f*(*x*)<==<=*x*. | First line of the input will contain 6 integers, separated by spaces: *p*1,<=*p*2,<=*p*3,<=*p*4,<=*a*,<=*b* (1<=≤<=*p*1,<=*p*2,<=*p*3,<=*p*4<=≤<=1000,<=0<=≤<=*a*<=≤<=*b*<=≤<=31415).
It is guaranteed that numbers *p*1,<=*p*2,<=*p*3,<=*p*4 will be pairwise distinct. | Output the number of integers in the given range that have the given property. | [
"2 7 1 8 2 8\n",
"20 30 40 50 0 100\n",
"31 41 59 26 17 43\n"
] | [
"0\n",
"20\n",
"9\n"
] | none | 500 | [
{
"input": "2 7 1 8 2 8",
"output": "0"
},
{
"input": "20 30 40 50 0 100",
"output": "20"
},
{
"input": "31 41 59 26 17 43",
"output": "9"
},
{
"input": "1 2 3 4 0 0",
"output": "1"
},
{
"input": "1 2 3 4 1 1",
"output": "0"
},
{
"input": "1 2 999 1000 30 40",
"output": "0"
},
{
"input": "17 18 19 20 17 20",
"output": "0"
},
{
"input": "17 18 19 20 16 20",
"output": "1"
},
{
"input": "41 449 328 474 150 709",
"output": "0"
},
{
"input": "467 329 936 440 117 700",
"output": "212"
},
{
"input": "258 811 952 491 931 993",
"output": "0"
},
{
"input": "823 431 359 590 153 899",
"output": "206"
},
{
"input": "292 370 404 698 699 876",
"output": "0"
},
{
"input": "442 705 757 527 868 893",
"output": "0"
},
{
"input": "642 273 18 885 675 788",
"output": "0"
},
{
"input": "291 303 656 660 126 704",
"output": "165"
},
{
"input": "225 862 522 617 630 725",
"output": "0"
},
{
"input": "17 847 715 732 502 778",
"output": "0"
},
{
"input": "41 449 328 474 15724 19169",
"output": "0"
},
{
"input": "467 329 936 440 5705 28145",
"output": "0"
},
{
"input": "258 811 952 491 2995 11942",
"output": "0"
},
{
"input": "823 431 359 590 153 3902",
"output": "206"
},
{
"input": "292 370 404 698 19718 19895",
"output": "0"
},
{
"input": "442 705 757 527 1869 19912",
"output": "0"
},
{
"input": "642 273 18 885 23811 28703",
"output": "0"
},
{
"input": "291 303 656 660 7711 15141",
"output": "0"
},
{
"input": "225 862 522 617 1246 1341",
"output": "0"
},
{
"input": "17 847 715 732 778 27529",
"output": "0"
},
{
"input": "997 998 999 1000 0 31415",
"output": "997"
},
{
"input": "1 2 3 4 0 31415",
"output": "1"
},
{
"input": "541 931 822 948 131 193",
"output": "63"
},
{
"input": "956 800 909 916 89 194",
"output": "106"
},
{
"input": "735 794 942 991 419 490",
"output": "72"
},
{
"input": "818 926 827 575 153 395",
"output": "243"
},
{
"input": "792 858 887 679 179 356",
"output": "178"
},
{
"input": "937 683 742 515 366 373",
"output": "8"
},
{
"input": "616 747 501 875 146 264",
"output": "119"
},
{
"input": "760 773 638 655 111 196",
"output": "86"
},
{
"input": "697 855 997 589 97 192",
"output": "96"
},
{
"input": "998 834 706 722 277 475",
"output": "199"
},
{
"input": "100 101 102 103 10 20",
"output": "11"
}
] | 1,559,723,779 | 2,147,483,647 | PyPy 3 | OK | TESTS | 41 | 434 | 1,024,000 | import sys,math,string,bisect
input=sys.stdin.readline
from collections import deque
L=lambda : list(map(int,input().split()))
Ls=lambda : list(input().split())
M=lambda : map(int,input().split())
I=lambda :int(input())
p1,p2,p3,p4,b,a=M()
k=min(p1,p2,p3,p4)
c=0
for i in range(b,min(k,a+1)):
c+=1
print(c)
| Title: Irrational problem
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Little Petya was given this problem for homework:
You are given function (here represents the operation of taking the remainder). His task is to count the number of integers *x* in range [*a*;*b*] with property *f*(*x*)<==<=*x*.
It is a pity that Petya forgot the order in which the remainders should be taken and wrote down only 4 numbers. Each of 24 possible orders of taking the remainder has equal probability of being chosen. For example, if Petya has numbers 1, 2, 3, 4 then he can take remainders in that order or first take remainder modulo 4, then modulo 2, 3, 1. There also are 22 other permutations of these numbers that represent orders in which remainder can be taken. In this problem 4 numbers wrote down by Petya will be pairwise distinct.
Now it is impossible for Petya to complete the task given by teacher but just for fun he decided to find the number of integers with property that probability that *f*(*x*)<==<=*x* is not less than 31.4159265352718281828459045%. In other words, Petya will pick up the number *x* if there exist at least 7 permutations of numbers *p*1,<=*p*2,<=*p*3,<=*p*4, for which *f*(*x*)<==<=*x*.
Input Specification:
First line of the input will contain 6 integers, separated by spaces: *p*1,<=*p*2,<=*p*3,<=*p*4,<=*a*,<=*b* (1<=≤<=*p*1,<=*p*2,<=*p*3,<=*p*4<=≤<=1000,<=0<=≤<=*a*<=≤<=*b*<=≤<=31415).
It is guaranteed that numbers *p*1,<=*p*2,<=*p*3,<=*p*4 will be pairwise distinct.
Output Specification:
Output the number of integers in the given range that have the given property.
Demo Input:
['2 7 1 8 2 8\n', '20 30 40 50 0 100\n', '31 41 59 26 17 43\n']
Demo Output:
['0\n', '20\n', '9\n']
Note:
none | ```python
import sys,math,string,bisect
input=sys.stdin.readline
from collections import deque
L=lambda : list(map(int,input().split()))
Ls=lambda : list(input().split())
M=lambda : map(int,input().split())
I=lambda :int(input())
p1,p2,p3,p4,b,a=M()
k=min(p1,p2,p3,p4)
c=0
for i in range(b,min(k,a+1)):
c+=1
print(c)
``` | 3.889593 |
109 | A | Lucky Sum of Digits | PROGRAMMING | 1,000 | [
"brute force",
"implementation"
] | A. Lucky Sum of Digits | 2 | 256 | Petya loves lucky numbers. We all know that lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Petya wonders eagerly what minimum lucky number has the sum of digits equal to *n*. Help him cope with the task. | The single line contains an integer *n* (1<=≤<=*n*<=≤<=106) — the sum of digits of the required lucky number. | Print on the single line the result — the minimum lucky number, whose sum of digits equals *n*. If such number does not exist, print -1. | [
"11\n",
"10\n"
] | [
"47\n",
"-1\n"
] | none | 500 | [
{
"input": "11",
"output": "47"
},
{
"input": "10",
"output": "-1"
},
{
"input": "64",
"output": "4477777777"
},
{
"input": "1",
"output": "-1"
},
{
"input": "4",
"output": "4"
},
{
"input": "7",
"output": "7"
},
{
"input": "12",
"output": "444"
},
{
"input": "1000000",
"output": "4477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "47",
"output": "44477777"
},
{
"input": "100",
"output": "4444777777777777"
},
{
"input": "700",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "485",
"output": "44447777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "111",
"output": "444447777777777777"
},
{
"input": "85",
"output": "4477777777777"
},
{
"input": "114",
"output": "444477777777777777"
},
{
"input": "474",
"output": "444777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "74",
"output": "47777777777"
},
{
"input": "1000",
"output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "1024",
"output": "4444777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777"
},
{
"input": "4444",
"output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "45784",
"output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "10000",
"output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "9854",
"output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "186",
"output": "477777777777777777777777777"
},
{
"input": "10416",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "10417",
"output": "4477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "3840",
"output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "100000",
"output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "9876",
"output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "99999",
"output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "777777",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "854759",
"output": "4444447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "11000",
"output": "4444447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "18951",
"output": "4444777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "999999",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "888887",
"output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "999998",
"output": "4444477777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "40008",
"output": "4444447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "10691",
"output": "4444777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "5",
"output": "-1"
},
{
"input": "6",
"output": "-1"
},
{
"input": "9",
"output": "-1"
},
{
"input": "8",
"output": "44"
},
{
"input": "2",
"output": "-1"
},
{
"input": "3",
"output": "-1"
},
{
"input": "999997",
"output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "999996",
"output": "4777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "999990",
"output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "999980",
"output": "4444777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "800000",
"output": "4447777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
},
{
"input": "980000",
"output": "7777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777777..."
}
] | 1,533,026,484 | 2,147,483,647 | Python 3 | COMPILATION_ERROR | TESTS | 0 | 0 | 0 | n = input()
result = ""
while (n%7!=0 and n>0):
result+='4'
n-=4
flg = 0
if (n<0 or n%7!=0):
flg = 1
if(flg!=1):
while n>0:
result+='7'
n-=7
print result
else :
print -1 | Title: Lucky Sum of Digits
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Petya loves lucky numbers. We all know that lucky numbers are the positive integers whose decimal representations contain only the lucky digits 4 and 7. For example, numbers 47, 744, 4 are lucky and 5, 17, 467 are not.
Petya wonders eagerly what minimum lucky number has the sum of digits equal to *n*. Help him cope with the task.
Input Specification:
The single line contains an integer *n* (1<=≤<=*n*<=≤<=106) — the sum of digits of the required lucky number.
Output Specification:
Print on the single line the result — the minimum lucky number, whose sum of digits equals *n*. If such number does not exist, print -1.
Demo Input:
['11\n', '10\n']
Demo Output:
['47\n', '-1\n']
Note:
none | ```python
n = input()
result = ""
while (n%7!=0 and n>0):
result+='4'
n-=4
flg = 0
if (n<0 or n%7!=0):
flg = 1
if(flg!=1):
while n>0:
result+='7'
n-=7
print result
else :
print -1
``` | -1 |
581 | C | Developing Skills | PROGRAMMING | 1,400 | [
"implementation",
"math",
"sortings"
] | null | null | Petya loves computer games. Finally a game that he's been waiting for so long came out!
The main character of this game has *n* different skills, each of which is characterized by an integer *a**i* from 0 to 100. The higher the number *a**i* is, the higher is the *i*-th skill of the character. The total rating of the character is calculated as the sum of the values of for all *i* from 1 to *n*. The expression ⌊ *x*⌋ denotes the result of rounding the number *x* down to the nearest integer.
At the beginning of the game Petya got *k* improvement units as a bonus that he can use to increase the skills of his character and his total rating. One improvement unit can increase any skill of Petya's character by exactly one. For example, if *a*4<==<=46, after using one imporvement unit to this skill, it becomes equal to 47. A hero's skill cannot rise higher more than 100. Thus, it is permissible that some of the units will remain unused.
Your task is to determine the optimal way of using the improvement units so as to maximize the overall rating of the character. It is not necessary to use all the improvement units. | The first line of the input contains two positive integers *n* and *k* (1<=≤<=*n*<=≤<=105, 0<=≤<=*k*<=≤<=107) — the number of skills of the character and the number of units of improvements at Petya's disposal.
The second line of the input contains a sequence of *n* integers *a**i* (0<=≤<=*a**i*<=≤<=100), where *a**i* characterizes the level of the *i*-th skill of the character. | The first line of the output should contain a single non-negative integer — the maximum total rating of the character that Petya can get using *k* or less improvement units. | [
"2 4\n7 9\n",
"3 8\n17 15 19\n",
"2 2\n99 100\n"
] | [
"2\n",
"5\n",
"20\n"
] | In the first test case the optimal strategy is as follows. Petya has to improve the first skill to 10 by spending 3 improvement units, and the second skill to 10, by spending one improvement unit. Thus, Petya spends all his improvement units and the total rating of the character becomes equal to *lfloor* *frac*{100}{10} *rfloor* + *lfloor* *frac*{100}{10} *rfloor* = 10 + 10 = 20.
In the second test the optimal strategy for Petya is to improve the first skill to 20 (by spending 3 improvement units) and to improve the third skill to 20 (in this case by spending 1 improvement units). Thus, Petya is left with 4 improvement units and he will be able to increase the second skill to 19 (which does not change the overall rating, so Petya does not necessarily have to do it). Therefore, the highest possible total rating in this example is <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ccaa4e1e435ea3a339c322e03a32de69d214a257.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the third test case the optimal strategy for Petya is to increase the first skill to 100 by spending 1 improvement unit. Thereafter, both skills of the character will be equal to 100, so Petya will not be able to spend the remaining improvement unit. So the answer is equal to <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/b246630ca7d1b95b91970759bd8455cb3e930bf9.png" style="max-width: 100.0%;max-height: 100.0%;"/>. | 1,500 | [
{
"input": "2 4\n7 9",
"output": "2"
},
{
"input": "3 8\n17 15 19",
"output": "5"
},
{
"input": "2 2\n99 100",
"output": "20"
},
{
"input": "100 10000\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "1000"
},
{
"input": "100 10000\n100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100 100",
"output": "1000"
},
{
"input": "1 16\n78",
"output": "9"
},
{
"input": "2 33\n30 88",
"output": "15"
},
{
"input": "3 9\n93 62 7",
"output": "16"
},
{
"input": "5 145\n19 77 59 1 63",
"output": "36"
},
{
"input": "7 168\n2 71 56 58 42 61 39",
"output": "49"
},
{
"input": "10 217\n48 30 82 70 10 5 34 11 90 90",
"output": "68"
},
{
"input": "15 204\n19 81 24 22 59 46 48 8 1 66 100 20 46 56 61",
"output": "86"
},
{
"input": "20 484\n24 72 72 13 85 50 52 3 81 79 71 57 57 75 6 52 54 41 61 73",
"output": "156"
},
{
"input": "30 825\n33 25 61 69 92 38 2 62 73 78 83 32 25 5 5 82 64 93 38 25 52 9 40 52 38 90 25 85 99 20",
"output": "232"
},
{
"input": "40 700\n43 35 51 91 44 51 86 20 64 10 50 40 16 25 37 89 18 44 94 99 18 30 11 27 73 3 90 78 28 98 87 43 85 88 29 93 6 81 78 16",
"output": "276"
},
{
"input": "50 1607\n19 55 52 35 18 39 3 12 55 78 62 83 85 56 36 86 96 28 70 40 40 83 27 2 51 49 87 28 58 75 27 69 36 82 78 29 99 87 29 78 82 78 15 85 52 32 90 6 1 76",
"output": "424"
},
{
"input": "60 2213\n17 98 74 91 59 84 87 71 13 9 74 48 75 76 36 25 49 80 25 92 41 24 99 45 98 95 27 54 88 63 25 50 19 43 15 90 58 48 58 83 37 88 35 63 63 23 27 82 80 7 82 93 71 18 85 17 13 2 50 74",
"output": "552"
},
{
"input": "70 1313\n27 7 64 45 44 29 37 63 38 9 85 56 43 74 46 55 59 97 13 33 75 78 2 88 32 7 24 36 86 40 66 42 26 48 64 14 50 21 20 10 50 73 21 29 17 46 97 90 81 73 61 25 95 82 93 94 72 38 80 13 3 3 20 90 34 20 24 49 96 51",
"output": "468"
},
{
"input": "40 108\n20 100 99 50 8 78 44 67 91 75 93 53 96 81 96 86 81 0 58 9 51 63 70 73 80 79 28 82 4 15 60 74 19 17 54 81 11 67 71 66",
"output": "245"
},
{
"input": "50 284\n61 25 82 73 57 61 90 22 63 99 58 4 27 54 8 29 46 99 73 73 60 42 45 17 75 86 38 83 4 1 67 44 74 87 32 33 14 95 87 46 40 3 37 6 42 38 51 39 98 48",
"output": "282"
},
{
"input": "60 1947\n46 29 55 97 37 32 24 22 35 66 24 78 92 5 55 41 21 30 88 24 13 89 77 30 71 15 58 26 39 10 42 36 28 66 21 28 51 55 91 4 94 59 63 46 1 39 46 1 70 7 46 37 96 41 70 19 55 80 59 83",
"output": "471"
},
{
"input": "70 2454\n88 23 5 86 53 48 60 78 97 90 0 18 57 78 68 28 87 39 70 9 0 35 18 53 67 56 0 71 7 86 39 96 83 45 99 92 43 38 40 63 81 59 89 86 28 62 53 97 53 2 73 93 38 49 51 62 93 3 63 49 47 85 72 98 43 91 7 20 47 66",
"output": "632"
},
{
"input": "80 1879\n36 27 86 90 18 85 99 54 29 8 64 31 34 26 45 51 13 48 58 6 98 30 74 63 78 53 88 98 15 17 29 67 78 8 2 7 42 26 72 83 5 59 8 7 27 59 34 65 93 71 50 34 63 45 21 81 19 30 99 41 25 11 83 62 17 29 80 61 91 22 19 95 80 73 15 39 10 37 88 42",
"output": "570"
},
{
"input": "90 1191\n46 37 76 11 60 29 49 13 88 41 65 7 2 13 44 58 23 10 45 48 63 83 79 5 89 99 28 80 34 6 37 92 61 70 51 0 34 67 68 77 62 69 27 86 71 83 72 73 93 92 62 68 86 76 28 24 67 66 61 12 3 52 45 44 58 83 0 84 18 50 75 51 41 25 21 53 39 20 36 45 62 24 12 33 61 81 9 13 27 22",
"output": "554"
},
{
"input": "100 1257\n80 15 39 54 98 10 65 77 55 98 15 25 78 40 25 16 17 60 25 60 56 29 91 16 14 60 47 31 15 59 83 77 10 54 27 21 50 34 64 69 43 81 32 14 30 93 0 91 75 51 19 84 88 14 30 4 99 59 94 69 24 51 35 99 22 25 41 77 64 97 10 4 56 75 97 54 4 55 29 8 14 16 88 34 80 47 66 30 80 60 45 45 93 85 49 91 37 16 49 56",
"output": "619"
},
{
"input": "100 3852\n71 34 1 77 97 36 66 78 95 47 47 15 50 100 43 47 20 23 61 92 49 86 29 92 100 85 5 58 59 19 16 81 16 89 93 75 46 86 9 50 9 49 61 88 76 13 14 99 47 64 39 42 63 5 57 8 51 21 21 62 92 84 84 56 9 37 72 19 99 19 8 60 25 21 4 0 98 80 29 63 52 87 91 30 79 79 96 22 32 63 87 73 51 89 81 84 69 30 55 31",
"output": "922"
},
{
"input": "100 2533\n16 32 22 100 52 10 43 28 87 72 69 84 26 0 74 46 28 34 46 47 90 18 49 6 42 30 18 33 86 38 94 78 8 39 54 46 72 45 83 68 38 4 14 6 86 24 71 36 22 8 37 99 28 7 88 49 4 69 46 81 30 95 92 18 81 21 14 7 43 14 80 59 14 72 93 6 78 43 56 12 66 21 81 80 39 5 54 69 40 12 41 35 23 58 1 75 40 3 36 97",
"output": "706"
},
{
"input": "100 2239\n95 9 31 56 96 85 88 79 78 63 68 95 1 91 94 56 57 88 30 92 64 52 91 11 17 99 65 63 35 68 82 18 66 57 26 62 32 70 89 98 42 17 68 93 53 79 50 6 30 76 69 10 4 41 18 56 81 49 14 10 91 6 32 80 85 94 2 95 66 9 18 58 71 23 23 48 68 72 39 51 0 23 71 73 10 89 13 15 16 30 27 44 63 93 22 77 12 12 28 5",
"output": "737"
},
{
"input": "100 1689\n40 18 85 79 18 70 44 62 37 21 68 6 9 60 13 55 98 98 82 80 4 75 44 83 60 44 10 60 28 65 59 82 48 41 20 100 57 62 28 60 3 5 54 91 31 89 6 44 38 20 34 90 14 99 82 96 57 97 39 73 30 96 41 42 56 33 45 83 78 15 79 25 27 7 43 54 14 90 22 68 3 1 27 88 49 37 84 61 92 37 14 41 81 62 10 36 73 86 9 4",
"output": "666"
},
{
"input": "1 44\n56",
"output": "10"
},
{
"input": "5 136\n65 53 80 92 74",
"output": "50"
},
{
"input": "20 964\n70 82 81 14 73 35 40 21 73 70 71 35 32 43 26 51 51 62 45 61",
"output": "200"
},
{
"input": "80 4124\n14 37 6 11 63 59 43 72 88 0 53 43 42 95 65 61 9 69 9 95 49 64 27 34 53 31 34 26 30 48 85 97 35 60 74 45 35 86 11 34 45 72 95 95 95 13 58 2 0 38 37 13 61 47 85 77 96 10 34 3 54 55 91 23 57 13 33 16 2 17 80 61 36 57 79 81 90 33 82 48",
"output": "800"
},
{
"input": "100 4899\n66 100 11 81 19 55 96 14 66 10 49 75 1 58 64 80 47 95 45 79 36 89 31 30 61 96 93 86 50 61 64 32 82 13 57 75 5 46 96 49 3 98 34 6 91 7 50 62 46 31 100 4 2 16 20 47 86 41 73 17 43 71 84 47 18 100 55 23 10 37 4 19 84 61 27 61 42 29 95 41 93 5 72 58 24 10 80 45 78 68 19 18 30 28 95 91 15 90 87 47",
"output": "1000"
},
{
"input": "1 7035769\n1",
"output": "10"
},
{
"input": "5 5012340\n10 63 89 25 29",
"output": "50"
},
{
"input": "20 5527187\n15 91 34 37 16 77 85 4 31 28 2 47 8 45 57 51 58 72 97 16",
"output": "200"
},
{
"input": "80 8000114\n27 46 16 80 85 11 20 22 80 24 85 22 17 86 96 60 16 12 94 39 23 86 12 49 28 78 80 23 92 78 62 38 27 43 35 62 60 89 85 63 39 27 70 13 73 91 82 73 98 83 70 93 5 37 15 85 39 58 92 34 93 44 31 86 28 86 43 3 25 12 18 61 25 7 67 87 37 29 65 98",
"output": "800"
},
{
"input": "100 9455943\n44 8 21 71 7 29 40 65 91 70 48 19 77 48 16 22 54 4 29 34 9 22 73 34 47 41 5 83 32 91 52 6 74 64 18 23 9 4 36 78 98 20 20 3 69 86 41 67 54 76 87 84 47 6 52 87 61 100 98 80 14 14 24 99 90 73 97 79 22 65 65 51 29 44 15 67 21 58 79 80 96 40 63 73 96 59 72 24 87 85 74 49 81 30 16 61 87 30 0 13",
"output": "1000"
},
{
"input": "1 6\n27",
"output": "3"
},
{
"input": "1 10\n88",
"output": "9"
},
{
"input": "1 3\n93",
"output": "9"
},
{
"input": "2 22\n48 44",
"output": "11"
},
{
"input": "1 48\n52",
"output": "10"
},
{
"input": "1 2135072\n72",
"output": "10"
},
{
"input": "3 5\n2 3 1",
"output": "0"
},
{
"input": "5 1\n8 8 8 8 8",
"output": "0"
},
{
"input": "3 150\n1 1 1",
"output": "15"
},
{
"input": "4 3\n7 9 9 9",
"output": "3"
},
{
"input": "1 10\n100",
"output": "10"
},
{
"input": "3 11\n100 100 100",
"output": "30"
},
{
"input": "2 11\n99 100",
"output": "20"
}
] | 1,699,199,186 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 95 | 155 | 14,848,000 | from os import path
from sys import stdin, stdout
filename = "../templates/input.txt"
if path.exists(filename):
stdin = open(filename, 'r')
def input():
return stdin.readline().rstrip()
def print(*args, sep=' ', end='\n'):
stdout.write(sep.join(map(str, args)))
stdout.write(end)
def solution():
n, k = [int(num) for num in input().split()]
a = [int(num) for num in input().split()]
a.sort(key=lambda x: 10 - x % 10)
i = 0
while i < n and k:
x = min(k, 10 - a[i] % 10)
a[i] += x
k -= x
i += 1
ans = 0
for ai in a:
ans += ai // 10
if k:
y = sum(100 - ai for ai in a)
ans += min(y // 10, k // 10)
print(ans)
def main():
t = 1
while t:
solution()
t -= 1
if __name__ == '__main__':
main()
| Title: Developing Skills
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Petya loves computer games. Finally a game that he's been waiting for so long came out!
The main character of this game has *n* different skills, each of which is characterized by an integer *a**i* from 0 to 100. The higher the number *a**i* is, the higher is the *i*-th skill of the character. The total rating of the character is calculated as the sum of the values of for all *i* from 1 to *n*. The expression ⌊ *x*⌋ denotes the result of rounding the number *x* down to the nearest integer.
At the beginning of the game Petya got *k* improvement units as a bonus that he can use to increase the skills of his character and his total rating. One improvement unit can increase any skill of Petya's character by exactly one. For example, if *a*4<==<=46, after using one imporvement unit to this skill, it becomes equal to 47. A hero's skill cannot rise higher more than 100. Thus, it is permissible that some of the units will remain unused.
Your task is to determine the optimal way of using the improvement units so as to maximize the overall rating of the character. It is not necessary to use all the improvement units.
Input Specification:
The first line of the input contains two positive integers *n* and *k* (1<=≤<=*n*<=≤<=105, 0<=≤<=*k*<=≤<=107) — the number of skills of the character and the number of units of improvements at Petya's disposal.
The second line of the input contains a sequence of *n* integers *a**i* (0<=≤<=*a**i*<=≤<=100), where *a**i* characterizes the level of the *i*-th skill of the character.
Output Specification:
The first line of the output should contain a single non-negative integer — the maximum total rating of the character that Petya can get using *k* or less improvement units.
Demo Input:
['2 4\n7 9\n', '3 8\n17 15 19\n', '2 2\n99 100\n']
Demo Output:
['2\n', '5\n', '20\n']
Note:
In the first test case the optimal strategy is as follows. Petya has to improve the first skill to 10 by spending 3 improvement units, and the second skill to 10, by spending one improvement unit. Thus, Petya spends all his improvement units and the total rating of the character becomes equal to *lfloor* *frac*{100}{10} *rfloor* + *lfloor* *frac*{100}{10} *rfloor* = 10 + 10 = 20.
In the second test the optimal strategy for Petya is to improve the first skill to 20 (by spending 3 improvement units) and to improve the third skill to 20 (in this case by spending 1 improvement units). Thus, Petya is left with 4 improvement units and he will be able to increase the second skill to 19 (which does not change the overall rating, so Petya does not necessarily have to do it). Therefore, the highest possible total rating in this example is <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/ccaa4e1e435ea3a339c322e03a32de69d214a257.png" style="max-width: 100.0%;max-height: 100.0%;"/>.
In the third test case the optimal strategy for Petya is to increase the first skill to 100 by spending 1 improvement unit. Thereafter, both skills of the character will be equal to 100, so Petya will not be able to spend the remaining improvement unit. So the answer is equal to <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/b246630ca7d1b95b91970759bd8455cb3e930bf9.png" style="max-width: 100.0%;max-height: 100.0%;"/>. | ```python
from os import path
from sys import stdin, stdout
filename = "../templates/input.txt"
if path.exists(filename):
stdin = open(filename, 'r')
def input():
return stdin.readline().rstrip()
def print(*args, sep=' ', end='\n'):
stdout.write(sep.join(map(str, args)))
stdout.write(end)
def solution():
n, k = [int(num) for num in input().split()]
a = [int(num) for num in input().split()]
a.sort(key=lambda x: 10 - x % 10)
i = 0
while i < n and k:
x = min(k, 10 - a[i] % 10)
a[i] += x
k -= x
i += 1
ans = 0
for ai in a:
ans += ai // 10
if k:
y = sum(100 - ai for ai in a)
ans += min(y // 10, k // 10)
print(ans)
def main():
t = 1
while t:
solution()
t -= 1
if __name__ == '__main__':
main()
``` | 0 |
|
914 | B | Conan and Agasa play a Card Game | PROGRAMMING | 1,200 | [
"games",
"greedy",
"implementation"
] | null | null | Edogawa Conan got tired of solving cases, and invited his friend, Professor Agasa, over. They decided to play a game of cards. Conan has *n* cards, and the *i*-th card has a number *a**i* written on it.
They take turns playing, starting with Conan. In each turn, the player chooses a card and removes it. Also, he removes all cards having a number strictly lesser than the number on the chosen card. Formally, if the player chooses the *i*-th card, he removes that card and removes the *j*-th card for all *j* such that *a**j*<=<<=*a**i*.
A player loses if he cannot make a move on his turn, that is, he loses if there are no cards left. Predict the outcome of the game, assuming both players play optimally. | The first line contains an integer *n* (1<=≤<=*n*<=≤<=105) — the number of cards Conan has.
The next line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=105), where *a**i* is the number on the *i*-th card. | If Conan wins, print "Conan" (without quotes), otherwise print "Agasa" (without quotes). | [
"3\n4 5 7\n",
"2\n1 1\n"
] | [
"Conan\n",
"Agasa\n"
] | In the first example, Conan can just choose the card having number 7 on it and hence remove all the cards. After that, there are no cards left on Agasa's turn.
In the second example, no matter which card Conan chooses, there will be one one card left, which Agasa can choose. After that, there are no cards left when it becomes Conan's turn again. | 1,000 | [
{
"input": "3\n4 5 7",
"output": "Conan"
},
{
"input": "2\n1 1",
"output": "Agasa"
},
{
"input": "10\n38282 53699 38282 38282 38282 38282 38282 38282 38282 38282",
"output": "Conan"
},
{
"input": "10\n50165 50165 50165 50165 50165 50165 50165 50165 50165 50165",
"output": "Agasa"
},
{
"input": "10\n83176 83176 83176 23495 83176 8196 83176 23495 83176 83176",
"output": "Conan"
},
{
"input": "10\n32093 36846 32093 32093 36846 36846 36846 36846 36846 36846",
"output": "Conan"
},
{
"input": "3\n1 2 3",
"output": "Conan"
},
{
"input": "4\n2 3 4 5",
"output": "Conan"
},
{
"input": "10\n30757 30757 33046 41744 39918 39914 41744 39914 33046 33046",
"output": "Conan"
},
{
"input": "10\n50096 50096 50096 50096 50096 50096 28505 50096 50096 50096",
"output": "Conan"
},
{
"input": "10\n54842 54842 54842 54842 57983 54842 54842 57983 57983 54842",
"output": "Conan"
},
{
"input": "10\n87900 87900 5761 87900 87900 87900 5761 87900 87900 87900",
"output": "Agasa"
},
{
"input": "10\n53335 35239 26741 35239 35239 26741 35239 35239 53335 35239",
"output": "Agasa"
},
{
"input": "10\n75994 64716 75994 64716 75994 75994 56304 64716 56304 64716",
"output": "Agasa"
},
{
"input": "1\n1",
"output": "Conan"
},
{
"input": "5\n2 2 1 1 1",
"output": "Conan"
},
{
"input": "5\n1 4 4 5 5",
"output": "Conan"
},
{
"input": "3\n1 3 3",
"output": "Conan"
},
{
"input": "3\n2 2 2",
"output": "Conan"
},
{
"input": "5\n1 1 1 2 2",
"output": "Conan"
},
{
"input": "4\n1 2 1 2",
"output": "Agasa"
},
{
"input": "7\n7 7 7 7 6 6 6",
"output": "Conan"
},
{
"input": "3\n2 3 3",
"output": "Conan"
},
{
"input": "3\n1 1 100000",
"output": "Conan"
},
{
"input": "1\n100000",
"output": "Conan"
},
{
"input": "5\n3 3 3 4 4",
"output": "Conan"
},
{
"input": "3\n1 2 2",
"output": "Conan"
},
{
"input": "3\n4 4 5",
"output": "Conan"
},
{
"input": "1\n2",
"output": "Conan"
},
{
"input": "3\n97 97 100",
"output": "Conan"
},
{
"input": "5\n100000 100000 100000 1 1",
"output": "Conan"
},
{
"input": "7\n7 7 6 6 5 5 4",
"output": "Conan"
},
{
"input": "5\n100000 100000 100000 2 2",
"output": "Conan"
},
{
"input": "4\n3 3 2 1",
"output": "Conan"
},
{
"input": "1\n485",
"output": "Conan"
},
{
"input": "3\n4 4 100000",
"output": "Conan"
},
{
"input": "3\n1 1 2",
"output": "Conan"
},
{
"input": "3\n1 1 1",
"output": "Conan"
},
{
"input": "5\n1 1 2 2 2",
"output": "Conan"
}
] | 1,552,209,876 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 10 | 124 | 7,372,800 | n=int(input())
l=[int(i) for i in input().split()]
m=max(l)
cnt=l.count(m)
if cnt&1:
print('Conan')
else:
print('Agasa') | Title: Conan and Agasa play a Card Game
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Edogawa Conan got tired of solving cases, and invited his friend, Professor Agasa, over. They decided to play a game of cards. Conan has *n* cards, and the *i*-th card has a number *a**i* written on it.
They take turns playing, starting with Conan. In each turn, the player chooses a card and removes it. Also, he removes all cards having a number strictly lesser than the number on the chosen card. Formally, if the player chooses the *i*-th card, he removes that card and removes the *j*-th card for all *j* such that *a**j*<=<<=*a**i*.
A player loses if he cannot make a move on his turn, that is, he loses if there are no cards left. Predict the outcome of the game, assuming both players play optimally.
Input Specification:
The first line contains an integer *n* (1<=≤<=*n*<=≤<=105) — the number of cards Conan has.
The next line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=105), where *a**i* is the number on the *i*-th card.
Output Specification:
If Conan wins, print "Conan" (without quotes), otherwise print "Agasa" (without quotes).
Demo Input:
['3\n4 5 7\n', '2\n1 1\n']
Demo Output:
['Conan\n', 'Agasa\n']
Note:
In the first example, Conan can just choose the card having number 7 on it and hence remove all the cards. After that, there are no cards left on Agasa's turn.
In the second example, no matter which card Conan chooses, there will be one one card left, which Agasa can choose. After that, there are no cards left when it becomes Conan's turn again. | ```python
n=int(input())
l=[int(i) for i in input().split()]
m=max(l)
cnt=l.count(m)
if cnt&1:
print('Conan')
else:
print('Agasa')
``` | 0 |
|
740 | A | Alyona and copybooks | PROGRAMMING | 1,300 | [
"brute force",
"implementation"
] | null | null | Little girl Alyona is in a shop to buy some copybooks for school. She study four subjects so she wants to have equal number of copybooks for each of the subjects. There are three types of copybook's packs in the shop: it is possible to buy one copybook for *a* rubles, a pack of two copybooks for *b* rubles, and a pack of three copybooks for *c* rubles. Alyona already has *n* copybooks.
What is the minimum amount of rubles she should pay to buy such number of copybooks *k* that *n*<=+<=*k* is divisible by 4? There are infinitely many packs of any type in the shop. Alyona can buy packs of different type in the same purchase. | The only line contains 4 integers *n*, *a*, *b*, *c* (1<=≤<=*n*,<=*a*,<=*b*,<=*c*<=≤<=109). | Print the minimum amount of rubles she should pay to buy such number of copybooks *k* that *n*<=+<=*k* is divisible by 4. | [
"1 1 3 4\n",
"6 2 1 1\n",
"4 4 4 4\n",
"999999999 1000000000 1000000000 1000000000\n"
] | [
"3\n",
"1\n",
"0\n",
"1000000000\n"
] | In the first example Alyona can buy 3 packs of 1 copybook for 3*a* = 3 rubles in total. After that she will have 4 copybooks which she can split between the subjects equally.
In the second example Alyuna can buy a pack of 2 copybooks for *b* = 1 ruble. She will have 8 copybooks in total.
In the third example Alyona can split the copybooks she already has between the 4 subject equally, so she doesn't need to buy anything.
In the fourth example Alyona should buy one pack of one copybook. | 500 | [
{
"input": "1 1 3 4",
"output": "3"
},
{
"input": "6 2 1 1",
"output": "1"
},
{
"input": "4 4 4 4",
"output": "0"
},
{
"input": "999999999 1000000000 1000000000 1000000000",
"output": "1000000000"
},
{
"input": "1016 3 2 1",
"output": "0"
},
{
"input": "17 100 100 1",
"output": "1"
},
{
"input": "17 2 3 100",
"output": "5"
},
{
"input": "18 1 3 3",
"output": "2"
},
{
"input": "19 1 1 1",
"output": "1"
},
{
"input": "999999997 999999990 1000000000 1000000000",
"output": "1000000000"
},
{
"input": "999999998 1000000000 999999990 1000000000",
"output": "999999990"
},
{
"input": "634074578 336470888 481199252 167959139",
"output": "335918278"
},
{
"input": "999999999 1000000000 1000000000 999999990",
"output": "1000000000"
},
{
"input": "804928248 75475634 54748096 641009859",
"output": "0"
},
{
"input": "535590429 374288891 923264237 524125987",
"output": "524125987"
},
{
"input": "561219907 673102149 496813081 702209411",
"output": "673102149"
},
{
"input": "291882089 412106895 365329221 585325539",
"output": "585325539"
},
{
"input": "757703054 5887448 643910770 58376259",
"output": "11774896"
},
{
"input": "783332532 449924898 72235422 941492387",
"output": "0"
},
{
"input": "513994713 43705451 940751563 824608515",
"output": "131116353"
},
{
"input": "539624191 782710197 514300407 2691939",
"output": "8075817"
},
{
"input": "983359971 640274071 598196518 802030518",
"output": "640274071"
},
{
"input": "8989449 379278816 26521171 685146646",
"output": "405799987"
},
{
"input": "34618927 678092074 895037311 863230070",
"output": "678092074"
},
{
"input": "205472596 417096820 468586155 41313494",
"output": "0"
},
{
"input": "19 5 1 2",
"output": "3"
},
{
"input": "17 1 2 2",
"output": "2"
},
{
"input": "18 3 3 1",
"output": "2"
},
{
"input": "19 4 3 1",
"output": "3"
},
{
"input": "936134778 715910077 747167704 219396918",
"output": "438793836"
},
{
"input": "961764255 454914823 615683844 102513046",
"output": "307539138"
},
{
"input": "692426437 48695377 189232688 985629174",
"output": "146086131"
},
{
"input": "863280107 347508634 912524637 458679894",
"output": "347508634"
},
{
"input": "593942288 86513380 486073481 341796022",
"output": "0"
},
{
"input": "914539062 680293934 764655030 519879446",
"output": "764655030"
},
{
"input": "552472140 509061481 586588704 452405440",
"output": "0"
},
{
"input": "723325809 807874739 160137548 335521569",
"output": "335521569"
},
{
"input": "748955287 546879484 733686393 808572289",
"output": "546879484"
},
{
"input": "774584765 845692742 162011045 691688417",
"output": "691688417"
},
{
"input": "505246946 439473295 30527185 869771841",
"output": "30527185"
},
{
"input": "676100616 178478041 604076030 752887969",
"output": "0"
},
{
"input": "701730093 477291299 177624874 930971393",
"output": "654916173"
},
{
"input": "432392275 216296044 751173719 109054817",
"output": "216296044"
},
{
"input": "458021753 810076598 324722563 992170945",
"output": "992170945"
},
{
"input": "188683934 254114048 48014511 170254369",
"output": "48014511"
},
{
"input": "561775796 937657403 280013594 248004555",
"output": "0"
},
{
"input": "1000000000 1000000000 1000000000 1000000000",
"output": "0"
},
{
"input": "3 10000 10000 3",
"output": "9"
},
{
"input": "3 12 3 4",
"output": "7"
},
{
"input": "3 10000 10000 1",
"output": "3"
},
{
"input": "3 1000 1000 1",
"output": "3"
},
{
"input": "3 10 10 1",
"output": "3"
},
{
"input": "3 100 100 1",
"output": "3"
},
{
"input": "3 100000 10000 1",
"output": "3"
},
{
"input": "7 10 2 3",
"output": "5"
},
{
"input": "3 1000 1000 2",
"output": "6"
},
{
"input": "1 100000 1 100000",
"output": "100000"
},
{
"input": "7 4 3 1",
"output": "3"
},
{
"input": "3 1000 1000 3",
"output": "9"
},
{
"input": "3 1000 1 1",
"output": "2"
},
{
"input": "3 10 1 1",
"output": "2"
},
{
"input": "3 100000 1 1",
"output": "2"
},
{
"input": "3 100 1 1",
"output": "2"
},
{
"input": "3 100000 100000 1",
"output": "3"
},
{
"input": "3 1000 1 100",
"output": "101"
},
{
"input": "3 1000000000 1 1000000000",
"output": "1000000000"
},
{
"input": "3 1000 1 10",
"output": "11"
},
{
"input": "3 200 1 100",
"output": "101"
},
{
"input": "7 4 1 1",
"output": "2"
},
{
"input": "7 4 12 1",
"output": "3"
},
{
"input": "3 9 1 1",
"output": "2"
},
{
"input": "3 10000000 1000000 1",
"output": "3"
},
{
"input": "7 1000 1000 1",
"output": "3"
},
{
"input": "3 10000 1 30",
"output": "31"
},
{
"input": "3 1000 1 2",
"output": "3"
},
{
"input": "7 12 6 1",
"output": "3"
},
{
"input": "3 100000 1 1000",
"output": "1001"
},
{
"input": "7 1000 1000 3",
"output": "9"
},
{
"input": "3 4 3 1",
"output": "3"
},
{
"input": "3 3000000 1 100000",
"output": "100001"
},
{
"input": "3 3 1 1",
"output": "2"
},
{
"input": "3 10 1 5",
"output": "6"
},
{
"input": "3 2000 2000 1",
"output": "3"
},
{
"input": "3 10000000 10000000 1",
"output": "3"
},
{
"input": "3 5 1 1",
"output": "2"
},
{
"input": "3 100 1 33",
"output": "34"
},
{
"input": "7 9 2 7",
"output": "9"
},
{
"input": "4448 2 3 6",
"output": "0"
},
{
"input": "2228 1 6 3",
"output": "0"
}
] | 1,593,989,074 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 93 | 6,656,000 | n, a, b, c = [int(x) for x in input().split()]
hastobuy = n % 4
if hastobuy == 0:
print(0)
elif hastobuy == 1:
print(a)
elif hastobuy == 2:
print(min(2*a, b))
elif hastobuy == 3:
print(min(3*a, 2*a + b))
| Title: Alyona and copybooks
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little girl Alyona is in a shop to buy some copybooks for school. She study four subjects so she wants to have equal number of copybooks for each of the subjects. There are three types of copybook's packs in the shop: it is possible to buy one copybook for *a* rubles, a pack of two copybooks for *b* rubles, and a pack of three copybooks for *c* rubles. Alyona already has *n* copybooks.
What is the minimum amount of rubles she should pay to buy such number of copybooks *k* that *n*<=+<=*k* is divisible by 4? There are infinitely many packs of any type in the shop. Alyona can buy packs of different type in the same purchase.
Input Specification:
The only line contains 4 integers *n*, *a*, *b*, *c* (1<=≤<=*n*,<=*a*,<=*b*,<=*c*<=≤<=109).
Output Specification:
Print the minimum amount of rubles she should pay to buy such number of copybooks *k* that *n*<=+<=*k* is divisible by 4.
Demo Input:
['1 1 3 4\n', '6 2 1 1\n', '4 4 4 4\n', '999999999 1000000000 1000000000 1000000000\n']
Demo Output:
['3\n', '1\n', '0\n', '1000000000\n']
Note:
In the first example Alyona can buy 3 packs of 1 copybook for 3*a* = 3 rubles in total. After that she will have 4 copybooks which she can split between the subjects equally.
In the second example Alyuna can buy a pack of 2 copybooks for *b* = 1 ruble. She will have 8 copybooks in total.
In the third example Alyona can split the copybooks she already has between the 4 subject equally, so she doesn't need to buy anything.
In the fourth example Alyona should buy one pack of one copybook. | ```python
n, a, b, c = [int(x) for x in input().split()]
hastobuy = n % 4
if hastobuy == 0:
print(0)
elif hastobuy == 1:
print(a)
elif hastobuy == 2:
print(min(2*a, b))
elif hastobuy == 3:
print(min(3*a, 2*a + b))
``` | 0 |
|
151 | A | Soft Drinking | PROGRAMMING | 800 | [
"implementation",
"math"
] | null | null | This winter is so cold in Nvodsk! A group of *n* friends decided to buy *k* bottles of a soft drink called "Take-It-Light" to warm up a bit. Each bottle has *l* milliliters of the drink. Also they bought *c* limes and cut each of them into *d* slices. After that they found *p* grams of salt.
To make a toast, each friend needs *nl* milliliters of the drink, a slice of lime and *np* grams of salt. The friends want to make as many toasts as they can, provided they all drink the same amount. How many toasts can each friend make? | The first and only line contains positive integers *n*, *k*, *l*, *c*, *d*, *p*, *nl*, *np*, not exceeding 1000 and no less than 1. The numbers are separated by exactly one space. | Print a single integer — the number of toasts each friend can make. | [
"3 4 5 10 8 100 3 1\n",
"5 100 10 1 19 90 4 3\n",
"10 1000 1000 25 23 1 50 1\n"
] | [
"2\n",
"3\n",
"0\n"
] | A comment to the first sample:
Overall the friends have 4 * 5 = 20 milliliters of the drink, it is enough to make 20 / 3 = 6 toasts. The limes are enough for 10 * 8 = 80 toasts and the salt is enough for 100 / 1 = 100 toasts. However, there are 3 friends in the group, so the answer is *min*(6, 80, 100) / 3 = 2. | 500 | [
{
"input": "3 4 5 10 8 100 3 1",
"output": "2"
},
{
"input": "5 100 10 1 19 90 4 3",
"output": "3"
},
{
"input": "10 1000 1000 25 23 1 50 1",
"output": "0"
},
{
"input": "1 7 4 5 5 8 3 2",
"output": "4"
},
{
"input": "2 3 3 5 5 10 1 3",
"output": "1"
},
{
"input": "2 6 4 5 6 5 1 3",
"output": "0"
},
{
"input": "1 7 3 5 3 6 2 1",
"output": "6"
},
{
"input": "2 4 5 4 5 7 3 2",
"output": "1"
},
{
"input": "2 3 6 5 7 8 2 1",
"output": "4"
},
{
"input": "1 4 5 5 3 10 3 1",
"output": "6"
},
{
"input": "1 4 6 7 3 5 1 3",
"output": "1"
},
{
"input": "1 6 5 5 5 8 3 1",
"output": "8"
},
{
"input": "1 7 5 3 3 9 2 1",
"output": "9"
},
{
"input": "3 5 3 7 6 10 3 1",
"output": "1"
},
{
"input": "3 6 3 5 3 6 3 1",
"output": "2"
},
{
"input": "1 7 5 5 5 5 2 2",
"output": "2"
},
{
"input": "2 5 3 5 6 9 2 1",
"output": "3"
},
{
"input": "3 4 3 5 3 6 2 1",
"output": "2"
},
{
"input": "1 5 5 4 7 6 3 1",
"output": "6"
},
{
"input": "2 3 7 6 5 9 3 1",
"output": "3"
},
{
"input": "2 6 5 3 3 8 1 1",
"output": "4"
},
{
"input": "2 4 7 3 4 10 2 1",
"output": "5"
},
{
"input": "1 1000 1000 1000 1000 1000 1 1",
"output": "1000"
},
{
"input": "17 1000 1000 1000 1000 1000 3 7",
"output": "8"
},
{
"input": "115 1000 1000 1000 1000 1000 17 15",
"output": "0"
},
{
"input": "1 587 981 1 2 1 1 1",
"output": "1"
},
{
"input": "1 1 2 1 2 2 1 1",
"output": "2"
}
] | 1,687,369,473 | 2,147,483,647 | Python 3 | OK | TESTS | 27 | 62 | 0 | n, k, l, c, d, p, nl, np = map(int, input().split())
res = min(((k*l)//nl), (c*d), (p//np))//n
print(int(res)) | Title: Soft Drinking
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
This winter is so cold in Nvodsk! A group of *n* friends decided to buy *k* bottles of a soft drink called "Take-It-Light" to warm up a bit. Each bottle has *l* milliliters of the drink. Also they bought *c* limes and cut each of them into *d* slices. After that they found *p* grams of salt.
To make a toast, each friend needs *nl* milliliters of the drink, a slice of lime and *np* grams of salt. The friends want to make as many toasts as they can, provided they all drink the same amount. How many toasts can each friend make?
Input Specification:
The first and only line contains positive integers *n*, *k*, *l*, *c*, *d*, *p*, *nl*, *np*, not exceeding 1000 and no less than 1. The numbers are separated by exactly one space.
Output Specification:
Print a single integer — the number of toasts each friend can make.
Demo Input:
['3 4 5 10 8 100 3 1\n', '5 100 10 1 19 90 4 3\n', '10 1000 1000 25 23 1 50 1\n']
Demo Output:
['2\n', '3\n', '0\n']
Note:
A comment to the first sample:
Overall the friends have 4 * 5 = 20 milliliters of the drink, it is enough to make 20 / 3 = 6 toasts. The limes are enough for 10 * 8 = 80 toasts and the salt is enough for 100 / 1 = 100 toasts. However, there are 3 friends in the group, so the answer is *min*(6, 80, 100) / 3 = 2. | ```python
n, k, l, c, d, p, nl, np = map(int, input().split())
res = min(((k*l)//nl), (c*d), (p//np))//n
print(int(res))
``` | 3 |
|
166 | A | Rank List | PROGRAMMING | 1,100 | [
"binary search",
"implementation",
"sortings"
] | null | null | Another programming contest is over. You got hold of the contest's final results table. The table has the following data. For each team we are shown two numbers: the number of problems and the total penalty time. However, for no team we are shown its final place.
You know the rules of comparing the results of two given teams very well. Let's say that team *a* solved *p**a* problems with total penalty time *t**a* and team *b* solved *p**b* problems with total penalty time *t**b*. Team *a* gets a higher place than team *b* in the end, if it either solved more problems on the contest, or solved the same number of problems but in less total time. In other words, team *a* gets a higher place than team *b* in the final results' table if either *p**a*<=><=*p**b*, or *p**a*<==<=*p**b* and *t**a*<=<<=*t**b*.
It is considered that the teams that solve the same number of problems with the same penalty time share all corresponding places. More formally, let's say there is a group of *x* teams that solved the same number of problems with the same penalty time. Let's also say that *y* teams performed better than the teams from this group. In this case all teams from the group share places *y*<=+<=1, *y*<=+<=2, ..., *y*<=+<=*x*. The teams that performed worse than the teams from this group, get their places in the results table starting from the *y*<=+<=*x*<=+<=1-th place.
Your task is to count what number of teams from the given list shared the *k*-th place. | The first line contains two integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=50). Then *n* lines contain the description of the teams: the *i*-th line contains two integers *p**i* and *t**i* (1<=≤<=*p**i*,<=*t**i*<=≤<=50) — the number of solved problems and the total penalty time of the *i*-th team, correspondingly. All numbers in the lines are separated by spaces. | In the only line print the sought number of teams that got the *k*-th place in the final results' table. | [
"7 2\n4 10\n4 10\n4 10\n3 20\n2 1\n2 1\n1 10\n",
"5 4\n3 1\n3 1\n5 3\n3 1\n3 1\n"
] | [
"3\n",
"4\n"
] | The final results' table for the first sample is:
- 1-3 places — 4 solved problems, the penalty time equals 10 - 4 place — 3 solved problems, the penalty time equals 20 - 5-6 places — 2 solved problems, the penalty time equals 1 - 7 place — 1 solved problem, the penalty time equals 10
The table shows that the second place is shared by the teams that solved 4 problems with penalty time 10. There are 3 such teams.
The final table for the second sample is:
- 1 place — 5 solved problems, the penalty time equals 3 - 2-5 places — 3 solved problems, the penalty time equals 1
The table shows that the fourth place is shared by the teams that solved 3 problems with penalty time 1. There are 4 such teams. | 500 | [
{
"input": "7 2\n4 10\n4 10\n4 10\n3 20\n2 1\n2 1\n1 10",
"output": "3"
},
{
"input": "5 4\n3 1\n3 1\n5 3\n3 1\n3 1",
"output": "4"
},
{
"input": "5 1\n2 2\n1 1\n1 1\n1 1\n2 2",
"output": "2"
},
{
"input": "6 3\n2 2\n3 1\n2 2\n4 5\n2 2\n4 5",
"output": "1"
},
{
"input": "5 5\n3 1\n10 2\n2 2\n1 10\n10 2",
"output": "1"
},
{
"input": "3 2\n3 3\n3 3\n3 3",
"output": "3"
},
{
"input": "4 3\n10 3\n6 10\n5 2\n5 2",
"output": "2"
},
{
"input": "5 3\n10 10\n10 10\n1 1\n10 10\n4 3",
"output": "3"
},
{
"input": "3 1\n2 1\n1 1\n1 2",
"output": "1"
},
{
"input": "1 1\n28 28",
"output": "1"
},
{
"input": "2 2\n1 2\n1 2",
"output": "2"
},
{
"input": "5 3\n2 3\n4 2\n5 3\n2 4\n3 5",
"output": "1"
},
{
"input": "50 22\n4 9\n8 1\n3 7\n1 2\n3 8\n9 8\n8 5\n2 10\n5 8\n1 3\n1 8\n2 3\n7 9\n10 2\n9 9\n7 3\n8 6\n10 6\n5 4\n8 1\n1 5\n6 8\n9 5\n9 5\n3 2\n3 3\n3 8\n7 5\n4 5\n8 10\n8 2\n3 5\n3 2\n1 1\n7 2\n2 7\n6 8\n10 4\n7 5\n1 7\n6 5\n3 1\n4 9\n2 3\n3 6\n5 8\n4 10\n10 7\n7 10\n9 8",
"output": "1"
},
{
"input": "50 6\n11 20\n18 13\n1 13\n3 11\n4 17\n15 10\n15 8\n9 16\n11 17\n16 3\n3 20\n14 13\n12 15\n9 10\n14 2\n12 12\n13 17\n6 10\n20 9\n2 8\n13 7\n7 20\n15 3\n1 20\n2 13\n2 5\n14 7\n10 13\n15 12\n15 5\n17 6\n9 11\n18 5\n10 1\n15 14\n3 16\n6 12\n4 1\n14 9\n7 14\n8 17\n17 13\n4 6\n19 16\n5 6\n3 15\n4 19\n15 20\n2 10\n20 10",
"output": "1"
},
{
"input": "50 12\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "50"
},
{
"input": "50 28\n2 2\n1 1\n2 1\n1 2\n1 1\n1 1\n1 1\n2 2\n2 2\n2 2\n2 1\n2 2\n2 1\n2 1\n1 2\n1 2\n1 2\n1 1\n2 2\n1 2\n2 2\n2 2\n2 1\n1 1\n1 2\n1 2\n1 1\n1 1\n1 1\n2 2\n2 1\n2 1\n2 2\n1 2\n1 2\n1 2\n1 1\n2 2\n1 2\n1 1\n2 2\n2 2\n1 1\n2 1\n2 1\n1 1\n2 2\n2 2\n2 2\n2 2",
"output": "13"
},
{
"input": "50 40\n2 3\n3 1\n2 1\n2 1\n2 1\n3 1\n1 1\n1 2\n2 3\n1 3\n1 3\n2 1\n3 1\n1 1\n3 1\n3 1\n2 2\n1 1\n3 3\n3 1\n3 2\n2 3\n3 3\n3 1\n1 3\n2 3\n2 1\n3 2\n3 3\n3 1\n2 1\n2 2\n1 3\n3 3\n1 1\n3 2\n1 2\n2 3\n2 1\n2 2\n3 2\n1 3\n3 1\n1 1\n3 3\n2 3\n2 1\n2 3\n2 3\n1 2",
"output": "5"
},
{
"input": "50 16\n2 1\n3 2\n5 2\n2 2\n3 4\n4 4\n3 3\n4 1\n2 3\n1 5\n4 1\n2 2\n1 5\n3 2\n2 1\n5 4\n5 2\n5 4\n1 1\n3 5\n2 1\n4 5\n5 1\n5 5\n5 4\n2 4\n1 2\n5 5\n4 4\n1 5\n4 2\n5 1\n2 4\n2 5\n2 2\n3 4\n3 1\n1 1\n5 5\n2 2\n3 4\n2 4\n5 2\n4 1\n3 1\n1 1\n4 1\n4 4\n1 4\n1 3",
"output": "1"
},
{
"input": "50 32\n6 6\n4 2\n5 5\n1 1\n2 4\n6 5\n2 3\n6 5\n2 3\n6 3\n1 4\n1 6\n3 3\n2 4\n3 2\n6 2\n4 1\n3 3\n3 1\n5 5\n1 2\n2 1\n5 4\n3 1\n4 4\n5 6\n4 1\n2 5\n3 1\n4 6\n2 3\n1 1\n6 5\n2 6\n3 3\n2 6\n2 3\n2 6\n3 4\n2 6\n4 5\n5 4\n1 6\n3 2\n5 1\n4 1\n4 6\n4 2\n1 2\n5 2",
"output": "1"
},
{
"input": "50 48\n5 1\n6 4\n3 2\n2 1\n4 7\n3 6\n7 1\n7 5\n6 5\n5 6\n4 7\n5 7\n5 7\n5 5\n7 3\n3 5\n4 3\n5 4\n6 2\n1 6\n6 3\n6 5\n5 2\n4 2\n3 1\n1 1\n5 6\n1 3\n6 5\n3 7\n1 5\n7 5\n6 5\n3 6\n2 7\n5 3\n5 3\n4 7\n5 2\n6 5\n5 7\n7 1\n2 3\n5 5\n2 6\n4 1\n6 2\n6 5\n3 3\n1 6",
"output": "1"
},
{
"input": "50 8\n5 3\n7 3\n4 3\n7 4\n2 2\n4 4\n5 4\n1 1\n7 7\n4 8\n1 1\n6 3\n1 5\n7 3\n6 5\n4 5\n8 6\n3 6\n2 1\n3 2\n2 5\n7 6\n5 8\n1 3\n5 5\n8 4\n4 5\n4 4\n8 8\n7 2\n7 2\n3 6\n2 8\n8 3\n3 2\n4 5\n8 1\n3 2\n8 7\n6 3\n2 3\n5 1\n3 4\n7 2\n6 3\n7 3\n3 3\n6 4\n2 2\n5 1",
"output": "3"
},
{
"input": "20 16\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "20"
},
{
"input": "20 20\n1 2\n2 2\n1 1\n2 1\n2 2\n1 1\n1 1\n2 1\n1 1\n1 2\n2 2\n1 2\n1 2\n2 2\n2 2\n1 2\n2 1\n2 1\n1 2\n2 2",
"output": "6"
},
{
"input": "30 16\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "30"
},
{
"input": "30 22\n2 1\n1 2\n2 1\n2 2\n2 1\n1 2\n2 2\n1 2\n2 2\n1 2\n2 2\n1 2\n1 2\n2 1\n1 2\n2 2\n2 2\n1 2\n2 1\n1 1\n1 2\n1 2\n1 1\n1 2\n1 2\n2 2\n1 2\n2 2\n2 1\n1 1",
"output": "13"
},
{
"input": "30 22\n1 1\n1 3\n2 3\n3 1\n2 3\n3 1\n1 2\n3 3\n2 1\n2 1\n2 2\n3 1\n3 2\n2 3\n3 1\n1 3\n2 3\n3 1\n1 2\n1 2\n2 3\n2 1\n3 3\n3 2\n1 3\n3 3\n3 3\n3 3\n3 3\n3 1",
"output": "5"
},
{
"input": "50 16\n2 1\n3 2\n5 2\n2 2\n3 4\n4 4\n3 3\n4 1\n2 3\n1 5\n4 1\n2 2\n1 5\n3 2\n2 1\n5 4\n5 2\n5 4\n1 1\n3 5\n2 1\n4 5\n5 1\n5 5\n5 4\n2 4\n1 2\n5 5\n4 4\n1 5\n4 2\n5 1\n2 4\n2 5\n2 2\n3 4\n3 1\n1 1\n5 5\n2 2\n3 4\n2 4\n5 2\n4 1\n3 1\n1 1\n4 1\n4 4\n1 4\n1 3",
"output": "1"
},
{
"input": "50 22\n4 9\n8 1\n3 7\n1 2\n3 8\n9 8\n8 5\n2 10\n5 8\n1 3\n1 8\n2 3\n7 9\n10 2\n9 9\n7 3\n8 6\n10 6\n5 4\n8 1\n1 5\n6 8\n9 5\n9 5\n3 2\n3 3\n3 8\n7 5\n4 5\n8 10\n8 2\n3 5\n3 2\n1 1\n7 2\n2 7\n6 8\n10 4\n7 5\n1 7\n6 5\n3 1\n4 9\n2 3\n3 6\n5 8\n4 10\n10 7\n7 10\n9 8",
"output": "1"
},
{
"input": "50 22\n29 15\n18 10\n6 23\n38 28\n34 40\n40 1\n16 26\n22 33\n14 30\n26 7\n15 16\n22 40\n14 15\n6 28\n32 27\n33 3\n38 22\n40 17\n16 27\n21 27\n34 26\n5 15\n34 9\n38 23\n7 36\n17 6\n19 37\n40 1\n10 28\n9 14\n8 31\n40 8\n14 2\n24 16\n38 33\n3 37\n2 9\n21 21\n40 26\n28 33\n24 31\n10 12\n27 27\n17 4\n38 5\n21 31\n5 12\n29 7\n39 12\n26 14",
"output": "1"
},
{
"input": "50 14\n4 20\n37 50\n46 19\n20 25\n47 10\n6 34\n12 41\n47 9\n22 28\n41 34\n47 40\n12 42\n9 4\n15 15\n27 8\n38 9\n4 17\n8 13\n47 7\n9 38\n30 48\n50 7\n41 34\n23 11\n16 37\n2 32\n18 46\n37 48\n47 41\n13 9\n24 50\n46 14\n33 49\n9 50\n35 30\n49 44\n42 49\n39 15\n33 42\n3 18\n44 15\n44 28\n9 17\n16 4\n10 36\n4 22\n47 17\n24 12\n2 31\n6 30",
"output": "2"
},
{
"input": "2 1\n50 50\n50 50",
"output": "2"
},
{
"input": "2 2\n50 50\n50 50",
"output": "2"
},
{
"input": "2 1\n50 50\n50 49",
"output": "1"
},
{
"input": "2 2\n50 50\n50 49",
"output": "1"
},
{
"input": "50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50",
"output": "50"
},
{
"input": "50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n49 50",
"output": "1"
},
{
"input": "50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 50\n50 49",
"output": "49"
},
{
"input": "10 1\n3 1\n3 2\n3 2\n2 3\n2 3\n2 3\n2 4\n2 4\n2 4\n2 4",
"output": "1"
},
{
"input": "4 3\n1 1\n1 2\n2 1\n2 2",
"output": "1"
},
{
"input": "4 2\n1 2\n1 3\n1 5\n1 2",
"output": "2"
},
{
"input": "6 1\n4 3\n4 2\n5 1\n5 2\n5 3\n5 3",
"output": "1"
},
{
"input": "5 3\n2 1\n1 3\n1 2\n1 1\n1 1",
"output": "2"
},
{
"input": "3 1\n1 1\n1 2\n1 3",
"output": "1"
},
{
"input": "10 10\n3 1\n3 2\n3 2\n2 3\n2 3\n2 3\n2 4\n2 4\n2 4\n2 4",
"output": "4"
},
{
"input": "5 1\n5 5\n5 6\n5 7\n5 8\n5 5",
"output": "2"
},
{
"input": "4 1\n1 1\n1 1\n1 2\n1 3",
"output": "2"
}
] | 1,599,149,666 | 2,147,483,647 | Python 3 | OK | TESTS | 46 | 218 | 307,200 | a=input().split()
n=int(a[0])
k=int(a[1])
m=[]
for i in range(n):
c=input().split()
m.append([int(c[0]), 50-int(c[1])])
m.sort()
m.reverse()
src=m[k-1]
count=0
for i in range(n):
if m[i]==src:
count+=1
print(count)
| Title: Rank List
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Another programming contest is over. You got hold of the contest's final results table. The table has the following data. For each team we are shown two numbers: the number of problems and the total penalty time. However, for no team we are shown its final place.
You know the rules of comparing the results of two given teams very well. Let's say that team *a* solved *p**a* problems with total penalty time *t**a* and team *b* solved *p**b* problems with total penalty time *t**b*. Team *a* gets a higher place than team *b* in the end, if it either solved more problems on the contest, or solved the same number of problems but in less total time. In other words, team *a* gets a higher place than team *b* in the final results' table if either *p**a*<=><=*p**b*, or *p**a*<==<=*p**b* and *t**a*<=<<=*t**b*.
It is considered that the teams that solve the same number of problems with the same penalty time share all corresponding places. More formally, let's say there is a group of *x* teams that solved the same number of problems with the same penalty time. Let's also say that *y* teams performed better than the teams from this group. In this case all teams from the group share places *y*<=+<=1, *y*<=+<=2, ..., *y*<=+<=*x*. The teams that performed worse than the teams from this group, get their places in the results table starting from the *y*<=+<=*x*<=+<=1-th place.
Your task is to count what number of teams from the given list shared the *k*-th place.
Input Specification:
The first line contains two integers *n* and *k* (1<=≤<=*k*<=≤<=*n*<=≤<=50). Then *n* lines contain the description of the teams: the *i*-th line contains two integers *p**i* and *t**i* (1<=≤<=*p**i*,<=*t**i*<=≤<=50) — the number of solved problems and the total penalty time of the *i*-th team, correspondingly. All numbers in the lines are separated by spaces.
Output Specification:
In the only line print the sought number of teams that got the *k*-th place in the final results' table.
Demo Input:
['7 2\n4 10\n4 10\n4 10\n3 20\n2 1\n2 1\n1 10\n', '5 4\n3 1\n3 1\n5 3\n3 1\n3 1\n']
Demo Output:
['3\n', '4\n']
Note:
The final results' table for the first sample is:
- 1-3 places — 4 solved problems, the penalty time equals 10 - 4 place — 3 solved problems, the penalty time equals 20 - 5-6 places — 2 solved problems, the penalty time equals 1 - 7 place — 1 solved problem, the penalty time equals 10
The table shows that the second place is shared by the teams that solved 4 problems with penalty time 10. There are 3 such teams.
The final table for the second sample is:
- 1 place — 5 solved problems, the penalty time equals 3 - 2-5 places — 3 solved problems, the penalty time equals 1
The table shows that the fourth place is shared by the teams that solved 3 problems with penalty time 1. There are 4 such teams. | ```python
a=input().split()
n=int(a[0])
k=int(a[1])
m=[]
for i in range(n):
c=input().split()
m.append([int(c[0]), 50-int(c[1])])
m.sort()
m.reverse()
src=m[k-1]
count=0
for i in range(n):
if m[i]==src:
count+=1
print(count)
``` | 3 |
|
546 | A | Soldier and Bananas | PROGRAMMING | 800 | [
"brute force",
"implementation",
"math"
] | null | null | A soldier wants to buy *w* bananas in the shop. He has to pay *k* dollars for the first banana, 2*k* dollars for the second one and so on (in other words, he has to pay *i*·*k* dollars for the *i*-th banana).
He has *n* dollars. How many dollars does he have to borrow from his friend soldier to buy *w* bananas? | The first line contains three positive integers *k*,<=*n*,<=*w* (1<=<=≤<=<=*k*,<=*w*<=<=≤<=<=1000, 0<=≤<=*n*<=≤<=109), the cost of the first banana, initial number of dollars the soldier has and number of bananas he wants. | Output one integer — the amount of dollars that the soldier must borrow from his friend. If he doesn't have to borrow money, output 0. | [
"3 17 4\n"
] | [
"13"
] | none | 500 | [
{
"input": "3 17 4",
"output": "13"
},
{
"input": "1 2 1",
"output": "0"
},
{
"input": "1 1 1",
"output": "0"
},
{
"input": "1 5 6",
"output": "16"
},
{
"input": "1 1000000000 1",
"output": "0"
},
{
"input": "1000 0 1000",
"output": "500500000"
},
{
"input": "859 453892 543",
"output": "126416972"
},
{
"input": "1000 1000000000 1000",
"output": "0"
},
{
"input": "1000 500500000 1000",
"output": "0"
},
{
"input": "1000 500500001 1000",
"output": "0"
},
{
"input": "1000 500499999 1000",
"output": "1"
},
{
"input": "634 87973 214",
"output": "14497197"
},
{
"input": "432 10000 241",
"output": "12587552"
},
{
"input": "111 111111111 111",
"output": "0"
},
{
"input": "20 43 3",
"output": "77"
}
] | 1,699,103,934 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 1 | 31 | 0 | a,b,c=map(int,input().split())
k=0
for i in range(c+1):
k=k+i*a
print(k-b)
| Title: Soldier and Bananas
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A soldier wants to buy *w* bananas in the shop. He has to pay *k* dollars for the first banana, 2*k* dollars for the second one and so on (in other words, he has to pay *i*·*k* dollars for the *i*-th banana).
He has *n* dollars. How many dollars does he have to borrow from his friend soldier to buy *w* bananas?
Input Specification:
The first line contains three positive integers *k*,<=*n*,<=*w* (1<=<=≤<=<=*k*,<=*w*<=<=≤<=<=1000, 0<=≤<=*n*<=≤<=109), the cost of the first banana, initial number of dollars the soldier has and number of bananas he wants.
Output Specification:
Output one integer — the amount of dollars that the soldier must borrow from his friend. If he doesn't have to borrow money, output 0.
Demo Input:
['3 17 4\n']
Demo Output:
['13']
Note:
none | ```python
a,b,c=map(int,input().split())
k=0
for i in range(c+1):
k=k+i*a
print(k-b)
``` | 0 |
|
939 | A | Love Triangle | PROGRAMMING | 800 | [
"graphs"
] | null | null | As you could know there are no male planes nor female planes. However, each plane on Earth likes some other plane. There are *n* planes on Earth, numbered from 1 to *n*, and the plane with number *i* likes the plane with number *f**i*, where 1<=≤<=*f**i*<=≤<=*n* and *f**i*<=≠<=*i*.
We call a love triangle a situation in which plane *A* likes plane *B*, plane *B* likes plane *C* and plane *C* likes plane *A*. Find out if there is any love triangle on Earth. | The first line contains a single integer *n* (2<=≤<=*n*<=≤<=5000) — the number of planes.
The second line contains *n* integers *f*1,<=*f*2,<=...,<=*f**n* (1<=≤<=*f**i*<=≤<=*n*, *f**i*<=≠<=*i*), meaning that the *i*-th plane likes the *f**i*-th. | Output «YES» if there is a love triangle consisting of planes on Earth. Otherwise, output «NO».
You can output any letter in lower case or in upper case. | [
"5\n2 4 5 1 3\n",
"5\n5 5 5 5 1\n"
] | [
"YES\n",
"NO\n"
] | In first example plane 2 likes plane 4, plane 4 likes plane 1, plane 1 likes plane 2 and that is a love triangle.
In second example there are no love triangles. | 500 | [
{
"input": "5\n2 4 5 1 3",
"output": "YES"
},
{
"input": "5\n5 5 5 5 1",
"output": "NO"
},
{
"input": "3\n3 1 2",
"output": "YES"
},
{
"input": "10\n4 10 9 5 3 1 5 10 6 4",
"output": "NO"
},
{
"input": "10\n5 5 4 9 10 9 9 5 3 1",
"output": "YES"
},
{
"input": "100\n50 40 60 87 39 58 44 84 46 68 16 57 77 87 92 95 42 31 74 15 36 84 30 3 47 15 87 90 76 66 6 63 74 19 40 49 6 84 41 9 77 34 7 12 11 73 58 24 81 14 81 29 65 100 1 85 64 32 38 4 54 67 32 81 80 7 100 71 29 80 4 52 47 7 78 56 52 75 81 37 16 41 27 28 58 60 62 47 29 40 37 14 59 91 12 54 25 58 12 43",
"output": "NO"
},
{
"input": "100\n25 6 46 37 87 99 70 31 46 12 94 40 87 56 28 8 94 39 13 12 67 13 71 39 83 48 40 14 62 41 16 71 20 41 83 41 68 98 23 82 62 83 62 35 49 22 31 21 66 98 54 39 34 52 11 28 47 89 25 44 68 36 91 46 82 86 88 48 27 93 7 9 53 36 16 100 84 84 44 25 58 66 16 46 72 21 91 78 4 17 44 17 47 67 93 89 75 44 56 50",
"output": "YES"
},
{
"input": "2\n2 1",
"output": "NO"
},
{
"input": "3\n2 3 1",
"output": "YES"
},
{
"input": "5\n2 1 4 5 3",
"output": "YES"
},
{
"input": "5\n5 4 5 5 2",
"output": "YES"
}
] | 1,668,615,573 | 2,147,483,647 | Python 3 | OK | TESTS | 16 | 46 | 307,200 | from sys import stdin
def decide(dct):
for i in dct.keys():
if dct[dct[dct[i]]] == i:
return 'YES'
return 'NO'
def main():
planes = int(stdin.readline().strip())
edges = stdin.readline().strip().split()
dct = {}
for i in range(1, planes+1):
dct[i] = int(edges[i-1])
result = decide(dct)
print(result)
main() | Title: Love Triangle
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
As you could know there are no male planes nor female planes. However, each plane on Earth likes some other plane. There are *n* planes on Earth, numbered from 1 to *n*, and the plane with number *i* likes the plane with number *f**i*, where 1<=≤<=*f**i*<=≤<=*n* and *f**i*<=≠<=*i*.
We call a love triangle a situation in which plane *A* likes plane *B*, plane *B* likes plane *C* and plane *C* likes plane *A*. Find out if there is any love triangle on Earth.
Input Specification:
The first line contains a single integer *n* (2<=≤<=*n*<=≤<=5000) — the number of planes.
The second line contains *n* integers *f*1,<=*f*2,<=...,<=*f**n* (1<=≤<=*f**i*<=≤<=*n*, *f**i*<=≠<=*i*), meaning that the *i*-th plane likes the *f**i*-th.
Output Specification:
Output «YES» if there is a love triangle consisting of planes on Earth. Otherwise, output «NO».
You can output any letter in lower case or in upper case.
Demo Input:
['5\n2 4 5 1 3\n', '5\n5 5 5 5 1\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In first example plane 2 likes plane 4, plane 4 likes plane 1, plane 1 likes plane 2 and that is a love triangle.
In second example there are no love triangles. | ```python
from sys import stdin
def decide(dct):
for i in dct.keys():
if dct[dct[dct[i]]] == i:
return 'YES'
return 'NO'
def main():
planes = int(stdin.readline().strip())
edges = stdin.readline().strip().split()
dct = {}
for i in range(1, planes+1):
dct[i] = int(edges[i-1])
result = decide(dct)
print(result)
main()
``` | 3 |
|
611 | B | New Year and Old Property | PROGRAMMING | 1,300 | [
"bitmasks",
"brute force",
"implementation"
] | null | null | The year 2015 is almost over.
Limak is a little polar bear. He has recently learnt about the binary system. He noticed that the passing year has exactly one zero in its representation in the binary system — 201510<==<=111110111112. Note that he doesn't care about the number of zeros in the decimal representation.
Limak chose some interval of years. He is going to count all years from this interval that have exactly one zero in the binary representation. Can you do it faster?
Assume that all positive integers are always written without leading zeros. | The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=1018) — the first year and the last year in Limak's interval respectively. | Print one integer – the number of years Limak will count in his chosen interval. | [
"5 10\n",
"2015 2015\n",
"100 105\n",
"72057594000000000 72057595000000000\n"
] | [
"2\n",
"1\n",
"0\n",
"26\n"
] | In the first sample Limak's interval contains numbers 5<sub class="lower-index">10</sub> = 101<sub class="lower-index">2</sub>, 6<sub class="lower-index">10</sub> = 110<sub class="lower-index">2</sub>, 7<sub class="lower-index">10</sub> = 111<sub class="lower-index">2</sub>, 8<sub class="lower-index">10</sub> = 1000<sub class="lower-index">2</sub>, 9<sub class="lower-index">10</sub> = 1001<sub class="lower-index">2</sub> and 10<sub class="lower-index">10</sub> = 1010<sub class="lower-index">2</sub>. Two of them (101<sub class="lower-index">2</sub> and 110<sub class="lower-index">2</sub>) have the described property. | 750 | [
{
"input": "5 10",
"output": "2"
},
{
"input": "2015 2015",
"output": "1"
},
{
"input": "100 105",
"output": "0"
},
{
"input": "72057594000000000 72057595000000000",
"output": "26"
},
{
"input": "1 100",
"output": "16"
},
{
"input": "1000000000000000000 1000000000000000000",
"output": "0"
},
{
"input": "1 1000000000000000000",
"output": "1712"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "1 4",
"output": "1"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 7",
"output": "3"
},
{
"input": "2 2",
"output": "1"
},
{
"input": "2 3",
"output": "1"
},
{
"input": "2 4",
"output": "1"
},
{
"input": "2 5",
"output": "2"
},
{
"input": "2 6",
"output": "3"
},
{
"input": "2 7",
"output": "3"
},
{
"input": "3 3",
"output": "0"
},
{
"input": "3 4",
"output": "0"
},
{
"input": "3 5",
"output": "1"
},
{
"input": "3 6",
"output": "2"
},
{
"input": "3 7",
"output": "2"
},
{
"input": "4 4",
"output": "0"
},
{
"input": "4 5",
"output": "1"
},
{
"input": "4 6",
"output": "2"
},
{
"input": "4 7",
"output": "2"
},
{
"input": "5 5",
"output": "1"
},
{
"input": "5 6",
"output": "2"
},
{
"input": "5 7",
"output": "2"
},
{
"input": "6 6",
"output": "1"
},
{
"input": "6 7",
"output": "1"
},
{
"input": "7 7",
"output": "0"
},
{
"input": "1 8",
"output": "3"
},
{
"input": "6 8",
"output": "1"
},
{
"input": "7 8",
"output": "0"
},
{
"input": "8 8",
"output": "0"
},
{
"input": "1 1022",
"output": "45"
},
{
"input": "1 1023",
"output": "45"
},
{
"input": "1 1024",
"output": "45"
},
{
"input": "1 1025",
"output": "45"
},
{
"input": "1 1026",
"output": "45"
},
{
"input": "509 1022",
"output": "11"
},
{
"input": "510 1022",
"output": "10"
},
{
"input": "511 1022",
"output": "9"
},
{
"input": "512 1022",
"output": "9"
},
{
"input": "513 1022",
"output": "9"
},
{
"input": "509 1023",
"output": "11"
},
{
"input": "510 1023",
"output": "10"
},
{
"input": "511 1023",
"output": "9"
},
{
"input": "512 1023",
"output": "9"
},
{
"input": "513 1023",
"output": "9"
},
{
"input": "509 1024",
"output": "11"
},
{
"input": "510 1024",
"output": "10"
},
{
"input": "511 1024",
"output": "9"
},
{
"input": "512 1024",
"output": "9"
},
{
"input": "513 1024",
"output": "9"
},
{
"input": "509 1025",
"output": "11"
},
{
"input": "510 1025",
"output": "10"
},
{
"input": "511 1025",
"output": "9"
},
{
"input": "512 1025",
"output": "9"
},
{
"input": "513 1025",
"output": "9"
},
{
"input": "1 1000000000",
"output": "408"
},
{
"input": "10000000000 70000000000000000",
"output": "961"
},
{
"input": "1 935829385028502935",
"output": "1712"
},
{
"input": "500000000000000000 1000000000000000000",
"output": "58"
},
{
"input": "500000000000000000 576460752303423488",
"output": "57"
},
{
"input": "576460752303423488 1000000000000000000",
"output": "1"
},
{
"input": "999999999999999999 1000000000000000000",
"output": "0"
},
{
"input": "1124800395214847 36011204832919551",
"output": "257"
},
{
"input": "1124800395214847 36011204832919550",
"output": "256"
},
{
"input": "1124800395214847 36011204832919552",
"output": "257"
},
{
"input": "1124800395214846 36011204832919551",
"output": "257"
},
{
"input": "1124800395214848 36011204832919551",
"output": "256"
},
{
"input": "1 287104476244869119",
"output": "1603"
},
{
"input": "1 287104476244869118",
"output": "1602"
},
{
"input": "1 287104476244869120",
"output": "1603"
},
{
"input": "492581209243647 1000000000000000000",
"output": "583"
},
{
"input": "492581209243646 1000000000000000000",
"output": "583"
},
{
"input": "492581209243648 1000000000000000000",
"output": "582"
},
{
"input": "1099444518911 1099444518911",
"output": "1"
},
{
"input": "1099444518910 1099444518911",
"output": "1"
},
{
"input": "1099444518911 1099444518912",
"output": "1"
},
{
"input": "1099444518910 1099444518912",
"output": "1"
},
{
"input": "864691128455135231 864691128455135231",
"output": "1"
},
{
"input": "864691128455135231 864691128455135232",
"output": "1"
},
{
"input": "864691128455135230 864691128455135232",
"output": "1"
},
{
"input": "864691128455135230 864691128455135231",
"output": "1"
},
{
"input": "864691128455135231 1000000000000000000",
"output": "1"
},
{
"input": "864691128455135232 1000000000000000000",
"output": "0"
},
{
"input": "864691128455135230 1000000000000000000",
"output": "1"
},
{
"input": "576460752303423487 576460752303423487",
"output": "0"
},
{
"input": "1 576460752303423487",
"output": "1711"
},
{
"input": "1 576460752303423486",
"output": "1711"
},
{
"input": "2 1000000000000000000",
"output": "1712"
},
{
"input": "3 1000000000000000000",
"output": "1711"
},
{
"input": "4 1000000000000000000",
"output": "1711"
},
{
"input": "5 1000000000000000000",
"output": "1711"
},
{
"input": "6 1000000000000000000",
"output": "1710"
},
{
"input": "5 6",
"output": "2"
},
{
"input": "1 2",
"output": "1"
}
] | 1,659,061,213 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 103 | 62 | 1,536,000 | l, r = map(int, input().split())
b = ['1']
ans = 0
c = 1
while(c <= 60):
for i in range(len(b) - 1, 0, -1):
b[i] = '0'
a = int(''.join(b), 2)
if(a >= l and a <= r):
ans += 1
b[i] = '1'
b.append('1')
c += 1
print(ans)
| Title: New Year and Old Property
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
The year 2015 is almost over.
Limak is a little polar bear. He has recently learnt about the binary system. He noticed that the passing year has exactly one zero in its representation in the binary system — 201510<==<=111110111112. Note that he doesn't care about the number of zeros in the decimal representation.
Limak chose some interval of years. He is going to count all years from this interval that have exactly one zero in the binary representation. Can you do it faster?
Assume that all positive integers are always written without leading zeros.
Input Specification:
The only line of the input contains two integers *a* and *b* (1<=≤<=*a*<=≤<=*b*<=≤<=1018) — the first year and the last year in Limak's interval respectively.
Output Specification:
Print one integer – the number of years Limak will count in his chosen interval.
Demo Input:
['5 10\n', '2015 2015\n', '100 105\n', '72057594000000000 72057595000000000\n']
Demo Output:
['2\n', '1\n', '0\n', '26\n']
Note:
In the first sample Limak's interval contains numbers 5<sub class="lower-index">10</sub> = 101<sub class="lower-index">2</sub>, 6<sub class="lower-index">10</sub> = 110<sub class="lower-index">2</sub>, 7<sub class="lower-index">10</sub> = 111<sub class="lower-index">2</sub>, 8<sub class="lower-index">10</sub> = 1000<sub class="lower-index">2</sub>, 9<sub class="lower-index">10</sub> = 1001<sub class="lower-index">2</sub> and 10<sub class="lower-index">10</sub> = 1010<sub class="lower-index">2</sub>. Two of them (101<sub class="lower-index">2</sub> and 110<sub class="lower-index">2</sub>) have the described property. | ```python
l, r = map(int, input().split())
b = ['1']
ans = 0
c = 1
while(c <= 60):
for i in range(len(b) - 1, 0, -1):
b[i] = '0'
a = int(''.join(b), 2)
if(a >= l and a <= r):
ans += 1
b[i] = '1'
b.append('1')
c += 1
print(ans)
``` | 3 |
|
0 | none | none | none | 0 | [
"none"
] | null | null | In a small but very proud high school it was decided to win ACM ICPC. This goal requires to compose as many teams of three as possible, but since there were only 6 students who wished to participate, the decision was to build exactly two teams.
After practice competition, participant number *i* got a score of *a**i*. Team score is defined as sum of scores of its participants. High school management is interested if it's possible to build two teams with equal scores. Your task is to answer that question. | The single line contains six integers *a*1,<=...,<=*a*6 (0<=≤<=*a**i*<=≤<=1000) — scores of the participants | Print "YES" (quotes for clarity), if it is possible to build teams with equal score, and "NO" otherwise.
You can print each character either upper- or lowercase ("YeS" and "yes" are valid when the answer is "YES"). | [
"1 3 2 1 2 1\n",
"1 1 1 1 1 99\n"
] | [
"YES\n",
"NO\n"
] | In the first sample, first team can be composed of 1st, 2nd and 6th participant, second — of 3rd, 4th and 5th: team scores are 1 + 3 + 1 = 2 + 1 + 2 = 5.
In the second sample, score of participant number 6 is too high: his team score will be definitely greater. | 0 | [
{
"input": "1 3 2 1 2 1",
"output": "YES"
},
{
"input": "1 1 1 1 1 99",
"output": "NO"
},
{
"input": "1000 1000 1000 1000 1000 1000",
"output": "YES"
},
{
"input": "0 0 0 0 0 0",
"output": "YES"
},
{
"input": "633 609 369 704 573 416",
"output": "NO"
},
{
"input": "353 313 327 470 597 31",
"output": "NO"
},
{
"input": "835 638 673 624 232 266",
"output": "NO"
},
{
"input": "936 342 19 398 247 874",
"output": "NO"
},
{
"input": "417 666 978 553 271 488",
"output": "NO"
},
{
"input": "71 66 124 199 67 147",
"output": "YES"
},
{
"input": "54 26 0 171 239 12",
"output": "YES"
},
{
"input": "72 8 186 92 267 69",
"output": "YES"
},
{
"input": "180 179 188 50 75 214",
"output": "YES"
},
{
"input": "16 169 110 136 404 277",
"output": "YES"
},
{
"input": "101 400 9 200 300 10",
"output": "YES"
},
{
"input": "101 400 200 9 300 10",
"output": "YES"
},
{
"input": "101 200 400 9 300 10",
"output": "YES"
},
{
"input": "101 400 200 300 9 10",
"output": "YES"
},
{
"input": "101 200 400 300 9 10",
"output": "YES"
},
{
"input": "4 4 4 4 5 4",
"output": "NO"
},
{
"input": "2 2 2 2 2 1",
"output": "NO"
},
{
"input": "1000 1000 999 1000 1000 1000",
"output": "NO"
},
{
"input": "129 1 10 29 8 111",
"output": "NO"
},
{
"input": "1000 1000 1000 999 999 1000",
"output": "YES"
},
{
"input": "101 200 300 400 9 10",
"output": "YES"
},
{
"input": "101 400 200 300 10 9",
"output": "YES"
},
{
"input": "101 200 400 300 10 9",
"output": "YES"
},
{
"input": "101 200 300 400 10 9",
"output": "YES"
},
{
"input": "101 200 300 10 400 9",
"output": "YES"
},
{
"input": "1 1 1 1 1 5",
"output": "NO"
},
{
"input": "8 1 1 3 3 0",
"output": "NO"
},
{
"input": "1 1 2 2 3 3",
"output": "YES"
},
{
"input": "1 2 2 5 2 5",
"output": "NO"
},
{
"input": "1 2 3 6 6 6",
"output": "NO"
},
{
"input": "36 91 7 86 51 89",
"output": "NO"
},
{
"input": "10 1 1 1 23 24",
"output": "NO"
},
{
"input": "1 1 1 10 23 24",
"output": "NO"
},
{
"input": "20 10 1 2 3 44",
"output": "NO"
},
{
"input": "7 0 14 11 8 6",
"output": "NO"
},
{
"input": "100 496 1 1 1 1",
"output": "NO"
},
{
"input": "5 4 2 5 11 3",
"output": "NO"
},
{
"input": "1 3 7 8 8 9",
"output": "YES"
},
{
"input": "1 3 4 5 18 19",
"output": "YES"
},
{
"input": "5 5 1 2 2 15",
"output": "NO"
},
{
"input": "2 1 0 0 0 5",
"output": "NO"
},
{
"input": "1 6 6 1 20 2",
"output": "NO"
},
{
"input": "2 10 0 0 0 0",
"output": "NO"
},
{
"input": "1 1 3 1 1 11",
"output": "NO"
},
{
"input": "10 10 1 1 1 37",
"output": "NO"
},
{
"input": "1 1 0 0 0 4",
"output": "NO"
},
{
"input": "1 1 10 1 1 28",
"output": "NO"
},
{
"input": "1 5 5 5 6 8",
"output": "YES"
},
{
"input": "0 2 3 4 4 5",
"output": "YES"
}
] | 1,511,353,612 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 10 | 62 | 0 | num1,num2,num3,num4,num5,num6=input().split()
num1=int(num1)
num2=int(num2)
num3=int(num3)
num4=int(num4)
num5=int(num5)
num6=int(num6)
if (num1+num2+num3 == num4+num5+num6):
print("YES")
elif (num2+num3+num4 == num1+num5+num6):
print("YES")
elif (num3+num4+num5 == num1+num2+num6):
print("YES")
elif (num1+num4+num5 == num2+num3+num6):
print("YES")
elif (num2+num4+num6 == num1+num3+num5):
print("YES")
elif (num1+num4+num6 == num2+num3+num5):
print("YES")
elif (num2+num5+num6 == num1+num3+num4):
print("YES")
elif (num3+num4+num6 == num1+num2+num5):
print("YES")
else:
print("NO") | Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In a small but very proud high school it was decided to win ACM ICPC. This goal requires to compose as many teams of three as possible, but since there were only 6 students who wished to participate, the decision was to build exactly two teams.
After practice competition, participant number *i* got a score of *a**i*. Team score is defined as sum of scores of its participants. High school management is interested if it's possible to build two teams with equal scores. Your task is to answer that question.
Input Specification:
The single line contains six integers *a*1,<=...,<=*a*6 (0<=≤<=*a**i*<=≤<=1000) — scores of the participants
Output Specification:
Print "YES" (quotes for clarity), if it is possible to build teams with equal score, and "NO" otherwise.
You can print each character either upper- or lowercase ("YeS" and "yes" are valid when the answer is "YES").
Demo Input:
['1 3 2 1 2 1\n', '1 1 1 1 1 99\n']
Demo Output:
['YES\n', 'NO\n']
Note:
In the first sample, first team can be composed of 1st, 2nd and 6th participant, second — of 3rd, 4th and 5th: team scores are 1 + 3 + 1 = 2 + 1 + 2 = 5.
In the second sample, score of participant number 6 is too high: his team score will be definitely greater. | ```python
num1,num2,num3,num4,num5,num6=input().split()
num1=int(num1)
num2=int(num2)
num3=int(num3)
num4=int(num4)
num5=int(num5)
num6=int(num6)
if (num1+num2+num3 == num4+num5+num6):
print("YES")
elif (num2+num3+num4 == num1+num5+num6):
print("YES")
elif (num3+num4+num5 == num1+num2+num6):
print("YES")
elif (num1+num4+num5 == num2+num3+num6):
print("YES")
elif (num2+num4+num6 == num1+num3+num5):
print("YES")
elif (num1+num4+num6 == num2+num3+num5):
print("YES")
elif (num2+num5+num6 == num1+num3+num4):
print("YES")
elif (num3+num4+num6 == num1+num2+num5):
print("YES")
else:
print("NO")
``` | 0 |
|
493 | B | Vasya and Wrestling | PROGRAMMING | 1,400 | [
"implementation"
] | null | null | Vasya has become interested in wrestling. In wrestling wrestlers use techniques for which they are awarded points by judges. The wrestler who gets the most points wins.
When the numbers of points of both wrestlers are equal, the wrestler whose sequence of points is lexicographically greater, wins.
If the sequences of the awarded points coincide, the wrestler who performed the last technique wins. Your task is to determine which wrestler won. | The first line contains number *n* — the number of techniques that the wrestlers have used (1<=≤<=*n*<=≤<=2·105).
The following *n* lines contain integer numbers *a**i* (|*a**i*|<=≤<=109, *a**i*<=≠<=0). If *a**i* is positive, that means that the first wrestler performed the technique that was awarded with *a**i* points. And if *a**i* is negative, that means that the second wrestler performed the technique that was awarded with (<=-<=*a**i*) points.
The techniques are given in chronological order. | If the first wrestler wins, print string "first", otherwise print "second" | [
"5\n1\n2\n-3\n-4\n3\n",
"3\n-1\n-2\n3\n",
"2\n4\n-4\n"
] | [
"second\n",
"first\n",
"second\n"
] | Sequence *x* = *x*<sub class="lower-index">1</sub>*x*<sub class="lower-index">2</sub>... *x*<sub class="lower-index">|*x*|</sub> is lexicographically larger than sequence *y* = *y*<sub class="lower-index">1</sub>*y*<sub class="lower-index">2</sub>... *y*<sub class="lower-index">|*y*|</sub>, if either |*x*| > |*y*| and *x*<sub class="lower-index">1</sub> = *y*<sub class="lower-index">1</sub>, *x*<sub class="lower-index">2</sub> = *y*<sub class="lower-index">2</sub>, ... , *x*<sub class="lower-index">|*y*|</sub> = *y*<sub class="lower-index">|*y*|</sub>, or there is such number *r* (*r* < |*x*|, *r* < |*y*|), that *x*<sub class="lower-index">1</sub> = *y*<sub class="lower-index">1</sub>, *x*<sub class="lower-index">2</sub> = *y*<sub class="lower-index">2</sub>, ... , *x*<sub class="lower-index">*r*</sub> = *y*<sub class="lower-index">*r*</sub> and *x*<sub class="lower-index">*r* + 1</sub> > *y*<sub class="lower-index">*r* + 1</sub>.
We use notation |*a*| to denote length of sequence *a*. | 1,000 | [
{
"input": "5\n1\n2\n-3\n-4\n3",
"output": "second"
},
{
"input": "3\n-1\n-2\n3",
"output": "first"
},
{
"input": "2\n4\n-4",
"output": "second"
},
{
"input": "7\n1\n2\n-3\n4\n5\n-6\n7",
"output": "first"
},
{
"input": "14\n1\n2\n3\n4\n5\n6\n7\n-8\n-9\n-10\n-11\n-12\n-13\n-14",
"output": "second"
},
{
"input": "4\n16\n12\n19\n-98",
"output": "second"
},
{
"input": "5\n-6\n-1\n-1\n5\n3",
"output": "second"
},
{
"input": "11\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1",
"output": "first"
},
{
"input": "1\n-534365",
"output": "second"
},
{
"input": "1\n10253033",
"output": "first"
},
{
"input": "3\n-1\n-2\n3",
"output": "first"
},
{
"input": "8\n1\n-2\n-3\n4\n5\n-6\n-7\n8",
"output": "second"
},
{
"input": "2\n1\n-1",
"output": "second"
},
{
"input": "5\n1\n2\n3\n4\n5",
"output": "first"
},
{
"input": "5\n-1\n-2\n-3\n-4\n-5",
"output": "second"
},
{
"input": "10\n-1\n-2\n-3\n-4\n-5\n5\n4\n3\n2\n1",
"output": "first"
},
{
"input": "131\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n1\n-1\n-1\n-1\n2",
"output": "first"
},
{
"input": "6\n-1\n-2\n-3\n1\n2\n3",
"output": "first"
},
{
"input": "3\n1000000000\n1000000000\n1000000000",
"output": "first"
},
{
"input": "12\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000",
"output": "first"
},
{
"input": "4\n1000000000\n1000000000\n1000000000\n-1000000000",
"output": "first"
},
{
"input": "20\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000",
"output": "first"
},
{
"input": "5\n1000000000\n1000000000\n-1000000000\n-1000000000\n-1000000000",
"output": "second"
},
{
"input": "4\n1\n-1000000000\n-1000000000\n-1000000000",
"output": "second"
},
{
"input": "5\n1000000000\n1000000000\n1000000000\n-1000000000\n-1000000000",
"output": "first"
},
{
"input": "4\n-1\n1000000000\n1000000000\n1000000000",
"output": "first"
},
{
"input": "11\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000",
"output": "first"
},
{
"input": "2\n-4\n4",
"output": "first"
},
{
"input": "3\n-12\n3\n9",
"output": "second"
},
{
"input": "3\n9\n1\n-10",
"output": "second"
},
{
"input": "3\n1\n2\n-3",
"output": "second"
},
{
"input": "4\n55\n5\n-5\n-55",
"output": "first"
},
{
"input": "4\n5\n-1\n1\n-5",
"output": "first"
},
{
"input": "2\n-5\n6",
"output": "first"
},
{
"input": "4\n5\n-4\n3\n-40",
"output": "second"
},
{
"input": "4\n1000000000\n1000000000\n1000000000\n-5",
"output": "first"
},
{
"input": "6\n3\n2\n1\n-3\n-1\n-2",
"output": "first"
},
{
"input": "5\n4\n1\n1\n-3\n-3",
"output": "first"
},
{
"input": "5\n208\n-52\n-52\n-52\n-52",
"output": "first"
},
{
"input": "3\n-100\n-200\n300",
"output": "first"
},
{
"input": "3\n400\n-200\n-200",
"output": "first"
},
{
"input": "3\n208\n-207\n-1",
"output": "first"
},
{
"input": "3\n98888887\n98888888\n-197777775",
"output": "second"
}
] | 1,605,788,909 | 2,147,483,647 | Python 3 | OK | TESTS | 57 | 405 | 6,553,600 | n = int(input())
pos_arr = []
neg_arr = []
pos_sum = 0
neg_sum = 0
for i in range(n):
x = int(input())
if x>0:
pos_sum += x
pos_arr.append(x)
else:
neg_sum += -x
neg_arr.append(-x)
if i==n-1:
last = x
if pos_sum>neg_sum:
print('first')
elif pos_sum<neg_sum:
print('second')
else:
if pos_arr>neg_arr:
print('first')
elif pos_arr<neg_arr:
print('second')
else:
if last<0:
print('second')
else:
print('first')
| Title: Vasya and Wrestling
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has become interested in wrestling. In wrestling wrestlers use techniques for which they are awarded points by judges. The wrestler who gets the most points wins.
When the numbers of points of both wrestlers are equal, the wrestler whose sequence of points is lexicographically greater, wins.
If the sequences of the awarded points coincide, the wrestler who performed the last technique wins. Your task is to determine which wrestler won.
Input Specification:
The first line contains number *n* — the number of techniques that the wrestlers have used (1<=≤<=*n*<=≤<=2·105).
The following *n* lines contain integer numbers *a**i* (|*a**i*|<=≤<=109, *a**i*<=≠<=0). If *a**i* is positive, that means that the first wrestler performed the technique that was awarded with *a**i* points. And if *a**i* is negative, that means that the second wrestler performed the technique that was awarded with (<=-<=*a**i*) points.
The techniques are given in chronological order.
Output Specification:
If the first wrestler wins, print string "first", otherwise print "second"
Demo Input:
['5\n1\n2\n-3\n-4\n3\n', '3\n-1\n-2\n3\n', '2\n4\n-4\n']
Demo Output:
['second\n', 'first\n', 'second\n']
Note:
Sequence *x* = *x*<sub class="lower-index">1</sub>*x*<sub class="lower-index">2</sub>... *x*<sub class="lower-index">|*x*|</sub> is lexicographically larger than sequence *y* = *y*<sub class="lower-index">1</sub>*y*<sub class="lower-index">2</sub>... *y*<sub class="lower-index">|*y*|</sub>, if either |*x*| > |*y*| and *x*<sub class="lower-index">1</sub> = *y*<sub class="lower-index">1</sub>, *x*<sub class="lower-index">2</sub> = *y*<sub class="lower-index">2</sub>, ... , *x*<sub class="lower-index">|*y*|</sub> = *y*<sub class="lower-index">|*y*|</sub>, or there is such number *r* (*r* < |*x*|, *r* < |*y*|), that *x*<sub class="lower-index">1</sub> = *y*<sub class="lower-index">1</sub>, *x*<sub class="lower-index">2</sub> = *y*<sub class="lower-index">2</sub>, ... , *x*<sub class="lower-index">*r*</sub> = *y*<sub class="lower-index">*r*</sub> and *x*<sub class="lower-index">*r* + 1</sub> > *y*<sub class="lower-index">*r* + 1</sub>.
We use notation |*a*| to denote length of sequence *a*. | ```python
n = int(input())
pos_arr = []
neg_arr = []
pos_sum = 0
neg_sum = 0
for i in range(n):
x = int(input())
if x>0:
pos_sum += x
pos_arr.append(x)
else:
neg_sum += -x
neg_arr.append(-x)
if i==n-1:
last = x
if pos_sum>neg_sum:
print('first')
elif pos_sum<neg_sum:
print('second')
else:
if pos_arr>neg_arr:
print('first')
elif pos_arr<neg_arr:
print('second')
else:
if last<0:
print('second')
else:
print('first')
``` | 3 |
|
267 | A | Subtractions | PROGRAMMING | 900 | [
"math",
"number theory"
] | null | null | You've got two numbers. As long as they are both larger than zero, they go through the same operation: subtract the lesser number from the larger one. If they equal substract one number from the another. For example, one operation transforms pair (4,17) to pair (4,13), it transforms (5,5) to (0,5).
You've got some number of pairs (*a**i*,<=*b**i*). How many operations will be performed for each of them? | The first line contains the number of pairs *n* (1<=<=≤<=<=*n*<=<=≤<=<=1000). Then follow *n* lines, each line contains a pair of positive integers *a**i*,<=*b**i* (1<=<=≤<=<=*a**i*,<=<=*b**i*<=<=≤<=<=109). | Print the sought number of operations for each pair on a single line. | [
"2\n4 17\n7 987654321\n"
] | [
"8\n141093479\n"
] | none | 500 | [
{
"input": "2\n4 17\n7 987654321",
"output": "8\n141093479"
},
{
"input": "10\n7 987654321\n7 987654321\n7 987654321\n7 987654321\n7 987654321\n7 987654321\n7 987654321\n7 987654321\n7 987654321\n7 987654321",
"output": "141093479\n141093479\n141093479\n141093479\n141093479\n141093479\n141093479\n141093479\n141093479\n141093479"
},
{
"input": "1\n536870912 32",
"output": "16777216"
},
{
"input": "20\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999\n1000000000 999999999",
"output": "1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000\n1000000000"
},
{
"input": "3\n1000000000 1\n1000000000 1\n1 100000000",
"output": "1000000000\n1000000000\n100000000"
}
] | 1,614,305,270 | 2,147,483,647 | PyPy 3 | OK | TESTS | 35 | 171 | 3,891,200 | for _ in range(int(input())):
a,b=map(int,input().split())
ans=int(0)
while a and b:
a,b=min(a,b),max(a,b)
ans,b=ans+b//a,b%a
print(ans)
| Title: Subtractions
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You've got two numbers. As long as they are both larger than zero, they go through the same operation: subtract the lesser number from the larger one. If they equal substract one number from the another. For example, one operation transforms pair (4,17) to pair (4,13), it transforms (5,5) to (0,5).
You've got some number of pairs (*a**i*,<=*b**i*). How many operations will be performed for each of them?
Input Specification:
The first line contains the number of pairs *n* (1<=<=≤<=<=*n*<=<=≤<=<=1000). Then follow *n* lines, each line contains a pair of positive integers *a**i*,<=*b**i* (1<=<=≤<=<=*a**i*,<=<=*b**i*<=<=≤<=<=109).
Output Specification:
Print the sought number of operations for each pair on a single line.
Demo Input:
['2\n4 17\n7 987654321\n']
Demo Output:
['8\n141093479\n']
Note:
none | ```python
for _ in range(int(input())):
a,b=map(int,input().split())
ans=int(0)
while a and b:
a,b=min(a,b),max(a,b)
ans,b=ans+b//a,b%a
print(ans)
``` | 3 |
|
734 | A | Anton and Danik | PROGRAMMING | 800 | [
"implementation",
"strings"
] | null | null | Anton likes to play chess, and so does his friend Danik.
Once they have played *n* games in a row. For each game it's known who was the winner — Anton or Danik. None of the games ended with a tie.
Now Anton wonders, who won more games, he or Danik? Help him determine this. | The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of games played.
The second line contains a string *s*, consisting of *n* uppercase English letters 'A' and 'D' — the outcome of each of the games. The *i*-th character of the string is equal to 'A' if the Anton won the *i*-th game and 'D' if Danik won the *i*-th game. | If Anton won more games than Danik, print "Anton" (without quotes) in the only line of the output.
If Danik won more games than Anton, print "Danik" (without quotes) in the only line of the output.
If Anton and Danik won the same number of games, print "Friendship" (without quotes). | [
"6\nADAAAA\n",
"7\nDDDAADA\n",
"6\nDADADA\n"
] | [
"Anton\n",
"Danik\n",
"Friendship\n"
] | In the first sample, Anton won 6 games, while Danik — only 1. Hence, the answer is "Anton".
In the second sample, Anton won 3 games and Danik won 4 games, so the answer is "Danik".
In the third sample, both Anton and Danik won 3 games and the answer is "Friendship". | 500 | [
{
"input": "6\nADAAAA",
"output": "Anton"
},
{
"input": "7\nDDDAADA",
"output": "Danik"
},
{
"input": "6\nDADADA",
"output": "Friendship"
},
{
"input": "10\nDDDDADDADD",
"output": "Danik"
},
{
"input": "40\nAAAAAAAAADDAAAAAAAAAAADADDAAAAAAAAAAADAA",
"output": "Anton"
},
{
"input": "200\nDDDDDDDADDDDDDAADADAADAAADAADADAAADDDADDDDDDADDDAADDDAADADDDDDADDDAAAADAAADDDDDAAADAADDDAAAADDADADDDAADDAADAAADAADAAAADDAADDADAAAADADDDAAAAAADDAADAADAADADDDAAADAAAADADDADAAAAAADADADDDADDDAADDADDDAAAAD",
"output": "Friendship"
},
{
"input": "1\nA",
"output": "Anton"
},
{
"input": "1\nD",
"output": "Danik"
},
{
"input": "2\nDA",
"output": "Friendship"
},
{
"input": "4\nDADA",
"output": "Friendship"
},
{
"input": "4\nDAAD",
"output": "Friendship"
},
{
"input": "3\nADD",
"output": "Danik"
},
{
"input": "3\nDAD",
"output": "Danik"
},
{
"input": "2\nDA",
"output": "Friendship"
},
{
"input": "379\nAADAAAAAADDAAAAAADAADADADDAAAAADADDAADAAAADDDADAAAAAAADAADAAAAAAADAAAAAAAAADAAAAAAADAAAAAAAAAAADDDADAAAAAAAADAADADAAAADAAAAAAAAAAAAAAAAADAAAADDDAADAAAAAAADAAADAAADAADDDADDAAADAAAAAADDDADDDAAADAAAADAAAAAAAAADAAADAAAAAAAAADAAAAAAAAAAAAAAAAAADADAAAAAAAAAAADAAAAADAAAADAAAAAAAAAAAAADADAADAAAAAAAADAADAAAAAAAADAAAAAAAADDDAAAAAADAAADAAAAAADAADAAAAAADAAAADADAADAAAAAADAAAADAADDAADAADAAA",
"output": "Anton"
}
] | 1,694,654,300 | 2,147,483,647 | Python 3 | OK | TESTS | 25 | 31 | 102,400 | n=input()
s=input()
na,nd=s.count("A"),s.count("D")
if na>nd:
print("Anton")
elif na==nd:
print("Friendship")
else:
print("Danik") | Title: Anton and Danik
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Anton likes to play chess, and so does his friend Danik.
Once they have played *n* games in a row. For each game it's known who was the winner — Anton or Danik. None of the games ended with a tie.
Now Anton wonders, who won more games, he or Danik? Help him determine this.
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of games played.
The second line contains a string *s*, consisting of *n* uppercase English letters 'A' and 'D' — the outcome of each of the games. The *i*-th character of the string is equal to 'A' if the Anton won the *i*-th game and 'D' if Danik won the *i*-th game.
Output Specification:
If Anton won more games than Danik, print "Anton" (without quotes) in the only line of the output.
If Danik won more games than Anton, print "Danik" (without quotes) in the only line of the output.
If Anton and Danik won the same number of games, print "Friendship" (without quotes).
Demo Input:
['6\nADAAAA\n', '7\nDDDAADA\n', '6\nDADADA\n']
Demo Output:
['Anton\n', 'Danik\n', 'Friendship\n']
Note:
In the first sample, Anton won 6 games, while Danik — only 1. Hence, the answer is "Anton".
In the second sample, Anton won 3 games and Danik won 4 games, so the answer is "Danik".
In the third sample, both Anton and Danik won 3 games and the answer is "Friendship". | ```python
n=input()
s=input()
na,nd=s.count("A"),s.count("D")
if na>nd:
print("Anton")
elif na==nd:
print("Friendship")
else:
print("Danik")
``` | 3 |
|
404 | A | Valera and X | PROGRAMMING | 1,000 | [
"implementation"
] | null | null | Valera is a little boy. Yesterday he got a huge Math hometask at school, so Valera didn't have enough time to properly learn the English alphabet for his English lesson. Unfortunately, the English teacher decided to have a test on alphabet today. At the test Valera got a square piece of squared paper. The length of the side equals *n* squares (*n* is an odd number) and each unit square contains some small letter of the English alphabet.
Valera needs to know if the letters written on the square piece of paper form letter "X". Valera's teacher thinks that the letters on the piece of paper form an "X", if:
- on both diagonals of the square paper all letters are the same; - all other squares of the paper (they are not on the diagonals) contain the same letter that is different from the letters on the diagonals.
Help Valera, write the program that completes the described task for him. | The first line contains integer *n* (3<=≤<=*n*<=<<=300; *n* is odd). Each of the next *n* lines contains *n* small English letters — the description of Valera's paper. | Print string "YES", if the letters on the paper form letter "X". Otherwise, print string "NO". Print the strings without quotes. | [
"5\nxooox\noxoxo\nsoxoo\noxoxo\nxooox\n",
"3\nwsw\nsws\nwsw\n",
"3\nxpx\npxp\nxpe\n"
] | [
"NO\n",
"YES\n",
"NO\n"
] | none | 500 | [
{
"input": "5\nxooox\noxoxo\nsoxoo\noxoxo\nxooox",
"output": "NO"
},
{
"input": "3\nwsw\nsws\nwsw",
"output": "YES"
},
{
"input": "3\nxpx\npxp\nxpe",
"output": "NO"
},
{
"input": "5\nliiil\nilili\niilii\nilili\nliiil",
"output": "YES"
},
{
"input": "7\nbwccccb\nckcccbj\nccbcbcc\ncccbccc\nccbcbcc\ncbcccbc\nbccccdt",
"output": "NO"
},
{
"input": "13\nsooooooooooos\nosoooooooooso\noosooooooosoo\nooosooooosooo\noooosooosoooo\nooooososooooo\noooooosoooooo\nooooososooooo\noooosooosoooo\nooosooooosooo\noosooooooosoo\nosoooooooooso\nsooooooooooos",
"output": "YES"
},
{
"input": "3\naaa\naaa\naaa",
"output": "NO"
},
{
"input": "3\naca\noec\nzba",
"output": "NO"
},
{
"input": "15\nrxeeeeeeeeeeeer\nereeeeeeeeeeere\needeeeeeeeeeoee\neeereeeeeeeewee\neeeereeeeebeeee\nqeeeereeejedyee\neeeeeerereeeeee\neeeeeeereeeeeee\neeeeeerereeeeze\neeeeereeereeeee\neeeereeeeegeeee\neeereeeeeeereee\neereeeeeeqeeved\ncreeeeeeceeeere\nreeerneeeeeeeer",
"output": "NO"
},
{
"input": "5\nxxxxx\nxxxxx\nxxxxx\nxxxxx\nxxxxx",
"output": "NO"
},
{
"input": "5\nxxxxx\nxxxxx\nxoxxx\nxxxxx\nxxxxx",
"output": "NO"
},
{
"input": "5\noxxxo\nxoxox\nxxxxx\nxoxox\noxxxo",
"output": "NO"
},
{
"input": "5\noxxxo\nxoxox\nxxoox\nxoxox\noxxxo",
"output": "NO"
},
{
"input": "5\noxxxo\nxoxox\nxxaxx\nxoxox\noxxxo",
"output": "NO"
},
{
"input": "5\noxxxo\nxoxox\noxoxx\nxoxox\noxxxo",
"output": "NO"
},
{
"input": "3\nxxx\naxa\nxax",
"output": "NO"
},
{
"input": "3\nxax\naxx\nxax",
"output": "NO"
},
{
"input": "3\nxax\naxa\nxxx",
"output": "NO"
},
{
"input": "3\nxax\nxxa\nxax",
"output": "NO"
},
{
"input": "3\nxax\naaa\nxax",
"output": "NO"
},
{
"input": "3\naax\naxa\nxax",
"output": "NO"
},
{
"input": "3\nxaa\naxa\nxax",
"output": "NO"
},
{
"input": "3\nxax\naxa\naax",
"output": "NO"
},
{
"input": "3\nxax\naxa\nxaa",
"output": "NO"
},
{
"input": "3\nxfx\naxa\nxax",
"output": "NO"
},
{
"input": "3\nxax\nafa\nxax",
"output": "NO"
},
{
"input": "3\nxax\naxa\nxaf",
"output": "NO"
},
{
"input": "3\nxox\nxxx\nxxx",
"output": "NO"
},
{
"input": "3\naxa\naax\nxxa",
"output": "NO"
},
{
"input": "3\nxox\noxx\nxox",
"output": "NO"
},
{
"input": "3\nxox\nooo\nxox",
"output": "NO"
},
{
"input": "3\naaa\naab\nbbb",
"output": "NO"
},
{
"input": "3\nxxx\nsxs\nxsx",
"output": "NO"
},
{
"input": "5\nabbba\nbabab\nbbbbb\nbaaab\nabbba",
"output": "NO"
},
{
"input": "5\nabaaa\nbbbbb\nbbabb\nbabab\nabbba",
"output": "NO"
},
{
"input": "5\nxoxox\noxoxo\nooxoo\noxoxo\nxooox",
"output": "NO"
},
{
"input": "3\nxox\noxx\nxxx",
"output": "NO"
},
{
"input": "5\nxoooo\noxooo\nooxoo\noooxo\noooox",
"output": "NO"
},
{
"input": "5\nxoooo\noxoxx\nooxoo\noxoxo\noxoox",
"output": "NO"
},
{
"input": "3\naaa\nbab\naba",
"output": "NO"
}
] | 1,654,138,565 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 19 | 46 | 0 | n = int(input())
s1 = input()
s = ''.join(sorted(set(s1)))
c = 1
co = 1
for i in range(n-1):
ss1 = input()
ss = ''.join(sorted(set(ss1)))
if ss!=s:
c = 0
if ss1 == s1:
co += 1
if co == n:
c = 0
if c:
print("YES")
else:
print("NO") | Title: Valera and X
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Valera is a little boy. Yesterday he got a huge Math hometask at school, so Valera didn't have enough time to properly learn the English alphabet for his English lesson. Unfortunately, the English teacher decided to have a test on alphabet today. At the test Valera got a square piece of squared paper. The length of the side equals *n* squares (*n* is an odd number) and each unit square contains some small letter of the English alphabet.
Valera needs to know if the letters written on the square piece of paper form letter "X". Valera's teacher thinks that the letters on the piece of paper form an "X", if:
- on both diagonals of the square paper all letters are the same; - all other squares of the paper (they are not on the diagonals) contain the same letter that is different from the letters on the diagonals.
Help Valera, write the program that completes the described task for him.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=<<=300; *n* is odd). Each of the next *n* lines contains *n* small English letters — the description of Valera's paper.
Output Specification:
Print string "YES", if the letters on the paper form letter "X". Otherwise, print string "NO". Print the strings without quotes.
Demo Input:
['5\nxooox\noxoxo\nsoxoo\noxoxo\nxooox\n', '3\nwsw\nsws\nwsw\n', '3\nxpx\npxp\nxpe\n']
Demo Output:
['NO\n', 'YES\n', 'NO\n']
Note:
none | ```python
n = int(input())
s1 = input()
s = ''.join(sorted(set(s1)))
c = 1
co = 1
for i in range(n-1):
ss1 = input()
ss = ''.join(sorted(set(ss1)))
if ss!=s:
c = 0
if ss1 == s1:
co += 1
if co == n:
c = 0
if c:
print("YES")
else:
print("NO")
``` | 0 |
|
990 | C | Bracket Sequences Concatenation Problem | PROGRAMMING | 1,500 | [
"implementation"
] | null | null | A bracket sequence is a string containing only characters "(" and ")".
A regular bracket sequence is a bracket sequence that can be transformed into a correct arithmetic expression by inserting characters "1" and "+" between the original characters of the sequence. For example, bracket sequences "()()", "(())" are regular (the resulting expressions are: "(1)+(1)", "((1+1)+1)"), and ")(" and "(" are not.
You are given $n$ bracket sequences $s_1, s_2, \dots , s_n$. Calculate the number of pairs $i, j \, (1 \le i, j \le n)$ such that the bracket sequence $s_i + s_j$ is a regular bracket sequence. Operation $+$ means concatenation i.e. "()(" + ")()" = "()()()".
If $s_i + s_j$ and $s_j + s_i$ are regular bracket sequences and $i \ne j$, then both pairs $(i, j)$ and $(j, i)$ must be counted in the answer. Also, if $s_i + s_i$ is a regular bracket sequence, the pair $(i, i)$ must be counted in the answer. | The first line contains one integer $n \, (1 \le n \le 3 \cdot 10^5)$ — the number of bracket sequences. The following $n$ lines contain bracket sequences — non-empty strings consisting only of characters "(" and ")". The sum of lengths of all bracket sequences does not exceed $3 \cdot 10^5$. | In the single line print a single integer — the number of pairs $i, j \, (1 \le i, j \le n)$ such that the bracket sequence $s_i + s_j$ is a regular bracket sequence. | [
"3\n)\n()\n(\n",
"2\n()\n()\n"
] | [
"2\n",
"4\n"
] | In the first example, suitable pairs are $(3, 1)$ and $(2, 2)$.
In the second example, any pair is suitable, namely $(1, 1), (1, 2), (2, 1), (2, 2)$. | 0 | [
{
"input": "3\n)\n()\n(",
"output": "2"
},
{
"input": "2\n()\n()",
"output": "4"
},
{
"input": "7\n()(\n)\n)(\n())\n(((\n()()()\n()",
"output": "6"
},
{
"input": "6\n(\n((\n(((\n))))\n)))))\n))))))",
"output": "0"
},
{
"input": "9\n(()\n((())\n(\n)\n(()()(()())))\n)\n)(()(\n)())(\n)()(",
"output": "9"
},
{
"input": "2\n(((((((((()\n)))))))))",
"output": "1"
},
{
"input": "1\n)(",
"output": "0"
},
{
"input": "1\n()",
"output": "1"
},
{
"input": "2\n(((\n)))",
"output": "1"
},
{
"input": "10\n()()(\n)((\n)()(((()(\n(((()(\n)(()((\n))\n()()()()\n))()))((\n)\n))())(",
"output": "2"
},
{
"input": "3\n)())(\n()(()(\n(((",
"output": "0"
},
{
"input": "2\n((((((((((((((((((((((((\n))))))))))))))))))))))))",
"output": "1"
},
{
"input": "2\n((\n))",
"output": "1"
}
] | 1,528,629,826 | 4,726 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 5 | 2,000 | 6,144,000 | n=int(input())
a=[]
ct=0
for k in range(n):
a.append(input())
for k in range(n):
for p in range(n):
b=[]
u=0
t=a[k]+a[p];
for q in range(len(t)):
if t[q]=='(':
b.append('(')
else:
if len(b)==0:
u=1
break
b.pop()
if u==0 and len(b)==0:
ct+=1
print(ct)
| Title: Bracket Sequences Concatenation Problem
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A bracket sequence is a string containing only characters "(" and ")".
A regular bracket sequence is a bracket sequence that can be transformed into a correct arithmetic expression by inserting characters "1" and "+" between the original characters of the sequence. For example, bracket sequences "()()", "(())" are regular (the resulting expressions are: "(1)+(1)", "((1+1)+1)"), and ")(" and "(" are not.
You are given $n$ bracket sequences $s_1, s_2, \dots , s_n$. Calculate the number of pairs $i, j \, (1 \le i, j \le n)$ such that the bracket sequence $s_i + s_j$ is a regular bracket sequence. Operation $+$ means concatenation i.e. "()(" + ")()" = "()()()".
If $s_i + s_j$ and $s_j + s_i$ are regular bracket sequences and $i \ne j$, then both pairs $(i, j)$ and $(j, i)$ must be counted in the answer. Also, if $s_i + s_i$ is a regular bracket sequence, the pair $(i, i)$ must be counted in the answer.
Input Specification:
The first line contains one integer $n \, (1 \le n \le 3 \cdot 10^5)$ — the number of bracket sequences. The following $n$ lines contain bracket sequences — non-empty strings consisting only of characters "(" and ")". The sum of lengths of all bracket sequences does not exceed $3 \cdot 10^5$.
Output Specification:
In the single line print a single integer — the number of pairs $i, j \, (1 \le i, j \le n)$ such that the bracket sequence $s_i + s_j$ is a regular bracket sequence.
Demo Input:
['3\n)\n()\n(\n', '2\n()\n()\n']
Demo Output:
['2\n', '4\n']
Note:
In the first example, suitable pairs are $(3, 1)$ and $(2, 2)$.
In the second example, any pair is suitable, namely $(1, 1), (1, 2), (2, 1), (2, 2)$. | ```python
n=int(input())
a=[]
ct=0
for k in range(n):
a.append(input())
for k in range(n):
for p in range(n):
b=[]
u=0
t=a[k]+a[p];
for q in range(len(t)):
if t[q]=='(':
b.append('(')
else:
if len(b)==0:
u=1
break
b.pop()
if u==0 and len(b)==0:
ct+=1
print(ct)
``` | 0 |
|
46 | C | Hamsters and Tigers | PROGRAMMING | 1,600 | [
"two pointers"
] | C. Hamsters and Tigers | 2 | 256 | Today there is going to be an unusual performance at the circus — hamsters and tigers will perform together! All of them stand in circle along the arena edge and now the trainer faces a difficult task: he wants to swap the animals' positions so that all the hamsters stood together and all the tigers also stood together. The trainer swaps the animals in pairs not to create a mess. He orders two animals to step out of the circle and swap places. As hamsters feel highly uncomfortable when tigers are nearby as well as tigers get nervous when there's so much potential prey around (consisting not only of hamsters but also of yummier spectators), the trainer wants to spend as little time as possible moving the animals, i.e. he wants to achieve it with the minimal number of swaps. Your task is to help him. | The first line contains number *n* (2<=≤<=*n*<=≤<=1000) which indicates the total number of animals in the arena. The second line contains the description of the animals' positions. The line consists of *n* symbols "H" and "T". The "H"s correspond to hamsters and the "T"s correspond to tigers. It is guaranteed that at least one hamster and one tiger are present on the arena. The animals are given in the order in which they are located circle-wise, in addition, the last animal stands near the first one. | Print the single number which is the minimal number of swaps that let the trainer to achieve his goal. | [
"3\nHTH\n",
"9\nHTHTHTHHT\n"
] | [
"0\n",
"2\n"
] | In the first example we shouldn't move anybody because the animals of each species already stand apart from the other species. In the second example you may swap, for example, the tiger in position 2 with the hamster in position 5 and then — the tiger in position 9 with the hamster in position 7. | 0 | [
{
"input": "3\nHTH",
"output": "0"
},
{
"input": "9\nHTHTHTHHT",
"output": "2"
},
{
"input": "2\nTH",
"output": "0"
},
{
"input": "4\nHTTH",
"output": "0"
},
{
"input": "4\nHTHT",
"output": "1"
},
{
"input": "7\nTTTHTTT",
"output": "0"
},
{
"input": "8\nHHTHHTHH",
"output": "1"
},
{
"input": "13\nHTTTHHHTTTTHH",
"output": "3"
},
{
"input": "20\nTTHTHTHHTHTTHHTTTHHH",
"output": "4"
},
{
"input": "35\nTTTTTTHTTHTTTTTHTTTTTTTTTTTHTHTTTTT",
"output": "3"
},
{
"input": "120\nTTTTTTTHTHTHTTTTTHTHTTTTHTTTTTTTTTTTTTTTTTTTTHTTHTTTTHTTHTTTTTTTTTTTTTTTHTTTTTTHTHTTHTTTTTTHTTTTTTTTTHTTHTTTTHTTTHTTTTTH",
"output": "14"
},
{
"input": "19\nHHHHHHHHHHHHHTTTHHH",
"output": "0"
},
{
"input": "87\nHTHHTTHHHHTHHHHHTTTHHTHHHHTTTTHHHTTHHTHTHTHHTTHTHHTHTHTTHHHTTTTTHTTHHHHHHTHHTHHTHTTHTHH",
"output": "17"
},
{
"input": "178\nTHHHTHTTTHTTHTTHHHHHTTTHTTHHTHTTTHTHTTTTTHHHTHTHHHTHHHTTTTTTTTHHHHTTHHTHHHHTHTTTHHHHHHTHHTHTTHTHTTTTTTTTTHHTTHHTHTTHHTHHHHHTTHHTTHHTTHHHTTHHTTTTHTHHHTHTTHTHTTTHHHHTHHTHHHTHTTTTTT",
"output": "40"
}
] | 1,692,176,208 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 62 | 0 | n = int(input())
positions = input()
tigers = positions.count('T')
# Concatenate the string to handle circular arrangement
concatenated_positions = positions + positions
min_tigers_in_window = float('inf')
window_tigers = concatenated_positions[:tigers].count('T')
min_tigers_in_window = min(min_tigers_in_window, window_tigers)
for i in range(tigers, len(concatenated_positions)):
if concatenated_positions[i - tigers] == 'T':
window_tigers -= 1
if concatenated_positions[i] == 'T':
window_tigers += 1
min_tigers_in_window = min(min_tigers_in_window, window_tigers)
min_swaps = min_tigers_in_window - tigers
print(min_swaps)
| Title: Hamsters and Tigers
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Today there is going to be an unusual performance at the circus — hamsters and tigers will perform together! All of them stand in circle along the arena edge and now the trainer faces a difficult task: he wants to swap the animals' positions so that all the hamsters stood together and all the tigers also stood together. The trainer swaps the animals in pairs not to create a mess. He orders two animals to step out of the circle and swap places. As hamsters feel highly uncomfortable when tigers are nearby as well as tigers get nervous when there's so much potential prey around (consisting not only of hamsters but also of yummier spectators), the trainer wants to spend as little time as possible moving the animals, i.e. he wants to achieve it with the minimal number of swaps. Your task is to help him.
Input Specification:
The first line contains number *n* (2<=≤<=*n*<=≤<=1000) which indicates the total number of animals in the arena. The second line contains the description of the animals' positions. The line consists of *n* symbols "H" and "T". The "H"s correspond to hamsters and the "T"s correspond to tigers. It is guaranteed that at least one hamster and one tiger are present on the arena. The animals are given in the order in which they are located circle-wise, in addition, the last animal stands near the first one.
Output Specification:
Print the single number which is the minimal number of swaps that let the trainer to achieve his goal.
Demo Input:
['3\nHTH\n', '9\nHTHTHTHHT\n']
Demo Output:
['0\n', '2\n']
Note:
In the first example we shouldn't move anybody because the animals of each species already stand apart from the other species. In the second example you may swap, for example, the tiger in position 2 with the hamster in position 5 and then — the tiger in position 9 with the hamster in position 7. | ```python
n = int(input())
positions = input()
tigers = positions.count('T')
# Concatenate the string to handle circular arrangement
concatenated_positions = positions + positions
min_tigers_in_window = float('inf')
window_tigers = concatenated_positions[:tigers].count('T')
min_tigers_in_window = min(min_tigers_in_window, window_tigers)
for i in range(tigers, len(concatenated_positions)):
if concatenated_positions[i - tigers] == 'T':
window_tigers -= 1
if concatenated_positions[i] == 'T':
window_tigers += 1
min_tigers_in_window = min(min_tigers_in_window, window_tigers)
min_swaps = min_tigers_in_window - tigers
print(min_swaps)
``` | 0 |
387 | A | George and Sleep | PROGRAMMING | 900 | [
"implementation"
] | null | null | George woke up and saw the current time *s* on the digital clock. Besides, George knows that he has slept for time *t*.
Help George! Write a program that will, given time *s* and *t*, determine the time *p* when George went to bed. Note that George could have gone to bed yesterday relatively to the current time (see the second test sample). | The first line contains current time *s* as a string in the format "hh:mm". The second line contains time *t* in the format "hh:mm" — the duration of George's sleep. It is guaranteed that the input contains the correct time in the 24-hour format, that is, 00<=≤<=*hh*<=≤<=23, 00<=≤<=*mm*<=≤<=59. | In the single line print time *p* — the time George went to bed in the format similar to the format of the time in the input. | [
"05:50\n05:44\n",
"00:00\n01:00\n",
"00:01\n00:00\n"
] | [
"00:06\n",
"23:00\n",
"00:01\n"
] | In the first sample George went to bed at "00:06". Note that you should print the time only in the format "00:06". That's why answers "0:06", "00:6" and others will be considered incorrect.
In the second sample, George went to bed yesterday.
In the third sample, George didn't do to bed at all. | 500 | [
{
"input": "05:50\n05:44",
"output": "00:06"
},
{
"input": "00:00\n01:00",
"output": "23:00"
},
{
"input": "00:01\n00:00",
"output": "00:01"
},
{
"input": "23:59\n23:59",
"output": "00:00"
},
{
"input": "23:44\n23:55",
"output": "23:49"
},
{
"input": "00:00\n13:12",
"output": "10:48"
},
{
"input": "12:00\n23:59",
"output": "12:01"
},
{
"input": "12:44\n12:44",
"output": "00:00"
},
{
"input": "05:55\n07:12",
"output": "22:43"
},
{
"input": "07:12\n05:55",
"output": "01:17"
},
{
"input": "22:22\n22:22",
"output": "00:00"
},
{
"input": "22:22\n22:23",
"output": "23:59"
},
{
"input": "23:24\n23:23",
"output": "00:01"
},
{
"input": "00:00\n00:00",
"output": "00:00"
},
{
"input": "23:30\n00:00",
"output": "23:30"
},
{
"input": "01:00\n00:00",
"output": "01:00"
},
{
"input": "05:44\n06:00",
"output": "23:44"
},
{
"input": "00:00\n23:59",
"output": "00:01"
},
{
"input": "21:00\n01:00",
"output": "20:00"
},
{
"input": "21:21\n12:21",
"output": "09:00"
},
{
"input": "12:21\n21:12",
"output": "15:09"
},
{
"input": "12:33\n23:33",
"output": "13:00"
},
{
"input": "07:55\n05:53",
"output": "02:02"
},
{
"input": "19:30\n02:00",
"output": "17:30"
},
{
"input": "21:30\n02:00",
"output": "19:30"
},
{
"input": "19:30\n09:30",
"output": "10:00"
},
{
"input": "13:08\n00:42",
"output": "12:26"
},
{
"input": "13:04\n09:58",
"output": "03:06"
},
{
"input": "21:21\n23:06",
"output": "22:15"
},
{
"input": "20:53\n10:23",
"output": "10:30"
},
{
"input": "12:59\n00:45",
"output": "12:14"
},
{
"input": "12:39\n22:21",
"output": "14:18"
},
{
"input": "21:10\n13:50",
"output": "07:20"
},
{
"input": "03:38\n23:46",
"output": "03:52"
},
{
"input": "03:48\n00:41",
"output": "03:07"
},
{
"input": "07:43\n12:27",
"output": "19:16"
},
{
"input": "03:23\n08:52",
"output": "18:31"
},
{
"input": "16:04\n10:28",
"output": "05:36"
},
{
"input": "12:53\n08:37",
"output": "04:16"
},
{
"input": "13:43\n17:23",
"output": "20:20"
},
{
"input": "00:00\n00:01",
"output": "23:59"
},
{
"input": "10:10\n01:01",
"output": "09:09"
},
{
"input": "10:05\n00:00",
"output": "10:05"
},
{
"input": "09:09\n00:00",
"output": "09:09"
},
{
"input": "09:10\n00:01",
"output": "09:09"
},
{
"input": "23:24\n00:28",
"output": "22:56"
},
{
"input": "10:00\n01:00",
"output": "09:00"
}
] | 1,683,787,826 | 2,147,483,647 | Python 3 | OK | TESTS | 47 | 46 | 0 | # Description of the problem can be found at http://codeforces.com/problemset/problem/387/A
l_s = list(map(int, input().split(":")))
l_t = list(map(int, input().split(":")))
if l_t[1] > l_s[1]:
l_s[0] -= 1
print("%02d:%02d" % ((l_s[0] - l_t[0]) % 24, (l_s[1] - l_t[1]) % 60)) | Title: George and Sleep
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
George woke up and saw the current time *s* on the digital clock. Besides, George knows that he has slept for time *t*.
Help George! Write a program that will, given time *s* and *t*, determine the time *p* when George went to bed. Note that George could have gone to bed yesterday relatively to the current time (see the second test sample).
Input Specification:
The first line contains current time *s* as a string in the format "hh:mm". The second line contains time *t* in the format "hh:mm" — the duration of George's sleep. It is guaranteed that the input contains the correct time in the 24-hour format, that is, 00<=≤<=*hh*<=≤<=23, 00<=≤<=*mm*<=≤<=59.
Output Specification:
In the single line print time *p* — the time George went to bed in the format similar to the format of the time in the input.
Demo Input:
['05:50\n05:44\n', '00:00\n01:00\n', '00:01\n00:00\n']
Demo Output:
['00:06\n', '23:00\n', '00:01\n']
Note:
In the first sample George went to bed at "00:06". Note that you should print the time only in the format "00:06". That's why answers "0:06", "00:6" and others will be considered incorrect.
In the second sample, George went to bed yesterday.
In the third sample, George didn't do to bed at all. | ```python
# Description of the problem can be found at http://codeforces.com/problemset/problem/387/A
l_s = list(map(int, input().split(":")))
l_t = list(map(int, input().split(":")))
if l_t[1] > l_s[1]:
l_s[0] -= 1
print("%02d:%02d" % ((l_s[0] - l_t[0]) % 24, (l_s[1] - l_t[1]) % 60))
``` | 3 |
|
844 | B | Rectangles | PROGRAMMING | 1,300 | [
"combinatorics",
"math"
] | null | null | You are given *n*<=×<=*m* table. Each cell of the table is colored white or black. Find the number of non-empty sets of cells such that:
1. All cells in a set have the same color. 1. Every two cells in a set share row or column. | The first line of input contains integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=50) — the number of rows and the number of columns correspondingly.
The next *n* lines of input contain descriptions of rows. There are *m* integers, separated by spaces, in each line. The number equals 0 if the corresponding cell is colored white and equals 1 if the corresponding cell is colored black. | Output single integer — the number of non-empty sets from the problem description. | [
"1 1\n0\n",
"2 3\n1 0 1\n0 1 0\n"
] | [
"1\n",
"8\n"
] | In the second example, there are six one-element sets. Additionally, there are two two-element sets, the first one consists of the first and the third cells of the first row, the second one consists of the first and the third cells of the second row. To sum up, there are 8 sets. | 1,000 | [
{
"input": "1 1\n0",
"output": "1"
},
{
"input": "2 3\n1 0 1\n0 1 0",
"output": "8"
},
{
"input": "2 2\n1 1\n1 1",
"output": "8"
},
{
"input": "1 10\n0 0 0 0 0 0 0 0 0 0",
"output": "1023"
},
{
"input": "11 1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1",
"output": "2047"
},
{
"input": "10 11\n1 1 0 1 1 0 0 0 1 0 0\n1 0 0 1 1 1 0 0 1 1 0\n0 0 1 0 1 1 0 1 0 1 1\n0 1 1 1 0 1 0 1 0 0 0\n1 1 1 1 1 1 1 0 1 0 0\n1 1 0 1 1 1 1 0 0 1 1\n1 0 1 0 1 0 0 1 1 1 0\n1 1 0 0 0 0 0 1 0 1 1\n1 1 0 1 1 1 0 0 1 1 0\n1 0 1 1 0 0 1 0 0 1 1",
"output": "2444"
},
{
"input": "50 1\n0\n1\n0\n1\n0\n1\n0\n1\n1\n1\n0\n0\n1\n0\n0\n1\n1\n1\n1\n0\n1\n1\n0\n1\n1\n1\n0\n1\n0\n0\n0\n1\n1\n0\n1\n1\n0\n1\n0\n1\n0\n0\n1\n0\n0\n0\n1\n1\n0\n1",
"output": "142606334"
},
{
"input": "1 50\n0 1 0 1 0 1 0 1 1 1 0 0 1 0 0 1 1 1 1 0 1 1 0 1 1 1 0 1 0 0 0 1 1 0 1 1 0 1 0 1 0 0 1 0 0 0 1 1 0 1",
"output": "142606334"
},
{
"input": "2 20\n0 1 0 0 1 0 1 0 0 0 0 0 0 0 0 0 0 0 1 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0",
"output": "589853"
},
{
"input": "5 5\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0\n0 0 0 0 0",
"output": "285"
},
{
"input": "6 6\n1 1 1 1 1 1\n1 1 1 1 1 1\n1 1 1 1 1 1\n1 1 1 1 1 1\n1 1 1 1 1 1\n1 1 1 1 1 1",
"output": "720"
},
{
"input": "21 2\n0 1\n1 1\n0 1\n0 0\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "1310745"
},
{
"input": "3 15\n1 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 1 0 1 0 0 0 0 0 1 0\n1 0 0 1 0 0 0 0 0 0 0 0 1 0 1",
"output": "22587"
},
{
"input": "10 11\n0 1 0 0 0 0 0 0 0 0 0\n0 1 0 1 0 0 1 0 0 0 0\n0 0 0 0 0 0 1 1 1 0 0\n0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 1 0 0 0 0 1 0\n0 0 0 0 0 0 1 0 0 0 0\n0 0 0 0 0 0 0 0 0 1 0\n0 0 1 0 0 0 1 1 0 0 0\n0 0 0 0 0 0 0 0 1 0 0\n0 0 1 0 1 0 0 0 0 1 1",
"output": "12047"
},
{
"input": "14 15\n0 1 0 0 0 0 0 0 1 0 0 0 1 0 1\n0 0 0 1 1 1 1 0 1 0 0 1 1 0 0\n1 0 0 0 0 1 1 0 0 0 0 0 0 0 0\n0 1 0 0 0 1 0 1 1 0 0 1 0 0 0\n0 0 1 1 0 1 0 1 0 1 1 0 1 0 0\n0 0 0 1 1 0 0 0 0 0 1 1 0 1 0\n0 0 1 0 0 0 0 0 0 1 0 0 1 1 0\n1 1 0 0 0 1 0 0 0 0 0 0 1 1 0\n0 0 0 0 1 0 1 1 1 0 0 0 1 0 1\n1 0 1 1 0 1 0 0 1 0 0 1 1 1 0\n1 0 0 0 0 1 0 0 0 0 0 1 0 0 0\n0 0 0 1 0 1 0 0 0 0 1 0 0 0 1\n0 0 1 0 1 0 0 0 1 1 1 1 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 1 0 0 0",
"output": "53166"
},
{
"input": "1 50\n0 0 0 0 0 0 0 1 0 0 0 0 1 0 1 0 0 0 0 0 0 0 0 0 0 1 1 0 0 0 0 0 0 0 1 1 0 0 1 0 0 0 0 1 0 0 0 1 0 0",
"output": "1099511628798"
},
{
"input": "50 1\n0\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n0\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n0\n1\n1\n1\n1\n1\n1\n1\n0\n1\n1\n1\n1\n0\n1\n1\n1\n1\n1",
"output": "35184372088862"
},
{
"input": "1 50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "1125899906842623"
},
{
"input": "5 50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "5629499534214415"
},
{
"input": "32 2\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1\n1 1",
"output": "8589934622"
},
{
"input": "1 50\n0 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "562949953421312"
},
{
"input": "50 1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1\n1",
"output": "1125899906842623"
},
{
"input": "1 49\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "562949953421311"
},
{
"input": "2 50\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "2251799813685296"
},
{
"input": "3 50\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "3377699720528069"
},
{
"input": "1 50\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "1125899906842623"
},
{
"input": "1 40\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "1099511627775"
},
{
"input": "1 33\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "8589934591"
},
{
"input": "2 40\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "2199023255590"
},
{
"input": "1 35\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "34359738367"
},
{
"input": "50 1\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0\n0",
"output": "1125899906842623"
}
] | 1,572,325,704 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 2 | 108 | 0 | n, m = map(int, input().split())
mat = []
for i in range(n):
mat.append([int(i) for i in input().split()])
cont = 0
for row in mat:
ones = row.count(1)
cont += 2**ones - 1
zeroes = row.count(0)
cont += 2**zeroes - 1
mat = map(list, zip(*mat))
for row in mat:
ones = row.count(1)
cont += max(2**ones - 2, 0)
zeroes = row.count(0)
cont += max(2**zeroes - 2, 0)
print(cont)
| Title: Rectangles
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given *n*<=×<=*m* table. Each cell of the table is colored white or black. Find the number of non-empty sets of cells such that:
1. All cells in a set have the same color. 1. Every two cells in a set share row or column.
Input Specification:
The first line of input contains integers *n* and *m* (1<=≤<=*n*,<=*m*<=≤<=50) — the number of rows and the number of columns correspondingly.
The next *n* lines of input contain descriptions of rows. There are *m* integers, separated by spaces, in each line. The number equals 0 if the corresponding cell is colored white and equals 1 if the corresponding cell is colored black.
Output Specification:
Output single integer — the number of non-empty sets from the problem description.
Demo Input:
['1 1\n0\n', '2 3\n1 0 1\n0 1 0\n']
Demo Output:
['1\n', '8\n']
Note:
In the second example, there are six one-element sets. Additionally, there are two two-element sets, the first one consists of the first and the third cells of the first row, the second one consists of the first and the third cells of the second row. To sum up, there are 8 sets. | ```python
n, m = map(int, input().split())
mat = []
for i in range(n):
mat.append([int(i) for i in input().split()])
cont = 0
for row in mat:
ones = row.count(1)
cont += 2**ones - 1
zeroes = row.count(0)
cont += 2**zeroes - 1
mat = map(list, zip(*mat))
for row in mat:
ones = row.count(1)
cont += max(2**ones - 2, 0)
zeroes = row.count(0)
cont += max(2**zeroes - 2, 0)
print(cont)
``` | 0 |
|
803 | B | Distances to Zero | PROGRAMMING | 1,200 | [
"constructive algorithms"
] | null | null | You are given the array of integer numbers *a*0,<=*a*1,<=...,<=*a**n*<=-<=1. For each element find the distance to the nearest zero (to the element which equals to zero). There is at least one zero element in the given array. | The first line contains integer *n* (1<=≤<=*n*<=≤<=2·105) — length of the array *a*. The second line contains integer elements of the array separated by single spaces (<=-<=109<=≤<=*a**i*<=≤<=109). | Print the sequence *d*0,<=*d*1,<=...,<=*d**n*<=-<=1, where *d**i* is the difference of indices between *i* and nearest *j* such that *a**j*<==<=0. It is possible that *i*<==<=*j*. | [
"9\n2 1 0 3 0 0 3 2 4\n",
"5\n0 1 2 3 4\n",
"7\n5 6 0 1 -2 3 4\n"
] | [
"2 1 0 1 0 0 1 2 3 ",
"0 1 2 3 4 ",
"2 1 0 1 2 3 4 "
] | none | 0 | [
{
"input": "9\n2 1 0 3 0 0 3 2 4",
"output": "2 1 0 1 0 0 1 2 3 "
},
{
"input": "5\n0 1 2 3 4",
"output": "0 1 2 3 4 "
},
{
"input": "7\n5 6 0 1 -2 3 4",
"output": "2 1 0 1 2 3 4 "
},
{
"input": "1\n0",
"output": "0 "
},
{
"input": "2\n0 0",
"output": "0 0 "
},
{
"input": "2\n0 1",
"output": "0 1 "
},
{
"input": "2\n1 0",
"output": "1 0 "
},
{
"input": "5\n0 1000000000 1000000000 1000000000 1000000000",
"output": "0 1 2 3 4 "
},
{
"input": "5\n-1000000000 -1000000000 0 1000000000 1000000000",
"output": "2 1 0 1 2 "
},
{
"input": "5\n-1000000000 1000000000 1000000000 1000000000 0",
"output": "4 3 2 1 0 "
},
{
"input": "15\n1000000000 -1000000000 -1000000000 1000000000 -1000000000 -1000000000 -1000000000 1000000000 1000000000 -1000000000 -1000000000 -1000000000 -1000000000 1000000000 0",
"output": "14 13 12 11 10 9 8 7 6 5 4 3 2 1 0 "
},
{
"input": "15\n0 0 0 0 1000000000 -1000000000 -1000000000 -1000000000 -1000000000 1000000000 1000000000 1000000000 -1000000000 -1000000000 1000000000",
"output": "0 0 0 0 1 2 3 4 5 6 7 8 9 10 11 "
},
{
"input": "15\n-1000000000 1000000000 1000000000 -1000000000 -1000000000 1000000000 0 -1000000000 -1000000000 0 0 1000000000 -1000000000 0 -1000000000",
"output": "6 5 4 3 2 1 0 1 1 0 0 1 1 0 1 "
},
{
"input": "15\n-1000000000 -1000000000 1000000000 1000000000 -1000000000 1000000000 1000000000 -1000000000 1000000000 1000000000 1000000000 0 0 0 0",
"output": "11 10 9 8 7 6 5 4 3 2 1 0 0 0 0 "
},
{
"input": "4\n0 0 2 0",
"output": "0 0 1 0 "
},
{
"input": "15\n1 2 3 4 0 1 2 3 -5 -4 -3 -1 0 5 4",
"output": "4 3 2 1 0 1 2 3 4 3 2 1 0 1 2 "
},
{
"input": "2\n0 -1",
"output": "0 1 "
},
{
"input": "5\n0 -1 -1 -1 0",
"output": "0 1 2 1 0 "
},
{
"input": "5\n0 0 0 -1 0",
"output": "0 0 0 1 0 "
},
{
"input": "3\n0 0 -1",
"output": "0 0 1 "
},
{
"input": "3\n0 -1 -1",
"output": "0 1 2 "
},
{
"input": "12\n0 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 0",
"output": "0 1 2 3 4 5 5 4 3 2 1 0 "
},
{
"input": "18\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 -1",
"output": "0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 "
},
{
"input": "30\n0 0 0 0 0 0 0 0 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1 -1",
"output": "0 0 0 0 0 0 0 0 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 "
},
{
"input": "1\n0",
"output": "0 "
},
{
"input": "1\n0",
"output": "0 "
},
{
"input": "1\n0",
"output": "0 "
},
{
"input": "2\n0 -1000000000",
"output": "0 1 "
},
{
"input": "2\n0 1000000000",
"output": "0 1 "
},
{
"input": "2\n-1000000000 0",
"output": "1 0 "
},
{
"input": "2\n0 0",
"output": "0 0 "
},
{
"input": "2\n0 0",
"output": "0 0 "
},
{
"input": "2\n0 0",
"output": "0 0 "
},
{
"input": "3\n0 -1000000000 -1000000000",
"output": "0 1 2 "
},
{
"input": "3\n0 1000000000 1000000000",
"output": "0 1 2 "
},
{
"input": "3\n1000000000 1000000000 0",
"output": "2 1 0 "
},
{
"input": "3\n0 0 -1000000000",
"output": "0 0 1 "
},
{
"input": "3\n0 1000000000 0",
"output": "0 1 0 "
},
{
"input": "3\n-1000000000 0 0",
"output": "1 0 0 "
},
{
"input": "3\n0 0 0",
"output": "0 0 0 "
},
{
"input": "3\n0 0 0",
"output": "0 0 0 "
},
{
"input": "3\n0 0 0",
"output": "0 0 0 "
},
{
"input": "4\n0 -1000000000 -1000000000 -1000000000",
"output": "0 1 2 3 "
},
{
"input": "4\n1000000000 -1000000000 0 -1000000000",
"output": "2 1 0 1 "
},
{
"input": "4\n1000000000 -1000000000 1000000000 0",
"output": "3 2 1 0 "
},
{
"input": "4\n0 0 -1000000000 1000000000",
"output": "0 0 1 2 "
},
{
"input": "4\n0 0 1000000000 -1000000000",
"output": "0 0 1 2 "
},
{
"input": "4\n-1000000000 1000000000 0 0",
"output": "2 1 0 0 "
},
{
"input": "4\n0 0 0 -1000000000",
"output": "0 0 0 1 "
},
{
"input": "4\n1000000000 0 0 0",
"output": "1 0 0 0 "
},
{
"input": "4\n1000000000 0 0 0",
"output": "1 0 0 0 "
},
{
"input": "4\n0 0 0 0",
"output": "0 0 0 0 "
},
{
"input": "4\n0 0 0 0",
"output": "0 0 0 0 "
},
{
"input": "4\n0 0 0 0",
"output": "0 0 0 0 "
},
{
"input": "5\n0 1000000000 1000000000 1000000000 1000000000",
"output": "0 1 2 3 4 "
},
{
"input": "5\n1000000000 -1000000000 -1000000000 1000000000 0",
"output": "4 3 2 1 0 "
},
{
"input": "5\n1000000000 -1000000000 1000000000 -1000000000 0",
"output": "4 3 2 1 0 "
},
{
"input": "5\n0 0 -1000000000 -1000000000 -1000000000",
"output": "0 0 1 2 3 "
},
{
"input": "5\n1000000000 0 -1000000000 0 -1000000000",
"output": "1 0 1 0 1 "
},
{
"input": "5\n1000000000 1000000000 1000000000 0 0",
"output": "3 2 1 0 0 "
},
{
"input": "5\n0 0 0 -1000000000 -1000000000",
"output": "0 0 0 1 2 "
},
{
"input": "5\n-1000000000 1000000000 0 0 0",
"output": "2 1 0 0 0 "
},
{
"input": "5\n1000000000 1000000000 0 0 0",
"output": "2 1 0 0 0 "
},
{
"input": "5\n0 0 0 0 -1000000000",
"output": "0 0 0 0 1 "
},
{
"input": "5\n0 0 1000000000 0 0",
"output": "0 0 1 0 0 "
},
{
"input": "5\n1000000000 0 0 0 0",
"output": "1 0 0 0 0 "
},
{
"input": "5\n0 0 0 0 0",
"output": "0 0 0 0 0 "
},
{
"input": "5\n0 0 0 0 0",
"output": "0 0 0 0 0 "
},
{
"input": "5\n0 0 0 0 0",
"output": "0 0 0 0 0 "
},
{
"input": "6\n0 1000000000 -1000000000 1000000000 -1000000000 1000000000",
"output": "0 1 2 3 4 5 "
},
{
"input": "6\n-1000000000 -1000000000 1000000000 1000000000 1000000000 0",
"output": "5 4 3 2 1 0 "
},
{
"input": "6\n-1000000000 1000000000 -1000000000 1000000000 -1000000000 0",
"output": "5 4 3 2 1 0 "
},
{
"input": "6\n0 0 1000000000 1000000000 -1000000000 -1000000000",
"output": "0 0 1 2 3 4 "
},
{
"input": "6\n0 0 1000000000 1000000000 -1000000000 -1000000000",
"output": "0 0 1 2 3 4 "
},
{
"input": "6\n-1000000000 1000000000 -1000000000 -1000000000 0 0",
"output": "4 3 2 1 0 0 "
},
{
"input": "6\n0 0 0 -1000000000 1000000000 1000000000",
"output": "0 0 0 1 2 3 "
},
{
"input": "6\n-1000000000 1000000000 -1000000000 0 0 0",
"output": "3 2 1 0 0 0 "
},
{
"input": "6\n-1000000000 -1000000000 1000000000 0 0 0",
"output": "3 2 1 0 0 0 "
},
{
"input": "6\n0 0 0 0 -1000000000 1000000000",
"output": "0 0 0 0 1 2 "
},
{
"input": "6\n0 0 0 -1000000000 1000000000 0",
"output": "0 0 0 1 1 0 "
},
{
"input": "6\n1000000000 1000000000 0 0 0 0",
"output": "2 1 0 0 0 0 "
},
{
"input": "6\n0 0 0 0 0 -1000000000",
"output": "0 0 0 0 0 1 "
},
{
"input": "6\n0 0 0 1000000000 0 0",
"output": "0 0 0 1 0 0 "
},
{
"input": "6\n1000000000 0 0 0 0 0",
"output": "1 0 0 0 0 0 "
},
{
"input": "6\n0 0 0 0 0 0",
"output": "0 0 0 0 0 0 "
},
{
"input": "6\n0 0 0 0 0 0",
"output": "0 0 0 0 0 0 "
},
{
"input": "6\n0 0 0 0 0 0",
"output": "0 0 0 0 0 0 "
},
{
"input": "7\n0 -1000000000 1000000000 -1000000000 -1000000000 -1000000000 -1000000000",
"output": "0 1 2 3 4 5 6 "
},
{
"input": "7\n1000000000 1000000000 -1000000000 0 -1000000000 1000000000 -1000000000",
"output": "3 2 1 0 1 2 3 "
},
{
"input": "7\n1000000000 1000000000 -1000000000 1000000000 -1000000000 -1000000000 0",
"output": "6 5 4 3 2 1 0 "
},
{
"input": "7\n0 0 1000000000 1000000000 1000000000 1000000000 -1000000000",
"output": "0 0 1 2 3 4 5 "
},
{
"input": "7\n0 1000000000 1000000000 -1000000000 1000000000 1000000000 0",
"output": "0 1 2 3 2 1 0 "
},
{
"input": "7\n1000000000 -1000000000 -1000000000 1000000000 -1000000000 0 0",
"output": "5 4 3 2 1 0 0 "
},
{
"input": "7\n0 0 0 1000000000 -1000000000 -1000000000 1000000000",
"output": "0 0 0 1 2 3 4 "
},
{
"input": "7\n-1000000000 0 0 -1000000000 0 -1000000000 1000000000",
"output": "1 0 0 1 0 1 2 "
},
{
"input": "7\n1000000000 1000000000 1000000000 -1000000000 0 0 0",
"output": "4 3 2 1 0 0 0 "
},
{
"input": "7\n0 0 0 0 -1000000000 -1000000000 1000000000",
"output": "0 0 0 0 1 2 3 "
},
{
"input": "7\n0 -1000000000 0 0 0 -1000000000 1000000000",
"output": "0 1 0 0 0 1 2 "
},
{
"input": "7\n1000000000 1000000000 1000000000 0 0 0 0",
"output": "3 2 1 0 0 0 0 "
},
{
"input": "7\n0 0 0 0 0 -1000000000 1000000000",
"output": "0 0 0 0 0 1 2 "
},
{
"input": "7\n0 -1000000000 0 0 0 0 -1000000000",
"output": "0 1 0 0 0 0 1 "
},
{
"input": "7\n-1000000000 1000000000 0 0 0 0 0",
"output": "2 1 0 0 0 0 0 "
},
{
"input": "7\n0 0 0 0 0 0 -1000000000",
"output": "0 0 0 0 0 0 1 "
},
{
"input": "7\n0 0 0 0 0 1000000000 0",
"output": "0 0 0 0 0 1 0 "
},
{
"input": "7\n1000000000 0 0 0 0 0 0",
"output": "1 0 0 0 0 0 0 "
},
{
"input": "7\n0 0 0 0 0 0 0",
"output": "0 0 0 0 0 0 0 "
},
{
"input": "7\n0 0 0 0 0 0 0",
"output": "0 0 0 0 0 0 0 "
},
{
"input": "7\n0 0 0 0 0 0 0",
"output": "0 0 0 0 0 0 0 "
},
{
"input": "8\n0 -1000000000 -1000000000 1000000000 1000000000 1000000000 1000000000 -1000000000",
"output": "0 1 2 3 4 5 6 7 "
},
{
"input": "8\n0 -1000000000 1000000000 1000000000 1000000000 -1000000000 1000000000 1000000000",
"output": "0 1 2 3 4 5 6 7 "
},
{
"input": "8\n1000000000 -1000000000 -1000000000 -1000000000 1000000000 1000000000 1000000000 0",
"output": "7 6 5 4 3 2 1 0 "
},
{
"input": "8\n0 0 -1000000000 -1000000000 1000000000 1000000000 1000000000 -1000000000",
"output": "0 0 1 2 3 4 5 6 "
},
{
"input": "8\n1000000000 0 0 -1000000000 -1000000000 1000000000 -1000000000 -1000000000",
"output": "1 0 0 1 2 3 4 5 "
},
{
"input": "8\n1000000000 -1000000000 1000000000 -1000000000 -1000000000 -1000000000 0 0",
"output": "6 5 4 3 2 1 0 0 "
},
{
"input": "8\n0 0 0 1000000000 1000000000 -1000000000 -1000000000 -1000000000",
"output": "0 0 0 1 2 3 4 5 "
},
{
"input": "8\n-1000000000 0 0 1000000000 1000000000 0 -1000000000 1000000000",
"output": "1 0 0 1 1 0 1 2 "
},
{
"input": "8\n1000000000 1000000000 1000000000 -1000000000 -1000000000 0 0 0",
"output": "5 4 3 2 1 0 0 0 "
},
{
"input": "8\n0 0 0 0 1000000000 1000000000 1000000000 -1000000000",
"output": "0 0 0 0 1 2 3 4 "
},
{
"input": "8\n1000000000 0 1000000000 -1000000000 0 -1000000000 0 0",
"output": "1 0 1 1 0 1 0 0 "
},
{
"input": "8\n-1000000000 -1000000000 -1000000000 -1000000000 0 0 0 0",
"output": "4 3 2 1 0 0 0 0 "
},
{
"input": "8\n0 0 0 0 0 1000000000 1000000000 -1000000000",
"output": "0 0 0 0 0 1 2 3 "
},
{
"input": "8\n-1000000000 0 -1000000000 0 0 1000000000 0 0",
"output": "1 0 1 0 0 1 0 0 "
},
{
"input": "8\n1000000000 1000000000 1000000000 0 0 0 0 0",
"output": "3 2 1 0 0 0 0 0 "
},
{
"input": "8\n0 0 0 0 0 0 -1000000000 -1000000000",
"output": "0 0 0 0 0 0 1 2 "
},
{
"input": "8\n0 0 0 1000000000 -1000000000 0 0 0",
"output": "0 0 0 1 1 0 0 0 "
},
{
"input": "8\n1000000000 1000000000 0 0 0 0 0 0",
"output": "2 1 0 0 0 0 0 0 "
},
{
"input": "8\n0 0 0 0 0 0 0 -1000000000",
"output": "0 0 0 0 0 0 0 1 "
},
{
"input": "8\n0 1000000000 0 0 0 0 0 0",
"output": "0 1 0 0 0 0 0 0 "
},
{
"input": "8\n1000000000 0 0 0 0 0 0 0",
"output": "1 0 0 0 0 0 0 0 "
},
{
"input": "8\n0 0 0 0 0 0 0 0",
"output": "0 0 0 0 0 0 0 0 "
},
{
"input": "8\n0 0 0 0 0 0 0 0",
"output": "0 0 0 0 0 0 0 0 "
},
{
"input": "8\n0 0 0 0 0 0 0 0",
"output": "0 0 0 0 0 0 0 0 "
}
] | 1,672,574,927 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 15 | 2,000 | 18,022,400 | n=int(input())
a=list(map(int,input().split()))
l=[]
def dist(b,l):
mid=len(l)//2
if(len(l)==1):
return abs(b-l[0])
elif(len(l)==2):
return min(abs(b-l[0]),abs(b-l[1]))
elif(b==l[mid]):
return 0
elif(b>l[mid]):
return dist(b,l[mid:])
else:
return dist(b,l[0:mid+1])
for i in range(n):
if(a[i]==0):
l.append(i)
for i in range(n):
a[i]=dist(i,l)
print(*a)
| Title: Distances to Zero
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You are given the array of integer numbers *a*0,<=*a*1,<=...,<=*a**n*<=-<=1. For each element find the distance to the nearest zero (to the element which equals to zero). There is at least one zero element in the given array.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=2·105) — length of the array *a*. The second line contains integer elements of the array separated by single spaces (<=-<=109<=≤<=*a**i*<=≤<=109).
Output Specification:
Print the sequence *d*0,<=*d*1,<=...,<=*d**n*<=-<=1, where *d**i* is the difference of indices between *i* and nearest *j* such that *a**j*<==<=0. It is possible that *i*<==<=*j*.
Demo Input:
['9\n2 1 0 3 0 0 3 2 4\n', '5\n0 1 2 3 4\n', '7\n5 6 0 1 -2 3 4\n']
Demo Output:
['2 1 0 1 0 0 1 2 3 ', '0 1 2 3 4 ', '2 1 0 1 2 3 4 ']
Note:
none | ```python
n=int(input())
a=list(map(int,input().split()))
l=[]
def dist(b,l):
mid=len(l)//2
if(len(l)==1):
return abs(b-l[0])
elif(len(l)==2):
return min(abs(b-l[0]),abs(b-l[1]))
elif(b==l[mid]):
return 0
elif(b>l[mid]):
return dist(b,l[mid:])
else:
return dist(b,l[0:mid+1])
for i in range(n):
if(a[i]==0):
l.append(i)
for i in range(n):
a[i]=dist(i,l)
print(*a)
``` | 0 |
|
841 | B | Godsend | PROGRAMMING | 1,100 | [
"games",
"math"
] | null | null | Leha somehow found an array consisting of *n* integers. Looking at it, he came up with a task. Two players play the game on the array. Players move one by one. The first player can choose for his move a subsegment of non-zero length with an odd sum of numbers and remove it from the array, after that the remaining parts are glued together into one array and the game continues. The second player can choose a subsegment of non-zero length with an even sum and remove it. Loses the one who can not make a move. Who will win if both play optimally? | First line of input data contains single integer *n* (1<=≤<=*n*<=≤<=106) — length of the array.
Next line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109). | Output answer in single line. "First", if first player wins, and "Second" otherwise (without quotes). | [
"4\n1 3 2 3\n",
"2\n2 2\n"
] | [
"First\n",
"Second\n"
] | In first sample first player remove whole array in one move and win.
In second sample first player can't make a move and lose. | 1,000 | [
{
"input": "4\n1 3 2 3",
"output": "First"
},
{
"input": "2\n2 2",
"output": "Second"
},
{
"input": "4\n2 4 6 8",
"output": "Second"
},
{
"input": "5\n1 1 1 1 1",
"output": "First"
},
{
"input": "4\n720074544 345031254 849487632 80870826",
"output": "Second"
},
{
"input": "1\n0",
"output": "Second"
},
{
"input": "1\n999999999",
"output": "First"
},
{
"input": "2\n1 999999999",
"output": "First"
},
{
"input": "4\n3 3 4 4",
"output": "First"
},
{
"input": "2\n1 2",
"output": "First"
},
{
"input": "8\n2 2 2 1 1 2 2 2",
"output": "First"
},
{
"input": "5\n3 3 2 2 2",
"output": "First"
},
{
"input": "4\n0 1 1 0",
"output": "First"
},
{
"input": "3\n1 2 2",
"output": "First"
},
{
"input": "6\n2 2 1 1 4 2",
"output": "First"
},
{
"input": "8\n2 2 2 3 3 2 2 2",
"output": "First"
},
{
"input": "4\n2 3 3 4",
"output": "First"
},
{
"input": "10\n2 2 2 2 3 1 2 2 2 2",
"output": "First"
},
{
"input": "6\n2 2 1 1 2 2",
"output": "First"
},
{
"input": "3\n1 1 2",
"output": "First"
},
{
"input": "6\n2 4 3 3 4 6",
"output": "First"
},
{
"input": "6\n4 4 3 3 4 4",
"output": "First"
},
{
"input": "4\n1 1 2 2",
"output": "First"
},
{
"input": "4\n1 3 5 7",
"output": "First"
},
{
"input": "4\n2 1 1 2",
"output": "First"
},
{
"input": "4\n1 3 3 2",
"output": "First"
},
{
"input": "5\n3 2 2 2 2",
"output": "First"
},
{
"input": "3\n2 1 1",
"output": "First"
},
{
"input": "4\n1000000000 1000000000 1000000000 99999999",
"output": "First"
},
{
"input": "4\n2 2 1 1",
"output": "First"
},
{
"input": "5\n2 3 2 3 2",
"output": "First"
},
{
"input": "1\n1",
"output": "First"
},
{
"input": "4\n1000000000 1000000000 1000000000 1",
"output": "First"
},
{
"input": "5\n2 2 2 1 1",
"output": "First"
},
{
"input": "6\n2 1 1 1 1 2",
"output": "First"
},
{
"input": "6\n1 2 2 2 2 1",
"output": "First"
},
{
"input": "11\n2 2 2 2 2 1 2 2 2 2 2",
"output": "First"
},
{
"input": "5\n1 3 2 2 2",
"output": "First"
},
{
"input": "3\n2 3 2",
"output": "First"
},
{
"input": "2\n1 1",
"output": "First"
},
{
"input": "5\n4 4 4 3 3",
"output": "First"
},
{
"input": "5\n3 3 4 4 4",
"output": "First"
},
{
"input": "1\n2",
"output": "Second"
}
] | 1,586,206,614 | 2,147,483,647 | PyPy 3 | OK | TESTS | 88 | 1,122 | 81,203,200 | n = int(input())
a = list(map(int,input().split()))
k = sum(a)
if k%2 == 1:
print('First')
else:
found = False
for x in a:
if x % 2 == 1:
found = True
break
if found:
print('First')
else:
print('Second') | Title: Godsend
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Leha somehow found an array consisting of *n* integers. Looking at it, he came up with a task. Two players play the game on the array. Players move one by one. The first player can choose for his move a subsegment of non-zero length with an odd sum of numbers and remove it from the array, after that the remaining parts are glued together into one array and the game continues. The second player can choose a subsegment of non-zero length with an even sum and remove it. Loses the one who can not make a move. Who will win if both play optimally?
Input Specification:
First line of input data contains single integer *n* (1<=≤<=*n*<=≤<=106) — length of the array.
Next line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (0<=≤<=*a**i*<=≤<=109).
Output Specification:
Output answer in single line. "First", if first player wins, and "Second" otherwise (without quotes).
Demo Input:
['4\n1 3 2 3\n', '2\n2 2\n']
Demo Output:
['First\n', 'Second\n']
Note:
In first sample first player remove whole array in one move and win.
In second sample first player can't make a move and lose. | ```python
n = int(input())
a = list(map(int,input().split()))
k = sum(a)
if k%2 == 1:
print('First')
else:
found = False
for x in a:
if x % 2 == 1:
found = True
break
if found:
print('First')
else:
print('Second')
``` | 3 |
|
39 | H | Multiplication Table | PROGRAMMING | 1,300 | [
"implementation"
] | H. Multiplication Table | 2 | 64 | Petya studies positional notations. He has already learned to add and subtract numbers in the systems of notations with different radices and has moved on to a more complicated action — multiplication. To multiply large numbers one has to learn the multiplication table. Unfortunately, in the second grade students learn only the multiplication table of decimals (and some students even learn it in the first grade). Help Petya make a multiplication table for numbers in the system of notations with the radix *k*. | The first line contains a single integer *k* (2<=≤<=*k*<=≤<=10) — the radix of the system. | Output the multiplication table for the system of notations with the radix *k*. The table must contain *k*<=-<=1 rows and *k*<=-<=1 columns. The element on the crossing of the *i*-th row and the *j*-th column is equal to the product of *i* and *j* in the system of notations with the radix *k*. Each line may have any number of spaces between the numbers (the extra spaces in the samples are put for clarity). | [
"10\n",
"3\n"
] | [
"1 2 3 4 5 6 7 8 9\n2 4 6 8 10 12 14 16 18\n3 6 9 12 15 18 21 24 27\n4 8 12 16 20 24 28 32 36\n5 10 15 20 25 30 35 40 45\n6 12 18 24 30 36 42 48 54\n7 14 21 28 35 42 49 56 63\n8 16 24 32 40 48 56 64 72\n9 18 27 36 45 54 63 72 81\n",
"1 2\n2 11"
] | none | 0 | [
{
"input": "10",
"output": "1 2 3 4 5 6 7 8 9 \n2 4 6 8 10 12 14 16 18 \n3 6 9 12 15 18 21 24 27 \n4 8 12 16 20 24 28 32 36 \n5 10 15 20 25 30 35 40 45 \n6 12 18 24 30 36 42 48 54 \n7 14 21 28 35 42 49 56 63 \n8 16 24 32 40 48 56 64 72 \n9 18 27 36 45 54 63 72 81 "
},
{
"input": "3",
"output": "1 2 \n2 11 "
},
{
"input": "2",
"output": "1 "
},
{
"input": "4",
"output": "1 2 3 \n2 10 12 \n3 12 21 "
},
{
"input": "5",
"output": "1 2 3 4 \n2 4 11 13 \n3 11 14 22 \n4 13 22 31 "
},
{
"input": "6",
"output": "1 2 3 4 5 \n2 4 10 12 14 \n3 10 13 20 23 \n4 12 20 24 32 \n5 14 23 32 41 "
},
{
"input": "7",
"output": "1 2 3 4 5 6 \n2 4 6 11 13 15 \n3 6 12 15 21 24 \n4 11 15 22 26 33 \n5 13 21 26 34 42 \n6 15 24 33 42 51 "
},
{
"input": "8",
"output": "1 2 3 4 5 6 7 \n2 4 6 10 12 14 16 \n3 6 11 14 17 22 25 \n4 10 14 20 24 30 34 \n5 12 17 24 31 36 43 \n6 14 22 30 36 44 52 \n7 16 25 34 43 52 61 "
},
{
"input": "9",
"output": "1 2 3 4 5 6 7 8 \n2 4 6 8 11 13 15 17 \n3 6 10 13 16 20 23 26 \n4 8 13 17 22 26 31 35 \n5 11 16 22 27 33 38 44 \n6 13 20 26 33 40 46 53 \n7 15 23 31 38 46 54 62 \n8 17 26 35 44 53 62 71 "
}
] | 1,632,755,979 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 1 | 124 | 6,963,200 | k = int(input(""))
n = k-1
if n == 1:
print("1")
elif n ==2 :
print("1 2")
print("2 1")
elif n == 3 :
print("1 2 3")
print("2 4 6")
print("3 6 9")
elif n == 4:
print("1 2 3 4")
print("2 4 6 8")
print("3 6 9 12")
print("4 8 12 16")
elif n == 5:
print("1 2 3 4 5")
print("2 4 6 8 10")
print("3 6 9 12 15")
print("4 8 12 16 20")
print("5 10 15 20 25")
elif n == 6:
print("1 2 3 4 5 6")
print("2 4 6 8 10 12")
print("3 6 9 12 15 18")
print("4 8 12 16 20 24")
print("5 10 15 20 25 30")
print("6 12 18 24 30 36")
elif n == 7:
print("1 2 3 4 5 6 7")
print("2 4 6 8 10 12 14")
print("3 6 9 12 15 18 21")
print("4 8 12 16 20 24 28")
print("5 10 15 20 25 30 35")
print("6 12 18 24 30 36 42")
print("7 14 21 28 35 42 49")
elif n == 8:
print("1 2 3 4 5 6 7 8")
print("2 4 6 8 10 12 14 16")
print("3 6 9 12 15 18 21 24")
print("4 8 12 16 20 24 28 32")
print("5 10 15 20 25 30 35 40")
print("6 12 18 24 30 36 42 48")
print("7 14 21 28 35 42 49 56")
print("8 16 24 32 40 48 56 64")
else:
print("1 2 3 4 5 6 7 8 9")
print("2 4 6 8 10 12 14 16 18")
print("3 6 9 12 15 18 21 24 27")
print("4 8 12 16 20 24 28 32 36")
print("5 10 15 20 25 30 35 40 45")
print("6 12 18 24 30 36 42 48 54")
print("7 14 21 28 35 42 49 56 63")
print("8 16 24 32 40 48 56 64 72")
print("9 18 27 36 45 54 63 72 81") | Title: Multiplication Table
Time Limit: 2 seconds
Memory Limit: 64 megabytes
Problem Description:
Petya studies positional notations. He has already learned to add and subtract numbers in the systems of notations with different radices and has moved on to a more complicated action — multiplication. To multiply large numbers one has to learn the multiplication table. Unfortunately, in the second grade students learn only the multiplication table of decimals (and some students even learn it in the first grade). Help Petya make a multiplication table for numbers in the system of notations with the radix *k*.
Input Specification:
The first line contains a single integer *k* (2<=≤<=*k*<=≤<=10) — the radix of the system.
Output Specification:
Output the multiplication table for the system of notations with the radix *k*. The table must contain *k*<=-<=1 rows and *k*<=-<=1 columns. The element on the crossing of the *i*-th row and the *j*-th column is equal to the product of *i* and *j* in the system of notations with the radix *k*. Each line may have any number of spaces between the numbers (the extra spaces in the samples are put for clarity).
Demo Input:
['10\n', '3\n']
Demo Output:
['1 2 3 4 5 6 7 8 9\n2 4 6 8 10 12 14 16 18\n3 6 9 12 15 18 21 24 27\n4 8 12 16 20 24 28 32 36\n5 10 15 20 25 30 35 40 45\n6 12 18 24 30 36 42 48 54\n7 14 21 28 35 42 49 56 63\n8 16 24 32 40 48 56 64 72\n9 18 27 36 45 54 63 72 81\n', '1 2\n2 11']
Note:
none | ```python
k = int(input(""))
n = k-1
if n == 1:
print("1")
elif n ==2 :
print("1 2")
print("2 1")
elif n == 3 :
print("1 2 3")
print("2 4 6")
print("3 6 9")
elif n == 4:
print("1 2 3 4")
print("2 4 6 8")
print("3 6 9 12")
print("4 8 12 16")
elif n == 5:
print("1 2 3 4 5")
print("2 4 6 8 10")
print("3 6 9 12 15")
print("4 8 12 16 20")
print("5 10 15 20 25")
elif n == 6:
print("1 2 3 4 5 6")
print("2 4 6 8 10 12")
print("3 6 9 12 15 18")
print("4 8 12 16 20 24")
print("5 10 15 20 25 30")
print("6 12 18 24 30 36")
elif n == 7:
print("1 2 3 4 5 6 7")
print("2 4 6 8 10 12 14")
print("3 6 9 12 15 18 21")
print("4 8 12 16 20 24 28")
print("5 10 15 20 25 30 35")
print("6 12 18 24 30 36 42")
print("7 14 21 28 35 42 49")
elif n == 8:
print("1 2 3 4 5 6 7 8")
print("2 4 6 8 10 12 14 16")
print("3 6 9 12 15 18 21 24")
print("4 8 12 16 20 24 28 32")
print("5 10 15 20 25 30 35 40")
print("6 12 18 24 30 36 42 48")
print("7 14 21 28 35 42 49 56")
print("8 16 24 32 40 48 56 64")
else:
print("1 2 3 4 5 6 7 8 9")
print("2 4 6 8 10 12 14 16 18")
print("3 6 9 12 15 18 21 24 27")
print("4 8 12 16 20 24 28 32 36")
print("5 10 15 20 25 30 35 40 45")
print("6 12 18 24 30 36 42 48 54")
print("7 14 21 28 35 42 49 56 63")
print("8 16 24 32 40 48 56 64 72")
print("9 18 27 36 45 54 63 72 81")
``` | 0 |
691 | A | Fashion in Berland | PROGRAMMING | 1,000 | [
"implementation"
] | null | null | According to rules of the Berland fashion, a jacket should be fastened by all the buttons except only one, but not necessarily it should be the last one. Also if the jacket has only one button, it should be fastened, so the jacket will not swinging open.
You are given a jacket with *n* buttons. Determine if it is fastened in a right way. | The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of buttons on the jacket.
The second line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=1). The number *a**i*<==<=0 if the *i*-th button is not fastened. Otherwise *a**i*<==<=1. | In the only line print the word "YES" if the jacket is fastened in a right way. Otherwise print the word "NO". | [
"3\n1 0 1\n",
"3\n1 0 0\n"
] | [
"YES\n",
"NO\n"
] | none | 0 | [
{
"input": "3\n1 0 1",
"output": "YES"
},
{
"input": "3\n1 0 0",
"output": "NO"
},
{
"input": "3\n1 1 0",
"output": "YES"
},
{
"input": "3\n1 1 1",
"output": "NO"
},
{
"input": "3\n0 0 1",
"output": "NO"
},
{
"input": "3\n0 0 0",
"output": "NO"
},
{
"input": "3\n0 1 1",
"output": "YES"
},
{
"input": "3\n0 1 0",
"output": "NO"
},
{
"input": "2\n0 1",
"output": "YES"
},
{
"input": "2\n1 0",
"output": "YES"
},
{
"input": "2\n0 0",
"output": "NO"
},
{
"input": "2\n1 1",
"output": "NO"
},
{
"input": "1\n1",
"output": "YES"
},
{
"input": "1\n0",
"output": "NO"
},
{
"input": "10\n1 0 1 1 1 1 1 1 1 1",
"output": "YES"
},
{
"input": "5\n1 1 1 1 0",
"output": "YES"
},
{
"input": "4\n1 0 1 0",
"output": "NO"
},
{
"input": "4\n1 1 0 0",
"output": "NO"
},
{
"input": "10\n0 0 1 1 1 1 1 1 1 1",
"output": "NO"
},
{
"input": "10\n1 1 1 1 1 1 1 1 1 1",
"output": "NO"
},
{
"input": "123\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "NO"
},
{
"input": "124\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "NO"
},
{
"input": "94\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "NO"
},
{
"input": "64\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "NO"
},
{
"input": "34\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "NO"
},
{
"input": "35\n1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1 1",
"output": "NO"
},
{
"input": "5\n1 1 1 1 1",
"output": "NO"
},
{
"input": "10\n0 0 0 0 0 0 0 0 0 0",
"output": "NO"
},
{
"input": "231\n0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0",
"output": "NO"
},
{
"input": "10\n1 1 0 1 1 1 0 1 1 1",
"output": "NO"
}
] | 1,678,621,774 | 2,147,483,647 | Python 3 | OK | TESTS | 83 | 46 | 0 | n = int(input())
lst = list(map(int, input().split()))
if n == 1:
if lst[0] == 1:
print("YES")
else:
print("NO")
else:
zeros = lst.count(0)
if zeros == 1:
print("YES")
else:
print("NO") | Title: Fashion in Berland
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
According to rules of the Berland fashion, a jacket should be fastened by all the buttons except only one, but not necessarily it should be the last one. Also if the jacket has only one button, it should be fastened, so the jacket will not swinging open.
You are given a jacket with *n* buttons. Determine if it is fastened in a right way.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=1000) — the number of buttons on the jacket.
The second line contains *n* integers *a**i* (0<=≤<=*a**i*<=≤<=1). The number *a**i*<==<=0 if the *i*-th button is not fastened. Otherwise *a**i*<==<=1.
Output Specification:
In the only line print the word "YES" if the jacket is fastened in a right way. Otherwise print the word "NO".
Demo Input:
['3\n1 0 1\n', '3\n1 0 0\n']
Demo Output:
['YES\n', 'NO\n']
Note:
none | ```python
n = int(input())
lst = list(map(int, input().split()))
if n == 1:
if lst[0] == 1:
print("YES")
else:
print("NO")
else:
zeros = lst.count(0)
if zeros == 1:
print("YES")
else:
print("NO")
``` | 3 |
|
898 | A | Rounding | PROGRAMMING | 800 | [
"implementation",
"math"
] | null | null | Vasya has a non-negative integer *n*. He wants to round it to nearest integer, which ends up with 0. If *n* already ends up with 0, Vasya considers it already rounded.
For example, if *n*<==<=4722 answer is 4720. If *n*<==<=5 Vasya can round it to 0 or to 10. Both ways are correct.
For given *n* find out to which integer will Vasya round it. | The first line contains single integer *n* (0<=≤<=*n*<=≤<=109) — number that Vasya has. | Print result of rounding *n*. Pay attention that in some cases answer isn't unique. In that case print any correct answer. | [
"5\n",
"113\n",
"1000000000\n",
"5432359\n"
] | [
"0\n",
"110\n",
"1000000000\n",
"5432360\n"
] | In the first example *n* = 5. Nearest integers, that ends up with zero are 0 and 10. Any of these answers is correct, so you can print 0 or 10. | 500 | [
{
"input": "5",
"output": "0"
},
{
"input": "113",
"output": "110"
},
{
"input": "1000000000",
"output": "1000000000"
},
{
"input": "5432359",
"output": "5432360"
},
{
"input": "999999994",
"output": "999999990"
},
{
"input": "10",
"output": "10"
},
{
"input": "9",
"output": "10"
},
{
"input": "1",
"output": "0"
},
{
"input": "0",
"output": "0"
},
{
"input": "3",
"output": "0"
},
{
"input": "4",
"output": "0"
},
{
"input": "6",
"output": "10"
},
{
"input": "7",
"output": "10"
},
{
"input": "8",
"output": "10"
},
{
"input": "19",
"output": "20"
},
{
"input": "100",
"output": "100"
},
{
"input": "997",
"output": "1000"
},
{
"input": "9994",
"output": "9990"
},
{
"input": "10002",
"output": "10000"
},
{
"input": "100000",
"output": "100000"
},
{
"input": "99999",
"output": "100000"
},
{
"input": "999999999",
"output": "1000000000"
},
{
"input": "999999998",
"output": "1000000000"
},
{
"input": "999999995",
"output": "999999990"
},
{
"input": "999999990",
"output": "999999990"
},
{
"input": "1000000",
"output": "1000000"
},
{
"input": "1000010",
"output": "1000010"
},
{
"input": "10000010",
"output": "10000010"
},
{
"input": "100000011",
"output": "100000010"
},
{
"input": "400000003",
"output": "400000000"
},
{
"input": "234234",
"output": "234230"
},
{
"input": "675621",
"output": "675620"
},
{
"input": "43532",
"output": "43530"
},
{
"input": "4576453",
"output": "4576450"
},
{
"input": "65754674",
"output": "65754670"
},
{
"input": "3245526",
"output": "3245530"
},
{
"input": "123445",
"output": "123440"
},
{
"input": "234217",
"output": "234220"
},
{
"input": "23451218",
"output": "23451220"
},
{
"input": "1231239",
"output": "1231240"
},
{
"input": "1923140",
"output": "1923140"
},
{
"input": "307910310",
"output": "307910310"
},
{
"input": "780961030",
"output": "780961030"
},
{
"input": "103509421",
"output": "103509420"
},
{
"input": "576560141",
"output": "576560140"
},
{
"input": "48851642",
"output": "48851640"
},
{
"input": "226935072",
"output": "226935070"
},
{
"input": "844450763",
"output": "844450760"
},
{
"input": "22534183",
"output": "22534180"
},
{
"input": "640049874",
"output": "640049870"
},
{
"input": "818133304",
"output": "818133300"
},
{
"input": "730616285",
"output": "730616280"
},
{
"input": "613732415",
"output": "613732410"
},
{
"input": "380991216",
"output": "380991220"
},
{
"input": "559074636",
"output": "559074640"
},
{
"input": "176590327",
"output": "176590330"
},
{
"input": "354673757",
"output": "354673760"
},
{
"input": "267156738",
"output": "267156740"
},
{
"input": "150272868",
"output": "150272870"
},
{
"input": "62755859",
"output": "62755860"
},
{
"input": "945871979",
"output": "945871980"
},
{
"input": "46",
"output": "50"
},
{
"input": "999",
"output": "1000"
},
{
"input": "1397",
"output": "1400"
}
] | 1,591,480,207 | 2,147,483,647 | Python 3 | OK | TESTS | 64 | 109 | 0 | n=int(input())
z=int(str(n)[-1])
if z>=5:
print(n+10-z)
else:
print(n-z)
| Title: Rounding
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasya has a non-negative integer *n*. He wants to round it to nearest integer, which ends up with 0. If *n* already ends up with 0, Vasya considers it already rounded.
For example, if *n*<==<=4722 answer is 4720. If *n*<==<=5 Vasya can round it to 0 or to 10. Both ways are correct.
For given *n* find out to which integer will Vasya round it.
Input Specification:
The first line contains single integer *n* (0<=≤<=*n*<=≤<=109) — number that Vasya has.
Output Specification:
Print result of rounding *n*. Pay attention that in some cases answer isn't unique. In that case print any correct answer.
Demo Input:
['5\n', '113\n', '1000000000\n', '5432359\n']
Demo Output:
['0\n', '110\n', '1000000000\n', '5432360\n']
Note:
In the first example *n* = 5. Nearest integers, that ends up with zero are 0 and 10. Any of these answers is correct, so you can print 0 or 10. | ```python
n=int(input())
z=int(str(n)[-1])
if z>=5:
print(n+10-z)
else:
print(n-z)
``` | 3 |
|
0 | none | none | none | 0 | [
"none"
] | null | null | Little Nastya has a hobby, she likes to remove some letters from word, to obtain another word. But it turns out to be pretty hard for her, because she is too young. Therefore, her brother Sergey always helps her.
Sergey gives Nastya the word *t* and wants to get the word *p* out of it. Nastya removes letters in a certain order (one after another, in this order strictly), which is specified by permutation of letters' indices of the word *t*: *a*1... *a*|*t*|. We denote the length of word *x* as |*x*|. Note that after removing one letter, the indices of other letters don't change. For example, if *t*<==<="nastya" and *a*<==<=[4,<=1,<=5,<=3,<=2,<=6] then removals make the following sequence of words "nastya" "nastya" "nastya" "nastya" "nastya" "nastya" "nastya".
Sergey knows this permutation. His goal is to stop his sister at some point and continue removing by himself to get the word *p*. Since Nastya likes this activity, Sergey wants to stop her as late as possible. Your task is to determine, how many letters Nastya can remove before she will be stopped by Sergey.
It is guaranteed that the word *p* can be obtained by removing the letters from word *t*. | The first and second lines of the input contain the words *t* and *p*, respectively. Words are composed of lowercase letters of the Latin alphabet (1<=≤<=|*p*|<=<<=|*t*|<=≤<=200<=000). It is guaranteed that the word *p* can be obtained by removing the letters from word *t*.
Next line contains a permutation *a*1,<=*a*2,<=...,<=*a*|*t*| of letter indices that specifies the order in which Nastya removes letters of *t* (1<=≤<=*a**i*<=≤<=|*t*|, all *a**i* are distinct). | Print a single integer number, the maximum number of letters that Nastya can remove. | [
"ababcba\nabb\n5 3 4 1 7 6 2\n",
"bbbabb\nbb\n1 6 3 4 2 5\n"
] | [
"3",
"4"
] | In the first sample test sequence of removing made by Nastya looks like this:
"ababcba" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "ababcba" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "ababcba" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "ababcba"
Nastya can not continue, because it is impossible to get word "abb" from word "ababcba".
So, Nastya will remove only three letters. | 0 | [
{
"input": "ababcba\nabb\n5 3 4 1 7 6 2",
"output": "3"
},
{
"input": "bbbabb\nbb\n1 6 3 4 2 5",
"output": "4"
},
{
"input": "cacaccccccacccc\ncacc\n10 9 14 5 1 7 15 3 6 12 4 8 11 13 2",
"output": "9"
},
{
"input": "aaaabaaabaabaaaaaaaa\naaaa\n18 5 4 6 13 9 1 3 7 8 16 10 12 19 17 15 14 11 20 2",
"output": "16"
},
{
"input": "aaaaaaaadbaaabbbbbddaaabdadbbbbbdbbabbbabaabdbbdababbbddddbdaabbddbbbbabbbbbabadaadabaaaadbbabbbaddb\naaaaaaaaaaaaaa\n61 52 5 43 53 81 7 96 6 9 34 78 79 12 8 63 22 76 18 46 41 56 3 20 57 21 75 73 100 94 35 69 32 4 70 95 88 44 68 10 71 98 23 89 36 62 28 51 24 30 74 55 27 80 38 48 93 1 19 84 13 11 86 60 87 33 39 29 83 91 67 72 54 2 17 85 82 14 15 90 64 50 99 26 66 65 31 49 40 45 77 37 25 42 97 47 58 92 59 16",
"output": "57"
}
] | 1,488,586,206 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 9 | 2,000 | 19,763,200 | t = input()
p = input()
aData = input()
a = [int(i) for i in aData.split()]
def removeChar(string, index):
return string[:index] + string[index+1:]
def replaceChar(string, index, rep):
return string[:index] + rep + string[index+1:]
ans = 0
for i in a:
t = replaceChar(t, (i-1), "X")
# Check if p still possible
pChar = 0
possible = False
for j in t:
if j == p[pChar]:
pChar += 1
if pChar >= len(p):
possible = True
break
if possible:
ans += 1
else:
break
print(ans)
| Title: none
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Little Nastya has a hobby, she likes to remove some letters from word, to obtain another word. But it turns out to be pretty hard for her, because she is too young. Therefore, her brother Sergey always helps her.
Sergey gives Nastya the word *t* and wants to get the word *p* out of it. Nastya removes letters in a certain order (one after another, in this order strictly), which is specified by permutation of letters' indices of the word *t*: *a*1... *a*|*t*|. We denote the length of word *x* as |*x*|. Note that after removing one letter, the indices of other letters don't change. For example, if *t*<==<="nastya" and *a*<==<=[4,<=1,<=5,<=3,<=2,<=6] then removals make the following sequence of words "nastya" "nastya" "nastya" "nastya" "nastya" "nastya" "nastya".
Sergey knows this permutation. His goal is to stop his sister at some point and continue removing by himself to get the word *p*. Since Nastya likes this activity, Sergey wants to stop her as late as possible. Your task is to determine, how many letters Nastya can remove before she will be stopped by Sergey.
It is guaranteed that the word *p* can be obtained by removing the letters from word *t*.
Input Specification:
The first and second lines of the input contain the words *t* and *p*, respectively. Words are composed of lowercase letters of the Latin alphabet (1<=≤<=|*p*|<=<<=|*t*|<=≤<=200<=000). It is guaranteed that the word *p* can be obtained by removing the letters from word *t*.
Next line contains a permutation *a*1,<=*a*2,<=...,<=*a*|*t*| of letter indices that specifies the order in which Nastya removes letters of *t* (1<=≤<=*a**i*<=≤<=|*t*|, all *a**i* are distinct).
Output Specification:
Print a single integer number, the maximum number of letters that Nastya can remove.
Demo Input:
['ababcba\nabb\n5 3 4 1 7 6 2\n', 'bbbabb\nbb\n1 6 3 4 2 5\n']
Demo Output:
['3', '4']
Note:
In the first sample test sequence of removing made by Nastya looks like this:
"ababcba" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "ababcba" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "ababcba" <img align="middle" class="tex-formula" src="https://espresso.codeforces.com/70a0795f45d32287dba0eb83fc4a3f470c6e5537.png" style="max-width: 100.0%;max-height: 100.0%;"/> "ababcba"
Nastya can not continue, because it is impossible to get word "abb" from word "ababcba".
So, Nastya will remove only three letters. | ```python
t = input()
p = input()
aData = input()
a = [int(i) for i in aData.split()]
def removeChar(string, index):
return string[:index] + string[index+1:]
def replaceChar(string, index, rep):
return string[:index] + rep + string[index+1:]
ans = 0
for i in a:
t = replaceChar(t, (i-1), "X")
# Check if p still possible
pChar = 0
possible = False
for j in t:
if j == p[pChar]:
pChar += 1
if pChar >= len(p):
possible = True
break
if possible:
ans += 1
else:
break
print(ans)
``` | 0 |
|
771 | A | Bear and Friendship Condition | PROGRAMMING | 1,500 | [
"dfs and similar",
"dsu",
"graphs"
] | null | null | Bear Limak examines a social network. Its main functionality is that two members can become friends (then they can talk with each other and share funny pictures).
There are *n* members, numbered 1 through *n*. *m* pairs of members are friends. Of course, a member can't be a friend with themselves.
Let A-B denote that members A and B are friends. Limak thinks that a network is reasonable if and only if the following condition is satisfied: For every three distinct members (X, Y, Z), if X-Y and Y-Z then also X-Z.
For example: if Alan and Bob are friends, and Bob and Ciri are friends, then Alan and Ciri should be friends as well.
Can you help Limak and check if the network is reasonable? Print "YES" or "NO" accordingly, without the quotes. | The first line of the input contain two integers *n* and *m* (3<=≤<=*n*<=≤<=150<=000, ) — the number of members and the number of pairs of members that are friends.
The *i*-th of the next *m* lines contains two distinct integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*,<=*a**i*<=≠<=*b**i*). Members *a**i* and *b**i* are friends with each other. No pair of members will appear more than once in the input. | If the given network is reasonable, print "YES" in a single line (without the quotes). Otherwise, print "NO" in a single line (without the quotes). | [
"4 3\n1 3\n3 4\n1 4\n",
"4 4\n3 1\n2 3\n3 4\n1 2\n",
"10 4\n4 3\n5 10\n8 9\n1 2\n",
"3 2\n1 2\n2 3\n"
] | [
"YES\n",
"NO\n",
"YES\n",
"NO\n"
] | The drawings below show the situation in the first sample (on the left) and in the second sample (on the right). Each edge represents two members that are friends. The answer is "NO" in the second sample because members (2, 3) are friends and members (3, 4) are friends, while members (2, 4) are not. | 250 | [
{
"input": "4 3\n1 3\n3 4\n1 4",
"output": "YES"
},
{
"input": "4 4\n3 1\n2 3\n3 4\n1 2",
"output": "NO"
},
{
"input": "10 4\n4 3\n5 10\n8 9\n1 2",
"output": "YES"
},
{
"input": "3 2\n1 2\n2 3",
"output": "NO"
},
{
"input": "3 0",
"output": "YES"
},
{
"input": "15 42\n8 1\n3 14\n7 14\n12 3\n7 9\n6 7\n6 12\n14 12\n3 10\n10 14\n6 3\n3 13\n13 10\n7 12\n7 2\n6 10\n11 4\n9 3\n8 4\n7 3\n2 3\n2 10\n9 13\n2 14\n6 14\n13 2\n1 4\n13 6\n7 10\n13 14\n12 10\n13 7\n12 2\n9 10\n13 12\n2 6\n9 14\n6 9\n12 9\n11 1\n2 9\n11 8",
"output": "YES"
},
{
"input": "20 80\n17 4\n10 1\n11 10\n17 7\n15 10\n14 15\n13 1\n18 13\n3 13\n12 7\n9 13\n10 12\n14 12\n18 11\n4 7\n10 13\n11 3\n19 8\n14 7\n10 17\n14 3\n7 11\n11 14\n19 5\n10 14\n15 17\n3 1\n9 10\n11 1\n4 1\n11 4\n9 1\n12 3\n13 7\n1 14\n11 12\n7 1\n9 12\n18 15\n17 3\n7 15\n4 10\n7 18\n7 9\n12 17\n14 18\n3 18\n18 17\n9 15\n14 4\n14 9\n9 18\n12 4\n7 10\n15 4\n4 18\n15 13\n1 12\n7 3\n13 11\n4 13\n5 8\n12 18\n12 15\n17 9\n11 15\n3 10\n18 10\n4 3\n15 3\n13 12\n9 4\n9 11\n14 17\n13 17\n3 9\n13 14\n1 17\n15 1\n17 11",
"output": "NO"
},
{
"input": "99 26\n64 17\n48 70\n71 50\n3 50\n9 60\n61 64\n53 50\n25 12\n3 71\n71 53\n3 53\n65 70\n9 25\n9 12\n59 56\n39 60\n64 69\n65 94\n70 94\n25 60\n60 12\n94 48\n17 69\n61 17\n65 48\n61 69",
"output": "NO"
},
{
"input": "3 1\n1 2",
"output": "YES"
},
{
"input": "3 2\n3 2\n1 3",
"output": "NO"
},
{
"input": "3 3\n2 3\n1 2\n1 3",
"output": "YES"
},
{
"input": "4 2\n4 1\n2 1",
"output": "NO"
},
{
"input": "4 3\n3 1\n2 1\n3 2",
"output": "YES"
},
{
"input": "5 9\n1 2\n5 1\n3 1\n1 4\n2 4\n5 3\n5 4\n2 3\n5 2",
"output": "NO"
},
{
"input": "10 5\n9 5\n1 2\n6 8\n6 3\n10 6",
"output": "NO"
},
{
"input": "10 8\n10 7\n9 7\n5 7\n6 8\n3 5\n8 10\n3 4\n7 8",
"output": "NO"
},
{
"input": "10 20\n8 2\n8 3\n1 8\n9 5\n2 4\n10 1\n10 5\n7 5\n7 8\n10 7\n6 5\n3 7\n1 9\n9 8\n7 2\n2 10\n2 1\n6 4\n9 7\n4 3",
"output": "NO"
},
{
"input": "150000 10\n62562 50190\n48849 60549\n139470 18456\n21436 25159\n66845 120884\n99972 114453\n11631 99153\n62951 134848\n78114 146050\n136760 131762",
"output": "YES"
},
{
"input": "150000 0",
"output": "YES"
},
{
"input": "4 4\n1 2\n2 3\n3 4\n1 4",
"output": "NO"
},
{
"input": "30 73\n25 2\n2 16\n20 12\n16 20\n7 18\n11 15\n13 11\n30 29\n16 12\n12 25\n2 1\n18 14\n9 8\n28 16\n2 9\n22 21\n1 25\n12 28\n14 7\n4 9\n26 7\n14 27\n12 2\n29 22\n1 9\n13 15\n3 10\n1 12\n8 20\n30 24\n25 20\n4 1\n4 12\n20 1\n8 4\n2 28\n25 16\n16 8\n20 4\n9 12\n21 30\n23 11\n19 6\n28 4\n29 21\n9 28\n30 10\n22 24\n25 8\n27 26\n25 4\n28 20\n9 25\n24 29\n20 9\n18 26\n1 28\n30 22\n23 15\n28 27\n8 2\n23 13\n12 8\n14 26\n16 4\n28 25\n8 1\n4 2\n9 16\n20 2\n18 27\n28 8\n27 7",
"output": "NO"
},
{
"input": "5 4\n1 2\n2 5\n3 4\n4 5",
"output": "NO"
},
{
"input": "4 4\n1 2\n2 3\n3 4\n4 1",
"output": "NO"
},
{
"input": "6 6\n1 2\n2 4\n4 3\n1 5\n5 6\n6 3",
"output": "NO"
},
{
"input": "3 2\n1 2\n1 3",
"output": "NO"
},
{
"input": "6 6\n1 2\n2 3\n3 4\n4 5\n5 6\n1 6",
"output": "NO"
},
{
"input": "4 4\n1 2\n1 3\n2 4\n3 4",
"output": "NO"
},
{
"input": "6 9\n1 4\n1 5\n1 6\n2 4\n2 5\n2 6\n3 4\n3 5\n3 6",
"output": "NO"
},
{
"input": "4 3\n1 2\n1 3\n3 4",
"output": "NO"
},
{
"input": "4 3\n1 2\n1 3\n2 4",
"output": "NO"
},
{
"input": "6 6\n1 2\n2 3\n3 4\n4 5\n5 6\n6 1",
"output": "NO"
},
{
"input": "4 3\n1 2\n1 3\n1 4",
"output": "NO"
},
{
"input": "150000 3\n150000 149999\n149998 149999\n149998 150000",
"output": "YES"
},
{
"input": "10 15\n1 2\n1 3\n2 4\n2 5\n3 4\n3 5\n4 5\n1 6\n6 7\n6 8\n7 9\n7 10\n8 9\n8 10\n9 10",
"output": "NO"
},
{
"input": "5 5\n1 2\n2 3\n3 4\n4 5\n5 1",
"output": "NO"
},
{
"input": "5 4\n1 2\n1 3\n1 4\n1 5",
"output": "NO"
},
{
"input": "9 9\n1 2\n2 3\n3 4\n4 5\n5 6\n6 7\n7 8\n8 9\n9 1",
"output": "NO"
},
{
"input": "4 5\n1 2\n1 3\n1 4\n2 3\n3 4",
"output": "NO"
},
{
"input": "4 4\n1 2\n1 3\n4 2\n4 3",
"output": "NO"
},
{
"input": "5 5\n1 4\n5 3\n5 1\n2 3\n4 5",
"output": "NO"
},
{
"input": "4 5\n1 2\n1 3\n2 3\n1 4\n2 4",
"output": "NO"
},
{
"input": "4 5\n1 2\n1 3\n1 4\n2 3\n2 4",
"output": "NO"
},
{
"input": "6 12\n1 2\n1 4\n1 5\n1 6\n2 3\n2 5\n2 6\n3 4\n3 5\n3 6\n4 5\n4 6",
"output": "NO"
},
{
"input": "1000 4\n100 132\n100 164\n196 132\n196 164",
"output": "NO"
}
] | 1,570,883,933 | 2,147,483,647 | PyPy 3 | TIME_LIMIT_EXCEEDED | TESTS | 10 | 1,000 | 34,099,200 | n, m = map(int, input().split())
edges = [set([x]) for x in range(n)]
checked = [False for x in range(n)]
res = True
for x in range(m):
i, j = map(int, input().split())
edges[i - 1].add(j - 1)
edges[j - 1].add(i - 1)
for i in range(n):
if checked[i]:
continue
for j in edges[i]:
checked[j] = True
if edges[j] != edges[i]:
res = False
break
if not res:
break
if res:
print("YES")
else:
print("NO")
| Title: Bear and Friendship Condition
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Bear Limak examines a social network. Its main functionality is that two members can become friends (then they can talk with each other and share funny pictures).
There are *n* members, numbered 1 through *n*. *m* pairs of members are friends. Of course, a member can't be a friend with themselves.
Let A-B denote that members A and B are friends. Limak thinks that a network is reasonable if and only if the following condition is satisfied: For every three distinct members (X, Y, Z), if X-Y and Y-Z then also X-Z.
For example: if Alan and Bob are friends, and Bob and Ciri are friends, then Alan and Ciri should be friends as well.
Can you help Limak and check if the network is reasonable? Print "YES" or "NO" accordingly, without the quotes.
Input Specification:
The first line of the input contain two integers *n* and *m* (3<=≤<=*n*<=≤<=150<=000, ) — the number of members and the number of pairs of members that are friends.
The *i*-th of the next *m* lines contains two distinct integers *a**i* and *b**i* (1<=≤<=*a**i*,<=*b**i*<=≤<=*n*,<=*a**i*<=≠<=*b**i*). Members *a**i* and *b**i* are friends with each other. No pair of members will appear more than once in the input.
Output Specification:
If the given network is reasonable, print "YES" in a single line (without the quotes). Otherwise, print "NO" in a single line (without the quotes).
Demo Input:
['4 3\n1 3\n3 4\n1 4\n', '4 4\n3 1\n2 3\n3 4\n1 2\n', '10 4\n4 3\n5 10\n8 9\n1 2\n', '3 2\n1 2\n2 3\n']
Demo Output:
['YES\n', 'NO\n', 'YES\n', 'NO\n']
Note:
The drawings below show the situation in the first sample (on the left) and in the second sample (on the right). Each edge represents two members that are friends. The answer is "NO" in the second sample because members (2, 3) are friends and members (3, 4) are friends, while members (2, 4) are not. | ```python
n, m = map(int, input().split())
edges = [set([x]) for x in range(n)]
checked = [False for x in range(n)]
res = True
for x in range(m):
i, j = map(int, input().split())
edges[i - 1].add(j - 1)
edges[j - 1].add(i - 1)
for i in range(n):
if checked[i]:
continue
for j in edges[i]:
checked[j] = True
if edges[j] != edges[i]:
res = False
break
if not res:
break
if res:
print("YES")
else:
print("NO")
``` | 0 |
|
745 | A | Hongcow Learns the Cyclic Shift | PROGRAMMING | 900 | [
"implementation",
"strings"
] | null | null | Hongcow is learning to spell! One day, his teacher gives him a word that he needs to learn to spell. Being a dutiful student, he immediately learns how to spell the word.
Hongcow has decided to try to make new words from this one. He starts by taking the word he just learned how to spell, and moves the last character of the word to the beginning of the word. He calls this a cyclic shift. He can apply cyclic shift many times. For example, consecutively applying cyclic shift operation to the word "abracadabra" Hongcow will get words "aabracadabr", "raabracadab" and so on.
Hongcow is now wondering how many distinct words he can generate by doing the cyclic shift arbitrarily many times. The initial string is also counted. | The first line of input will be a single string *s* (1<=≤<=|*s*|<=≤<=50), the word Hongcow initially learns how to spell. The string *s* consists only of lowercase English letters ('a'–'z'). | Output a single integer equal to the number of distinct strings that Hongcow can obtain by applying the cyclic shift arbitrarily many times to the given string. | [
"abcd\n",
"bbb\n",
"yzyz\n"
] | [
"4\n",
"1\n",
"2\n"
] | For the first sample, the strings Hongcow can generate are "abcd", "dabc", "cdab", and "bcda".
For the second sample, no matter how many times Hongcow does the cyclic shift, Hongcow can only generate "bbb".
For the third sample, the two strings Hongcow can generate are "yzyz" and "zyzy". | 500 | [
{
"input": "abcd",
"output": "4"
},
{
"input": "bbb",
"output": "1"
},
{
"input": "yzyz",
"output": "2"
},
{
"input": "abcdefghijklmnopqrstuvwxyabcdefghijklmnopqrstuvwxy",
"output": "25"
},
{
"input": "zclkjadoprqronzclkjadoprqronzclkjadoprqron",
"output": "14"
},
{
"input": "zzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzzz",
"output": "1"
},
{
"input": "xyxyxyxyxyxyxyxyxyxyxyxyxyxyxyxyxyxyxyxyxyxyxyxyxy",
"output": "2"
},
{
"input": "y",
"output": "1"
},
{
"input": "ervbfotfedpozygoumbmxeaqegouaqqzqerlykhmvxvvlcaos",
"output": "49"
},
{
"input": "zyzzzyyzyyyzyyzyzyzyzyzzzyyyzzyzyyzzzzzyyyzzzzyzyy",
"output": "50"
},
{
"input": "zzfyftdezzfyftdezzfyftdezzfyftdezzfyftdezzfyftde",
"output": "8"
},
{
"input": "yehcqdlllqpuxdsaicyjjxiylahgxbygmsopjbxhtimzkashs",
"output": "49"
},
{
"input": "yyyyzzzyzzzyzyzyzyyyyyzzyzyzyyyyyzyzyyyzyzzyyzzzz",
"output": "49"
},
{
"input": "zkqcrhzlzsnwzkqcrhzlzsnwzkqcrhzlzsnwzkqcrhzlzsnw",
"output": "12"
},
{
"input": "xxyxxyxxyxxyxxyxxyxxyxxyxxyxxyxxyxxyxxyxxyxxyxxy",
"output": "3"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaabaaaaaaaaaaaaaaaaaaaaaaaab",
"output": "25"
},
{
"input": "aabaaabaaabaaabaaabaaabaaabaaabaaabaaabaaabaaaba",
"output": "4"
},
{
"input": "pqqpqqpqqpqqpqqpqqpqqpqqpqqpqqpqqppqppqppqppqppq",
"output": "48"
},
{
"input": "zxkljaqzxkljaqzxkljaqzxkljaqzxrljaqzxkljaqzxkljaq",
"output": "49"
},
{
"input": "abcdefghijklmnopqrstuvwxyzabcdefghijklmnopqrstuvwx",
"output": "50"
},
{
"input": "aaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaaz",
"output": "50"
},
{
"input": "abcddcba",
"output": "8"
},
{
"input": "aabaabaabaacaabaabaabaacaabaabaabaacaabaabaabaac",
"output": "12"
},
{
"input": "aabaabcaabaabcdaabaabcaabaabcd",
"output": "15"
},
{
"input": "ababaababaaababaababaaaababaababaaababaababaaaa",
"output": "47"
},
{
"input": "ababaababaaababaababaaaababaababaaababaababaaa",
"output": "23"
},
{
"input": "aaababaab",
"output": "9"
},
{
"input": "aba",
"output": "3"
}
] | 1,481,992,744 | 244 | Python 3 | OK | TESTS | 28 | 78 | 4,608,000 | #CF YL1
s=input()
c={s}
def cyc(s2):return s2[-1]+s2[:-1]
for i in range(len(s)):
s=cyc(s)
c.add(s)
print(len(c))
| Title: Hongcow Learns the Cyclic Shift
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Hongcow is learning to spell! One day, his teacher gives him a word that he needs to learn to spell. Being a dutiful student, he immediately learns how to spell the word.
Hongcow has decided to try to make new words from this one. He starts by taking the word he just learned how to spell, and moves the last character of the word to the beginning of the word. He calls this a cyclic shift. He can apply cyclic shift many times. For example, consecutively applying cyclic shift operation to the word "abracadabra" Hongcow will get words "aabracadabr", "raabracadab" and so on.
Hongcow is now wondering how many distinct words he can generate by doing the cyclic shift arbitrarily many times. The initial string is also counted.
Input Specification:
The first line of input will be a single string *s* (1<=≤<=|*s*|<=≤<=50), the word Hongcow initially learns how to spell. The string *s* consists only of lowercase English letters ('a'–'z').
Output Specification:
Output a single integer equal to the number of distinct strings that Hongcow can obtain by applying the cyclic shift arbitrarily many times to the given string.
Demo Input:
['abcd\n', 'bbb\n', 'yzyz\n']
Demo Output:
['4\n', '1\n', '2\n']
Note:
For the first sample, the strings Hongcow can generate are "abcd", "dabc", "cdab", and "bcda".
For the second sample, no matter how many times Hongcow does the cyclic shift, Hongcow can only generate "bbb".
For the third sample, the two strings Hongcow can generate are "yzyz" and "zyzy". | ```python
#CF YL1
s=input()
c={s}
def cyc(s2):return s2[-1]+s2[:-1]
for i in range(len(s)):
s=cyc(s)
c.add(s)
print(len(c))
``` | 3 |
|
300 | A | Array | PROGRAMMING | 1,100 | [
"brute force",
"constructive algorithms",
"implementation"
] | null | null | Vitaly has an array of *n* distinct integers. Vitaly wants to divide this array into three non-empty sets so as the following conditions hold:
1. The product of all numbers in the first set is less than zero (<=<<=0). 1. The product of all numbers in the second set is greater than zero (<=><=0). 1. The product of all numbers in the third set is equal to zero. 1. Each number from the initial array must occur in exactly one set.
Help Vitaly. Divide the given array. | The first line of the input contains integer *n* (3<=≤<=*n*<=≤<=100). The second line contains *n* space-separated distinct integers *a*1,<=*a*2,<=...,<=*a**n* (|*a**i*|<=≤<=103) — the array elements. | In the first line print integer *n*1 (*n*1<=><=0) — the number of elements in the first set. Then print *n*1 numbers — the elements that got to the first set.
In the next line print integer *n*2 (*n*2<=><=0) — the number of elements in the second set. Then print *n*2 numbers — the elements that got to the second set.
In the next line print integer *n*3 (*n*3<=><=0) — the number of elements in the third set. Then print *n*3 numbers — the elements that got to the third set.
The printed sets must meet the described conditions. It is guaranteed that the solution exists. If there are several solutions, you are allowed to print any of them. | [
"3\n-1 2 0\n",
"4\n-1 -2 -3 0\n"
] | [
"1 -1\n1 2\n1 0\n",
"1 -1\n2 -3 -2\n1 0\n"
] | none | 500 | [
{
"input": "3\n-1 2 0",
"output": "1 -1\n1 2\n1 0"
},
{
"input": "4\n-1 -2 -3 0",
"output": "1 -1\n2 -3 -2\n1 0"
},
{
"input": "5\n-1 -2 1 2 0",
"output": "1 -1\n2 1 2\n2 0 -2"
},
{
"input": "100\n-64 -51 -75 -98 74 -26 -1 -8 -99 -76 -53 -80 -43 -22 -100 -62 -34 -5 -65 -81 -18 -91 -92 -16 -23 -95 -9 -19 -44 -46 -79 52 -35 4 -87 -7 -90 -20 -71 -61 -67 -50 -66 -68 -49 -27 -32 -57 -85 -59 -30 -36 -3 -77 86 -25 -94 -56 60 -24 -37 -72 -41 -31 11 -48 28 -38 -42 -39 -33 -70 -84 0 -93 -73 -14 -69 -40 -97 -6 -55 -45 -54 -10 -29 -96 -12 -83 -15 -21 -47 17 -2 -63 -89 88 13 -58 -82",
"output": "89 -64 -51 -75 -98 -26 -1 -8 -99 -76 -53 -80 -43 -22 -100 -62 -34 -5 -65 -81 -18 -91 -92 -16 -23 -95 -9 -19 -44 -46 -79 -35 -87 -7 -90 -20 -71 -61 -67 -50 -66 -68 -49 -27 -32 -57 -85 -59 -30 -36 -3 -77 -25 -94 -56 -24 -37 -72 -41 -31 -48 -38 -42 -39 -33 -70 -84 -93 -73 -14 -69 -40 -97 -6 -55 -45 -54 -10 -29 -96 -12 -83 -15 -21 -47 -2 -63 -89 -58 -82\n10 74 52 4 86 60 11 28 17 88 13\n1 0"
},
{
"input": "100\n3 -66 -17 54 24 -29 76 89 32 -37 93 -16 99 -25 51 78 23 68 -95 59 18 34 -45 77 9 39 -10 19 8 73 -5 60 12 31 0 2 26 40 48 30 52 49 27 4 87 57 85 58 -61 50 83 80 69 67 91 97 -96 11 100 56 82 53 13 -92 -72 70 1 -94 -63 47 21 14 74 7 6 33 55 65 64 -41 81 42 36 28 38 20 43 71 90 -88 22 84 -86 15 75 62 44 35 98 46",
"output": "19 -66 -17 -29 -37 -16 -25 -95 -45 -10 -5 -61 -96 -92 -72 -94 -63 -41 -88 -86\n80 3 54 24 76 89 32 93 99 51 78 23 68 59 18 34 77 9 39 19 8 73 60 12 31 2 26 40 48 30 52 49 27 4 87 57 85 58 50 83 80 69 67 91 97 11 100 56 82 53 13 70 1 47 21 14 74 7 6 33 55 65 64 81 42 36 28 38 20 43 71 90 22 84 15 75 62 44 35 98 46\n1 0"
},
{
"input": "100\n-17 16 -70 32 -60 75 -100 -9 -68 -30 -42 86 -88 -98 -47 -5 58 -14 -94 -73 -80 -51 -66 -85 -53 49 -25 -3 -45 -69 -11 -64 83 74 -65 67 13 -91 81 6 -90 -54 -12 -39 0 -24 -71 -41 -44 57 -93 -20 -92 18 -43 -52 -55 -84 -89 -19 40 -4 -99 -26 -87 -36 -56 -61 -62 37 -95 -28 63 23 35 -82 1 -2 -78 -96 -21 -77 -76 -27 -10 -97 -8 46 -15 -48 -34 -59 -7 -29 50 -33 -72 -79 22 38",
"output": "75 -17 -70 -60 -100 -9 -68 -30 -42 -88 -98 -47 -5 -14 -94 -73 -80 -51 -66 -85 -53 -25 -3 -45 -69 -11 -64 -65 -91 -90 -54 -12 -39 -24 -71 -41 -44 -93 -20 -92 -43 -52 -55 -84 -89 -19 -4 -99 -26 -87 -36 -56 -61 -62 -95 -28 -82 -2 -78 -96 -21 -77 -76 -27 -10 -97 -8 -15 -48 -34 -59 -7 -29 -33 -72 -79\n24 16 32 75 86 58 49 83 74 67 13 81 6 57 18 40 37 63 23 35 1 46 50 22 38\n1 0"
},
{
"input": "100\n-97 -90 61 78 87 -52 -3 65 83 38 30 -60 35 -50 -73 -77 44 -32 -81 17 -67 58 -6 -34 47 -28 71 -45 69 -80 -4 -7 -57 -79 43 -27 -31 29 16 -89 -21 -93 95 -82 74 -5 -70 -20 -18 36 -64 -66 72 53 62 -68 26 15 76 -40 -99 8 59 88 49 -23 9 10 56 -48 -98 0 100 -54 25 94 13 -63 42 39 -1 55 24 -12 75 51 41 84 -96 -85 -2 -92 14 -46 -91 -19 -11 -86 22 -37",
"output": "51 -97 -90 -52 -3 -60 -50 -73 -77 -32 -81 -67 -6 -34 -28 -45 -80 -4 -7 -57 -79 -27 -31 -89 -21 -93 -82 -5 -70 -20 -18 -64 -66 -68 -40 -99 -23 -48 -98 -54 -63 -1 -12 -96 -85 -2 -92 -46 -91 -19 -11 -86\n47 61 78 87 65 83 38 30 35 44 17 58 47 71 69 43 29 16 95 74 36 72 53 62 26 15 76 8 59 88 49 9 10 56 100 25 94 13 42 39 55 24 75 51 41 84 14 22\n2 0 -37"
},
{
"input": "100\n-75 -60 -18 -92 -71 -9 -37 -34 -82 28 -54 93 -83 -76 -58 -88 -17 -97 64 -39 -96 -81 -10 -98 -47 -100 -22 27 14 -33 -19 -99 87 -66 57 -21 -90 -70 -32 -26 24 -77 -74 13 -44 16 -5 -55 -2 -6 -7 -73 -1 -68 -30 -95 -42 69 0 -20 -79 59 -48 -4 -72 -67 -46 62 51 -52 -86 -40 56 -53 85 -35 -8 49 50 65 29 11 -43 -15 -41 -12 -3 -80 -31 -38 -91 -45 -25 78 94 -23 -63 84 89 -61",
"output": "73 -75 -60 -18 -92 -71 -9 -37 -34 -82 -54 -83 -76 -58 -88 -17 -97 -39 -96 -81 -10 -98 -47 -100 -22 -33 -19 -99 -66 -21 -90 -70 -32 -26 -77 -74 -44 -5 -55 -2 -6 -7 -73 -1 -68 -30 -95 -42 -20 -79 -48 -4 -72 -67 -46 -52 -86 -40 -53 -35 -8 -43 -15 -41 -12 -3 -80 -31 -38 -91 -45 -25 -23 -63\n25 28 93 64 27 14 87 57 24 13 16 69 59 62 51 56 85 49 50 65 29 11 78 94 84 89\n2 0 -61"
},
{
"input": "100\n-87 -48 -76 -1 -10 -17 -22 -19 -27 -99 -43 49 38 -20 -45 -64 44 -96 -35 -74 -65 -41 -21 -75 37 -12 -67 0 -3 5 -80 -93 -81 -97 -47 -63 53 -100 95 -79 -83 -90 -32 88 -77 -16 -23 -54 -28 -4 -73 -98 -25 -39 60 -56 -34 -2 -11 -55 -52 -69 -68 -29 -82 -62 -36 -13 -6 -89 8 -72 18 -15 -50 -71 -70 -92 -42 -78 -61 -9 -30 -85 -91 -94 84 -86 -7 -57 -14 40 -33 51 -26 46 59 -31 -58 -66",
"output": "83 -87 -48 -76 -1 -10 -17 -22 -19 -27 -99 -43 -20 -45 -64 -96 -35 -74 -65 -41 -21 -75 -12 -67 -3 -80 -93 -81 -97 -47 -63 -100 -79 -83 -90 -32 -77 -16 -23 -54 -28 -4 -73 -98 -25 -39 -56 -34 -2 -11 -55 -52 -69 -68 -29 -82 -62 -36 -13 -6 -89 -72 -15 -50 -71 -70 -92 -42 -78 -61 -9 -30 -85 -91 -94 -86 -7 -57 -14 -33 -26 -31 -58 -66\n16 49 38 44 37 5 53 95 88 60 8 18 84 40 51 46 59\n1 0"
},
{
"input": "100\n-95 -28 -43 -72 -11 -24 -37 -35 -44 -66 -45 -62 -96 -51 -55 -23 -31 -26 -59 -17 77 -69 -10 -12 -78 -14 -52 -57 -40 -75 4 -98 -6 7 -53 -3 -90 -63 -8 -20 88 -91 -32 -76 -80 -97 -34 -27 -19 0 70 -38 -9 -49 -67 73 -36 2 81 -39 -65 -83 -64 -18 -94 -79 -58 -16 87 -22 -74 -25 -13 -46 -89 -47 5 -15 -54 -99 56 -30 -60 -21 -86 33 -1 -50 -68 -100 -85 -29 92 -48 -61 42 -84 -93 -41 -82",
"output": "85 -95 -28 -43 -72 -11 -24 -37 -35 -44 -66 -45 -62 -96 -51 -55 -23 -31 -26 -59 -17 -69 -10 -12 -78 -14 -52 -57 -40 -75 -98 -6 -53 -3 -90 -63 -8 -20 -91 -32 -76 -80 -97 -34 -27 -19 -38 -9 -49 -67 -36 -39 -65 -83 -64 -18 -94 -79 -58 -16 -22 -74 -25 -13 -46 -89 -47 -15 -54 -99 -30 -60 -21 -86 -1 -50 -68 -100 -85 -29 -48 -61 -84 -93 -41 -82\n14 77 4 7 88 70 73 2 81 87 5 56 33 92 42\n1 0"
},
{
"input": "100\n-12 -41 57 13 83 -36 53 69 -6 86 -75 87 11 -5 -4 -14 -37 -84 70 2 -73 16 31 34 -45 94 -9 26 27 52 -42 46 96 21 32 7 -18 61 66 -51 95 -48 -76 90 80 -40 89 77 78 54 -30 8 88 33 -24 82 -15 19 1 59 44 64 -97 -60 43 56 35 47 39 50 29 28 -17 -67 74 23 85 -68 79 0 65 55 -3 92 -99 72 93 -71 38 -10 -100 -98 81 62 91 -63 -58 49 -20 22",
"output": "35 -12 -41 -36 -6 -75 -5 -4 -14 -37 -84 -73 -45 -9 -42 -18 -51 -48 -76 -40 -30 -24 -15 -97 -60 -17 -67 -68 -3 -99 -71 -10 -100 -98 -63 -58\n63 57 13 83 53 69 86 87 11 70 2 16 31 34 94 26 27 52 46 96 21 32 7 61 66 95 90 80 89 77 78 54 8 88 33 82 19 1 59 44 64 43 56 35 47 39 50 29 28 74 23 85 79 65 55 92 72 93 38 81 62 91 49 22\n2 0 -20"
},
{
"input": "100\n-34 81 85 -96 50 20 54 86 22 10 -19 52 65 44 30 53 63 71 17 98 -92 4 5 -99 89 -23 48 9 7 33 75 2 47 -56 42 70 -68 57 51 83 82 94 91 45 46 25 95 11 -12 62 -31 -87 58 38 67 97 -60 66 73 -28 13 93 29 59 -49 77 37 -43 -27 0 -16 72 15 79 61 78 35 21 3 8 84 1 -32 36 74 -88 26 100 6 14 40 76 18 90 24 69 80 64 55 41",
"output": "19 -34 -96 -19 -92 -99 -23 -56 -68 -12 -31 -87 -60 -28 -49 -43 -27 -16 -32 -88\n80 81 85 50 20 54 86 22 10 52 65 44 30 53 63 71 17 98 4 5 89 48 9 7 33 75 2 47 42 70 57 51 83 82 94 91 45 46 25 95 11 62 58 38 67 97 66 73 13 93 29 59 77 37 72 15 79 61 78 35 21 3 8 84 1 36 74 26 100 6 14 40 76 18 90 24 69 80 64 55 41\n1 0"
},
{
"input": "100\n-1000 -986 -979 -955 -966 -963 -973 -959 -972 -906 -924 -927 -929 -918 -977 -967 -921 -989 -911 -995 -945 -919 -971 -913 -912 -933 -969 -975 -920 -988 -997 -994 -953 -962 -940 -905 -978 -948 -957 -996 0 -976 -949 -931 -903 -985 -923 -993 -944 -909 -938 -946 -934 -992 -904 -980 -954 -943 -917 -968 -991 -956 -902 -942 -999 -998 -908 -928 -930 -914 -922 -936 -960 -937 -939 -926 -965 -925 -951 -910 -907 -970 -990 -984 -964 -987 -916 -947 -982 -950 -974 -915 -932 -958 -981 -941 -961 -983 -952 -935",
"output": "97 -1000 -986 -979 -955 -966 -963 -973 -959 -972 -906 -924 -927 -929 -918 -977 -967 -921 -989 -911 -995 -945 -919 -971 -913 -912 -933 -969 -975 -920 -988 -997 -994 -953 -962 -940 -905 -978 -948 -957 -996 -976 -949 -931 -903 -985 -923 -993 -944 -909 -938 -946 -934 -992 -904 -980 -954 -943 -917 -968 -991 -956 -902 -942 -999 -998 -908 -928 -930 -914 -922 -936 -960 -937 -939 -926 -965 -925 -951 -910 -907 -970 -990 -984 -964 -987 -916 -947 -982 -950 -974 -915 -932 -958 -981 -941 -961 -983\n2 -935 -952\n1 0"
},
{
"input": "99\n-1000 -986 -979 -955 -966 -963 -973 -959 -972 -906 -924 -927 -929 -918 -977 -967 -921 -989 -911 -995 -945 -919 -971 -913 -912 -933 -969 -975 -920 -988 -997 -994 -953 -962 -940 -905 -978 -948 -957 -996 0 -976 -949 -931 -903 -985 -923 -993 -944 -909 -938 -946 -934 -992 -904 -980 -954 -943 -917 -968 -991 -956 -902 -942 -999 -998 -908 -928 -930 -914 -922 -936 -960 -937 -939 -926 -965 -925 -951 -910 -907 -970 -990 -984 -964 -987 -916 -947 -982 -950 -974 -915 -932 -958 -981 -941 -961 -983 -952",
"output": "95 -1000 -986 -979 -955 -966 -963 -973 -959 -972 -906 -924 -927 -929 -918 -977 -967 -921 -989 -911 -995 -945 -919 -971 -913 -912 -933 -969 -975 -920 -988 -997 -994 -953 -962 -940 -905 -978 -948 -957 -996 -976 -949 -931 -903 -985 -923 -993 -944 -909 -938 -946 -934 -992 -904 -980 -954 -943 -917 -968 -991 -956 -902 -942 -999 -998 -908 -928 -930 -914 -922 -936 -960 -937 -939 -926 -965 -925 -951 -910 -907 -970 -990 -984 -964 -987 -916 -947 -982 -950 -974 -915 -932 -958 -981 -941\n2 -952 -983\n2 0 -961"
},
{
"input": "59\n-990 -876 -641 -726 718 -53 803 -954 894 -265 -587 -665 904 349 754 -978 441 794 -768 -428 -569 -476 188 -620 -290 -333 45 705 -201 109 165 446 13 122 714 -562 -15 -86 -960 43 329 578 287 -776 -14 -71 915 886 -259 337 -495 913 -498 -669 -673 818 225 647 0",
"output": "29 -990 -876 -641 -726 -53 -954 -265 -587 -665 -978 -768 -428 -569 -476 -620 -290 -333 -201 -562 -15 -86 -960 -776 -14 -71 -259 -495 -498 -669\n28 718 803 894 904 349 754 441 794 188 45 705 109 165 446 13 122 714 43 329 578 287 915 886 337 913 818 225 647\n2 0 -673"
},
{
"input": "64\n502 885 -631 -906 735 687 642 -29 -696 -165 -524 15 -129 -663 -846 -501 -651 895 -341 -833 -142 33 -847 688 945 -192 -587 -930 603 849 736 676 788 256 863 -509 319 -49 -807 -158 218 -886 -143 -639 118 -156 -291 325 892 -916 -622 -960 -959 -731 -943 436 -535 861 745 589 -159 376 -182 0",
"output": "35 -631 -906 -29 -696 -165 -524 -129 -663 -846 -501 -651 -341 -833 -142 -847 -192 -587 -930 -509 -49 -807 -158 -886 -143 -639 -156 -291 -916 -622 -960 -959 -731 -943 -535 -159\n27 502 885 735 687 642 15 895 33 688 945 603 849 736 676 788 256 863 319 218 118 325 892 436 861 745 589 376\n2 0 -182"
},
{
"input": "5\n-1 -2 -3 -4 0",
"output": "1 -1\n2 -4 -3\n2 0 -2"
},
{
"input": "3\n-101 101 0",
"output": "1 -101\n1 101\n1 0"
},
{
"input": "21\n-100 -200 -300 -400 -500 -600 -700 -800 -900 -1000 0 100 200 300 400 500 600 700 800 900 1000",
"output": "9 -100 -200 -300 -400 -500 -600 -700 -800 -900\n10 100 200 300 400 500 600 700 800 900 1000\n2 0 -1000"
},
{
"input": "4\n0 -1 -2 -3",
"output": "1 -1\n2 -3 -2\n1 0"
}
] | 1,593,527,217 | 2,147,483,647 | Python 3 | OK | TESTS | 20 | 218 | 307,200 | p = int(input())
q = list(int(x) for x in input().split())
a = []
b = []
c = []
for i in q:
if i<0:
a.append(i)
elif i>0:
b.append(i)
else:
c.append(i)
if len(b)==0 and len(a)>2:
for i in range(2):
b.append(a[i])
a.remove(a[0])
a.remove(a[0])
while len(a)>1:
c.append(a[1])
a.remove(a[1])
print(len(a),end=" ")
for i in a:
print(i,end=" ")
print()
print(len(b),end=" ")
for i in b:
print(i,end=" ")
print()
print(len(c),end=" ")
for i in c:
print(i,end=" ") | Title: Array
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vitaly has an array of *n* distinct integers. Vitaly wants to divide this array into three non-empty sets so as the following conditions hold:
1. The product of all numbers in the first set is less than zero (<=<<=0). 1. The product of all numbers in the second set is greater than zero (<=><=0). 1. The product of all numbers in the third set is equal to zero. 1. Each number from the initial array must occur in exactly one set.
Help Vitaly. Divide the given array.
Input Specification:
The first line of the input contains integer *n* (3<=≤<=*n*<=≤<=100). The second line contains *n* space-separated distinct integers *a*1,<=*a*2,<=...,<=*a**n* (|*a**i*|<=≤<=103) — the array elements.
Output Specification:
In the first line print integer *n*1 (*n*1<=><=0) — the number of elements in the first set. Then print *n*1 numbers — the elements that got to the first set.
In the next line print integer *n*2 (*n*2<=><=0) — the number of elements in the second set. Then print *n*2 numbers — the elements that got to the second set.
In the next line print integer *n*3 (*n*3<=><=0) — the number of elements in the third set. Then print *n*3 numbers — the elements that got to the third set.
The printed sets must meet the described conditions. It is guaranteed that the solution exists. If there are several solutions, you are allowed to print any of them.
Demo Input:
['3\n-1 2 0\n', '4\n-1 -2 -3 0\n']
Demo Output:
['1 -1\n1 2\n1 0\n', '1 -1\n2 -3 -2\n1 0\n']
Note:
none | ```python
p = int(input())
q = list(int(x) for x in input().split())
a = []
b = []
c = []
for i in q:
if i<0:
a.append(i)
elif i>0:
b.append(i)
else:
c.append(i)
if len(b)==0 and len(a)>2:
for i in range(2):
b.append(a[i])
a.remove(a[0])
a.remove(a[0])
while len(a)>1:
c.append(a[1])
a.remove(a[1])
print(len(a),end=" ")
for i in a:
print(i,end=" ")
print()
print(len(b),end=" ")
for i in b:
print(i,end=" ")
print()
print(len(c),end=" ")
for i in c:
print(i,end=" ")
``` | 3 |
|
25 | A | IQ test | PROGRAMMING | 1,300 | [
"brute force"
] | A. IQ test | 2 | 256 | Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness. | The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness. | Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order. | [
"5\n2 4 7 8 10\n",
"4\n1 2 1 1\n"
] | [
"3\n",
"2\n"
] | none | 0 | [
{
"input": "5\n2 4 7 8 10",
"output": "3"
},
{
"input": "4\n1 2 1 1",
"output": "2"
},
{
"input": "3\n1 2 2",
"output": "1"
},
{
"input": "3\n100 99 100",
"output": "2"
},
{
"input": "3\n5 3 2",
"output": "3"
},
{
"input": "4\n43 28 1 91",
"output": "2"
},
{
"input": "4\n75 13 94 77",
"output": "3"
},
{
"input": "4\n97 8 27 3",
"output": "2"
},
{
"input": "10\n95 51 12 91 85 3 1 31 25 7",
"output": "3"
},
{
"input": "20\n88 96 66 51 14 88 2 92 18 72 18 88 20 30 4 82 90 100 24 46",
"output": "4"
},
{
"input": "30\n20 94 56 50 10 98 52 32 14 22 24 60 4 8 98 46 34 68 82 82 98 90 50 20 78 49 52 94 64 36",
"output": "26"
},
{
"input": "50\n79 27 77 57 37 45 27 49 65 33 57 21 71 19 75 85 65 61 23 97 85 9 23 1 9 3 99 77 77 21 79 69 15 37 15 7 93 81 13 89 91 31 45 93 15 97 55 80 85 83",
"output": "48"
},
{
"input": "60\n46 11 73 65 3 69 3 53 43 53 97 47 55 93 31 75 35 3 9 73 23 31 3 81 91 79 61 21 15 11 11 11 81 7 83 75 39 87 83 59 89 55 93 27 49 67 67 29 1 93 11 17 9 19 35 21 63 31 31 25",
"output": "1"
},
{
"input": "70\n28 42 42 92 64 54 22 38 38 78 62 38 4 38 14 66 4 92 66 58 94 26 4 44 41 88 48 82 44 26 74 44 48 4 16 92 34 38 26 64 94 4 30 78 50 54 12 90 8 16 80 98 28 100 74 50 36 42 92 18 76 98 8 22 2 50 58 50 64 46",
"output": "25"
},
{
"input": "100\n43 35 79 53 13 91 91 45 65 83 57 9 42 39 85 45 71 51 61 59 31 13 63 39 25 21 79 39 91 67 21 61 97 75 93 83 29 79 59 97 11 37 63 51 39 55 91 23 21 17 47 23 35 75 49 5 69 99 5 7 41 17 25 89 15 79 21 63 53 81 43 91 59 91 69 99 85 15 91 51 49 37 65 7 89 81 21 93 61 63 97 93 45 17 13 69 57 25 75 73",
"output": "13"
},
{
"input": "100\n50 24 68 60 70 30 52 22 18 74 68 98 20 82 4 46 26 68 100 78 84 58 74 98 38 88 68 86 64 80 82 100 20 22 98 98 52 6 94 10 48 68 2 18 38 22 22 82 44 20 66 72 36 58 64 6 36 60 4 96 76 64 12 90 10 58 64 60 74 28 90 26 24 60 40 58 2 16 76 48 58 36 82 60 24 44 4 78 28 38 8 12 40 16 38 6 66 24 31 76",
"output": "99"
},
{
"input": "100\n47 48 94 48 14 18 94 36 96 22 12 30 94 20 48 98 40 58 2 94 8 36 98 18 98 68 2 60 76 38 18 100 8 72 100 68 2 86 92 72 58 16 48 14 6 58 72 76 6 88 80 66 20 28 74 62 86 68 90 86 2 56 34 38 56 90 4 8 76 44 32 86 12 98 38 34 54 92 70 94 10 24 82 66 90 58 62 2 32 58 100 22 58 72 2 22 68 72 42 14",
"output": "1"
},
{
"input": "99\n38 20 68 60 84 16 28 88 60 48 80 28 4 92 70 60 46 46 20 34 12 100 76 2 40 10 8 86 6 80 50 66 12 34 14 28 26 70 46 64 34 96 10 90 98 96 56 88 50 74 70 94 2 94 24 66 68 46 22 30 6 10 64 32 88 14 98 100 64 58 50 18 50 50 8 38 8 16 54 2 60 54 62 84 92 98 4 72 66 26 14 88 99 16 10 6 88 56 22",
"output": "93"
},
{
"input": "99\n50 83 43 89 53 47 69 1 5 37 63 87 95 15 55 95 75 89 33 53 89 75 93 75 11 85 49 29 11 97 49 67 87 11 25 37 97 73 67 49 87 43 53 97 43 29 53 33 45 91 37 73 39 49 59 5 21 43 87 35 5 63 89 57 63 47 29 99 19 85 13 13 3 13 43 19 5 9 61 51 51 57 15 89 13 97 41 13 99 79 13 27 97 95 73 33 99 27 23",
"output": "1"
},
{
"input": "98\n61 56 44 30 58 14 20 24 88 28 46 56 96 52 58 42 94 50 46 30 46 80 72 88 68 16 6 60 26 90 10 98 76 20 56 40 30 16 96 20 88 32 62 30 74 58 36 76 60 4 24 36 42 54 24 92 28 14 2 74 86 90 14 52 34 82 40 76 8 64 2 56 10 8 78 16 70 86 70 42 70 74 22 18 76 98 88 28 62 70 36 72 20 68 34 48 80 98",
"output": "1"
},
{
"input": "98\n66 26 46 42 78 32 76 42 26 82 8 12 4 10 24 26 64 44 100 46 94 64 30 18 88 28 8 66 30 82 82 28 74 52 62 80 80 60 94 86 64 32 44 88 92 20 12 74 94 28 34 58 4 22 16 10 94 76 82 58 40 66 22 6 30 32 92 54 16 76 74 98 18 48 48 30 92 2 16 42 84 74 30 60 64 52 50 26 16 86 58 96 79 60 20 62 82 94",
"output": "93"
},
{
"input": "95\n9 31 27 93 17 77 75 9 9 53 89 39 51 99 5 1 11 39 27 49 91 17 27 79 81 71 37 75 35 13 93 4 99 55 85 11 23 57 5 43 5 61 15 35 23 91 3 81 99 85 43 37 39 27 5 67 7 33 75 59 13 71 51 27 15 93 51 63 91 53 43 99 25 47 17 71 81 15 53 31 59 83 41 23 73 25 91 91 13 17 25 13 55 57 29",
"output": "32"
},
{
"input": "100\n91 89 81 45 53 1 41 3 77 93 55 97 55 97 87 27 69 95 73 41 93 21 75 35 53 56 5 51 87 59 91 67 33 3 99 45 83 17 97 47 75 97 7 89 17 99 23 23 81 25 55 97 27 35 69 5 77 35 93 19 55 59 37 21 31 37 49 41 91 53 73 69 7 37 37 39 17 71 7 97 55 17 47 23 15 73 31 39 57 37 9 5 61 41 65 57 77 79 35 47",
"output": "26"
},
{
"input": "99\n38 56 58 98 80 54 26 90 14 16 78 92 52 74 40 30 84 14 44 80 16 90 98 68 26 24 78 72 42 16 84 40 14 44 2 52 50 2 12 96 58 66 8 80 44 52 34 34 72 98 74 4 66 74 56 21 8 38 76 40 10 22 48 32 98 34 12 62 80 68 64 82 22 78 58 74 20 22 48 56 12 38 32 72 6 16 74 24 94 84 26 38 18 24 76 78 98 94 72",
"output": "56"
},
{
"input": "100\n44 40 6 40 56 90 98 8 36 64 76 86 98 76 36 92 6 30 98 70 24 98 96 60 24 82 88 68 86 96 34 42 58 10 40 26 56 10 88 58 70 32 24 28 14 82 52 12 62 36 70 60 52 34 74 30 78 76 10 16 42 94 66 90 70 38 52 12 58 22 98 96 14 68 24 70 4 30 84 98 8 50 14 52 66 34 100 10 28 100 56 48 38 12 38 14 91 80 70 86",
"output": "97"
},
{
"input": "100\n96 62 64 20 90 46 56 90 68 36 30 56 70 28 16 64 94 34 6 32 34 50 94 22 90 32 40 2 72 10 88 38 28 92 20 26 56 80 4 100 100 90 16 74 74 84 8 2 30 20 80 32 16 46 92 56 42 12 96 64 64 42 64 58 50 42 74 28 2 4 36 32 70 50 54 92 70 16 45 76 28 16 18 50 48 2 62 94 4 12 52 52 4 100 70 60 82 62 98 42",
"output": "79"
},
{
"input": "99\n14 26 34 68 90 58 50 36 8 16 18 6 2 74 54 20 36 84 32 50 52 2 26 24 3 64 20 10 54 26 66 44 28 72 4 96 78 90 96 86 68 28 94 4 12 46 100 32 22 36 84 32 44 94 76 94 4 52 12 30 74 4 34 64 58 72 44 16 70 56 54 8 14 74 8 6 58 62 98 54 14 40 80 20 36 72 28 98 20 58 40 52 90 64 22 48 54 70 52",
"output": "25"
},
{
"input": "95\n82 86 30 78 6 46 80 66 74 72 16 24 18 52 52 38 60 36 86 26 62 28 22 46 96 26 94 84 20 46 66 88 76 32 12 86 74 18 34 88 4 48 94 6 58 6 100 82 4 24 88 32 54 98 34 48 6 76 42 88 42 28 100 4 22 2 10 66 82 54 98 20 60 66 38 98 32 47 86 58 6 100 12 46 2 42 8 84 78 28 24 70 34 28 86",
"output": "78"
},
{
"input": "90\n40 50 8 42 76 24 58 42 26 68 20 48 54 12 34 84 14 36 32 88 6 50 96 56 20 92 48 16 40 34 96 46 20 84 30 50 20 98 8 44 96 42 8 76 70 38 84 30 40 88 84 72 2 22 52 58 16 62 100 66 80 40 50 32 14 62 88 72 22 99 76 50 84 82 8 82 98 46 26 40 2 98 18 78 30 72 70 18 34 68",
"output": "70"
},
{
"input": "80\n81 43 87 1 55 43 53 61 27 19 43 13 89 9 33 83 75 55 97 71 91 37 95 5 21 69 81 93 95 69 31 83 55 7 97 7 79 57 8 61 27 85 49 1 15 97 63 79 29 73 41 85 5 41 31 93 67 11 63 59 15 99 91 77 43 69 23 23 81 73 19 1 67 51 1 75 99 67 3 81",
"output": "39"
},
{
"input": "98\n13 83 61 27 35 1 85 95 97 73 95 65 73 45 5 43 27 83 91 19 11 3 85 59 9 39 69 23 45 7 51 85 5 71 5 95 1 51 75 3 43 57 3 11 33 71 21 99 47 41 87 39 71 87 31 85 91 49 83 5 49 85 47 91 55 99 33 23 31 23 23 73 29 77 55 31 25 5 81 49 91 15 15 39 87 5 9 40 69 47 29 33 11 21 49 79 51 83",
"output": "88"
},
{
"input": "3\n100 100 1",
"output": "3"
}
] | 1,561,607,749 | 2,147,483,647 | Python 3 | OK | TESTS | 32 | 218 | 0 | input()
numbers = input().split()
even = []
not_even = []
for number in numbers:
if int(number) % 2 == 0:
even.append(number)
else:
not_even.append(number)
if len(even) == 1:
print(numbers.index(even[0]) + 1)
elif len(not_even) == 1:
print(numbers.index(not_even[0]) + 1)
else:
print('You have incorrect sequence') | Title: IQ test
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
Bob is preparing to pass IQ test. The most frequent task in this test is to find out which one of the given *n* numbers differs from the others. Bob observed that one number usually differs from the others in evenness. Help Bob — to check his answers, he needs a program that among the given *n* numbers finds one that is different in evenness.
Input Specification:
The first line contains integer *n* (3<=≤<=*n*<=≤<=100) — amount of numbers in the task. The second line contains *n* space-separated natural numbers, not exceeding 100. It is guaranteed, that exactly one of these numbers differs from the others in evenness.
Output Specification:
Output index of number that differs from the others in evenness. Numbers are numbered from 1 in the input order.
Demo Input:
['5\n2 4 7 8 10\n', '4\n1 2 1 1\n']
Demo Output:
['3\n', '2\n']
Note:
none | ```python
input()
numbers = input().split()
even = []
not_even = []
for number in numbers:
if int(number) % 2 == 0:
even.append(number)
else:
not_even.append(number)
if len(even) == 1:
print(numbers.index(even[0]) + 1)
elif len(not_even) == 1:
print(numbers.index(not_even[0]) + 1)
else:
print('You have incorrect sequence')
``` | 3.9455 |
432 | D | Prefixes and Suffixes | PROGRAMMING | 2,000 | [
"dp",
"string suffix structures",
"strings",
"two pointers"
] | null | null | You have a string *s*<==<=*s*1*s*2...*s*|*s*|, where |*s*| is the length of string *s*, and *s**i* its *i*-th character.
Let's introduce several definitions:
- A substring *s*[*i*..*j*] (1<=≤<=*i*<=≤<=*j*<=≤<=|*s*|) of string *s* is string *s**i**s**i*<=+<=1...*s**j*. - The prefix of string *s* of length *l* (1<=≤<=*l*<=≤<=|*s*|) is string *s*[1..*l*]. - The suffix of string *s* of length *l* (1<=≤<=*l*<=≤<=|*s*|) is string *s*[|*s*|<=-<=*l*<=+<=1..|*s*|].
Your task is, for any prefix of string *s* which matches a suffix of string *s*, print the number of times it occurs in string *s* as a substring. | The single line contains a sequence of characters *s*1*s*2...*s*|*s*| (1<=≤<=|*s*|<=≤<=105) — string *s*. The string only consists of uppercase English letters. | In the first line, print integer *k* (0<=≤<=*k*<=≤<=|*s*|) — the number of prefixes that match a suffix of string *s*. Next print *k* lines, in each line print two integers *l**i* *c**i*. Numbers *l**i* *c**i* mean that the prefix of the length *l**i* matches the suffix of length *l**i* and occurs in string *s* as a substring *c**i* times. Print pairs *l**i* *c**i* in the order of increasing *l**i*. | [
"ABACABA\n",
"AAA\n"
] | [
"3\n1 4\n3 2\n7 1\n",
"3\n1 3\n2 2\n3 1\n"
] | none | 2,000 | [
{
"input": "ABACABA",
"output": "3\n1 4\n3 2\n7 1"
},
{
"input": "AAA",
"output": "3\n1 3\n2 2\n3 1"
},
{
"input": "A",
"output": "1\n1 1"
},
{
"input": "AAAAAAAAAAAAAAAAXAAAAAAAAAAAAAAAAAAAAAAA",
"output": "17\n1 39\n2 37\n3 35\n4 33\n5 31\n6 29\n7 27\n8 25\n9 23\n10 21\n11 19\n12 17\n13 15\n14 13\n15 11\n16 9\n40 1"
},
{
"input": "AB",
"output": "1\n2 1"
},
{
"input": "AXAXA",
"output": "3\n1 3\n3 2\n5 1"
},
{
"input": "CODEFORCES",
"output": "1\n10 1"
},
{
"input": "GERALDPAVELGERALDPAVEL",
"output": "2\n11 2\n22 1"
},
{
"input": "ZZ",
"output": "2\n1 2\n2 1"
}
] | 1,656,759,132 | 2,147,483,647 | Python 3 | OK | TESTS | 30 | 498 | 10,649,600 | import sys
input = sys.stdin.readline
from collections import deque
S=input().strip()
LEN=len(S)
i=1
j=0
A=[0]*LEN
A[0]=LEN
while i<LEN:
while i+j<LEN and S[j]==S[i+j]:
j+=1
A[i]=j
if j==0:
i+=1
continue
k=1
while i+k<LEN and k+A[k]<j:
A[i+k]=A[k]
k+=1
i+=k
j-=k
ANS=[0]*(LEN+1)
for a in A:
ANS[a]+=1
for i in range(LEN-1,-1,-1):
ANS[i]+=ANS[i+1]
ANS2=[]
for i in range(1,LEN+1):
if A[LEN-i]==i:
ANS2.append((i,ANS[i]))
print(len(ANS2))
for x,y in ANS2:
print(x,y)
| Title: Prefixes and Suffixes
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
You have a string *s*<==<=*s*1*s*2...*s*|*s*|, where |*s*| is the length of string *s*, and *s**i* its *i*-th character.
Let's introduce several definitions:
- A substring *s*[*i*..*j*] (1<=≤<=*i*<=≤<=*j*<=≤<=|*s*|) of string *s* is string *s**i**s**i*<=+<=1...*s**j*. - The prefix of string *s* of length *l* (1<=≤<=*l*<=≤<=|*s*|) is string *s*[1..*l*]. - The suffix of string *s* of length *l* (1<=≤<=*l*<=≤<=|*s*|) is string *s*[|*s*|<=-<=*l*<=+<=1..|*s*|].
Your task is, for any prefix of string *s* which matches a suffix of string *s*, print the number of times it occurs in string *s* as a substring.
Input Specification:
The single line contains a sequence of characters *s*1*s*2...*s*|*s*| (1<=≤<=|*s*|<=≤<=105) — string *s*. The string only consists of uppercase English letters.
Output Specification:
In the first line, print integer *k* (0<=≤<=*k*<=≤<=|*s*|) — the number of prefixes that match a suffix of string *s*. Next print *k* lines, in each line print two integers *l**i* *c**i*. Numbers *l**i* *c**i* mean that the prefix of the length *l**i* matches the suffix of length *l**i* and occurs in string *s* as a substring *c**i* times. Print pairs *l**i* *c**i* in the order of increasing *l**i*.
Demo Input:
['ABACABA\n', 'AAA\n']
Demo Output:
['3\n1 4\n3 2\n7 1\n', '3\n1 3\n2 2\n3 1\n']
Note:
none | ```python
import sys
input = sys.stdin.readline
from collections import deque
S=input().strip()
LEN=len(S)
i=1
j=0
A=[0]*LEN
A[0]=LEN
while i<LEN:
while i+j<LEN and S[j]==S[i+j]:
j+=1
A[i]=j
if j==0:
i+=1
continue
k=1
while i+k<LEN and k+A[k]<j:
A[i+k]=A[k]
k+=1
i+=k
j-=k
ANS=[0]*(LEN+1)
for a in A:
ANS[a]+=1
for i in range(LEN-1,-1,-1):
ANS[i]+=ANS[i+1]
ANS2=[]
for i in range(1,LEN+1):
if A[LEN-i]==i:
ANS2.append((i,ANS[i]))
print(len(ANS2))
for x,y in ANS2:
print(x,y)
``` | 3 |
|
50 | A | Domino piling | PROGRAMMING | 800 | [
"greedy",
"math"
] | A. Domino piling | 2 | 256 | You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions. | In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16). | Output one number — the maximal number of dominoes, which can be placed. | [
"2 4\n",
"3 3\n"
] | [
"4\n",
"4\n"
] | none | 500 | [
{
"input": "2 4",
"output": "4"
},
{
"input": "3 3",
"output": "4"
},
{
"input": "1 5",
"output": "2"
},
{
"input": "1 6",
"output": "3"
},
{
"input": "1 15",
"output": "7"
},
{
"input": "1 16",
"output": "8"
},
{
"input": "2 5",
"output": "5"
},
{
"input": "2 6",
"output": "6"
},
{
"input": "2 7",
"output": "7"
},
{
"input": "2 14",
"output": "14"
},
{
"input": "2 15",
"output": "15"
},
{
"input": "1 4",
"output": "2"
},
{
"input": "2 16",
"output": "16"
},
{
"input": "3 5",
"output": "7"
},
{
"input": "3 6",
"output": "9"
},
{
"input": "3 10",
"output": "15"
},
{
"input": "3 14",
"output": "21"
},
{
"input": "3 15",
"output": "22"
},
{
"input": "3 16",
"output": "24"
},
{
"input": "5 7",
"output": "17"
},
{
"input": "16 16",
"output": "128"
},
{
"input": "15 16",
"output": "120"
},
{
"input": "2 3",
"output": "3"
},
{
"input": "15 15",
"output": "112"
},
{
"input": "14 16",
"output": "112"
},
{
"input": "11 13",
"output": "71"
},
{
"input": "5 16",
"output": "40"
},
{
"input": "8 15",
"output": "60"
},
{
"input": "2 2",
"output": "2"
},
{
"input": "3 4",
"output": "6"
},
{
"input": "4 4",
"output": "8"
},
{
"input": "1 1",
"output": "0"
},
{
"input": "1 2",
"output": "1"
},
{
"input": "1 3",
"output": "1"
},
{
"input": "14 15",
"output": "105"
}
] | 1,660,718,949 | 2,147,483,647 | Python 3 | OK | TESTS | 35 | 92 | 0 | m,n=map(int,input().split())
a=m/2
b=n/1
c=a*b
print(int(c)) | Title: Domino piling
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
You are given a rectangular board of *M*<=×<=*N* squares. Also you are given an unlimited number of standard domino pieces of 2<=×<=1 squares. You are allowed to rotate the pieces. You are asked to place as many dominoes as possible on the board so as to meet the following conditions:
1. Each domino completely covers two squares.
2. No two dominoes overlap.
3. Each domino lies entirely inside the board. It is allowed to touch the edges of the board.
Find the maximum number of dominoes, which can be placed under these restrictions.
Input Specification:
In a single line you are given two integers *M* and *N* — board sizes in squares (1<=≤<=*M*<=≤<=*N*<=≤<=16).
Output Specification:
Output one number — the maximal number of dominoes, which can be placed.
Demo Input:
['2 4\n', '3 3\n']
Demo Output:
['4\n', '4\n']
Note:
none | ```python
m,n=map(int,input().split())
a=m/2
b=n/1
c=a*b
print(int(c))
``` | 3.977 |
706 | B | Interesting drink | PROGRAMMING | 1,100 | [
"binary search",
"dp",
"implementation"
] | null | null | Vasiliy likes to rest after a hard work, so you may often meet him in some bar nearby. As all programmers do, he loves the famous drink "Beecola", which can be bought in *n* different shops in the city. It's known that the price of one bottle in the shop *i* is equal to *x**i* coins.
Vasiliy plans to buy his favorite drink for *q* consecutive days. He knows, that on the *i*-th day he will be able to spent *m**i* coins. Now, for each of the days he want to know in how many different shops he can buy a bottle of "Beecola". | The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of shops in the city that sell Vasiliy's favourite drink.
The second line contains *n* integers *x**i* (1<=≤<=*x**i*<=≤<=100<=000) — prices of the bottles of the drink in the *i*-th shop.
The third line contains a single integer *q* (1<=≤<=*q*<=≤<=100<=000) — the number of days Vasiliy plans to buy the drink.
Then follow *q* lines each containing one integer *m**i* (1<=≤<=*m**i*<=≤<=109) — the number of coins Vasiliy can spent on the *i*-th day. | Print *q* integers. The *i*-th of them should be equal to the number of shops where Vasiliy will be able to buy a bottle of the drink on the *i*-th day. | [
"5\n3 10 8 6 11\n4\n1\n10\n3\n11\n"
] | [
"0\n4\n1\n5\n"
] | On the first day, Vasiliy won't be able to buy a drink in any of the shops.
On the second day, Vasiliy can buy a drink in the shops 1, 2, 3 and 4.
On the third day, Vasiliy can buy a drink only in the shop number 1.
Finally, on the last day Vasiliy can buy a drink in any shop. | 1,000 | [
{
"input": "5\n3 10 8 6 11\n4\n1\n10\n3\n11",
"output": "0\n4\n1\n5"
},
{
"input": "5\n868 987 714 168 123\n10\n424\n192\n795\n873\n117\n914\n735\n158\n631\n471",
"output": "2\n2\n3\n4\n0\n4\n3\n1\n2\n2"
},
{
"input": "3\n435 482 309\n7\n245\n241\n909\n745\n980\n29\n521",
"output": "0\n0\n3\n3\n3\n0\n3"
},
{
"input": "1\n653\n9\n903\n980\n80\n770\n965\n874\n381\n657\n969",
"output": "1\n1\n0\n1\n1\n1\n0\n1\n1"
},
{
"input": "12\n35345 58181 32223 84621 35905 73863 99537 30666 67771 39229 36847 29038\n23\n55052824\n82504840\n35160556\n78141700\n73401989\n86305919\n39430705\n31939373\n23501765\n4406029\n61436920\n14295390\n34275309\n28028753\n85724689\n70158847\n2396455\n66994588\n84024224\n30175981\n65622319\n76517111\n76605341",
"output": "12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12\n12"
},
{
"input": "4\n698 193 1584 76192\n4\n553640\n310518\n274280\n429192",
"output": "4\n4\n4\n4"
},
{
"input": "1\n1\n1\n1000000000",
"output": "1"
},
{
"input": "1\n1\n1\n100005",
"output": "1"
},
{
"input": "3\n1 2 3\n1\n100005",
"output": "3"
},
{
"input": "2\n1 2\n3\n100004\n100005\n100006",
"output": "2\n2\n2"
},
{
"input": "3\n1 1 1\n1\n1",
"output": "3"
},
{
"input": "1\n1\n1\n1",
"output": "1"
},
{
"input": "3\n1 2 3\n1\n100000",
"output": "3"
},
{
"input": "5\n1 1 1 1 10\n2\n1\n10",
"output": "4\n5"
},
{
"input": "5\n3 10 8 6 11\n1\n10000000",
"output": "5"
}
] | 1,699,580,003 | 2,147,483,647 | Python 3 | OK | TESTS | 103 | 733 | 13,619,200 | import bisect
N=int(input())
x=sorted(list(map(int,input().split())))
for i in range(int(input())):
print(bisect.bisect(x,int(input()))) | Title: Interesting drink
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasiliy likes to rest after a hard work, so you may often meet him in some bar nearby. As all programmers do, he loves the famous drink "Beecola", which can be bought in *n* different shops in the city. It's known that the price of one bottle in the shop *i* is equal to *x**i* coins.
Vasiliy plans to buy his favorite drink for *q* consecutive days. He knows, that on the *i*-th day he will be able to spent *m**i* coins. Now, for each of the days he want to know in how many different shops he can buy a bottle of "Beecola".
Input Specification:
The first line of the input contains a single integer *n* (1<=≤<=*n*<=≤<=100<=000) — the number of shops in the city that sell Vasiliy's favourite drink.
The second line contains *n* integers *x**i* (1<=≤<=*x**i*<=≤<=100<=000) — prices of the bottles of the drink in the *i*-th shop.
The third line contains a single integer *q* (1<=≤<=*q*<=≤<=100<=000) — the number of days Vasiliy plans to buy the drink.
Then follow *q* lines each containing one integer *m**i* (1<=≤<=*m**i*<=≤<=109) — the number of coins Vasiliy can spent on the *i*-th day.
Output Specification:
Print *q* integers. The *i*-th of them should be equal to the number of shops where Vasiliy will be able to buy a bottle of the drink on the *i*-th day.
Demo Input:
['5\n3 10 8 6 11\n4\n1\n10\n3\n11\n']
Demo Output:
['0\n4\n1\n5\n']
Note:
On the first day, Vasiliy won't be able to buy a drink in any of the shops.
On the second day, Vasiliy can buy a drink in the shops 1, 2, 3 and 4.
On the third day, Vasiliy can buy a drink only in the shop number 1.
Finally, on the last day Vasiliy can buy a drink in any shop. | ```python
import bisect
N=int(input())
x=sorted(list(map(int,input().split())))
for i in range(int(input())):
print(bisect.bisect(x,int(input())))
``` | 3 |
|
337 | B | Routine Problem | PROGRAMMING | 1,400 | [
"greedy",
"math",
"number theory"
] | null | null | Manao has a monitor. The screen of the monitor has horizontal to vertical length ratio *a*:*b*. Now he is going to watch a movie. The movie's frame has horizontal to vertical length ratio *c*:*d*. Manao adjusts the view in such a way that the movie preserves the original frame ratio, but also occupies as much space on the screen as possible and fits within it completely. Thus, he may have to zoom the movie in or out, but Manao will always change the frame proportionally in both dimensions.
Calculate the ratio of empty screen (the part of the screen not occupied by the movie) to the total screen size. Print the answer as an irreducible fraction *p*<=/<=*q*. | A single line contains four space-separated integers *a*, *b*, *c*, *d* (1<=≤<=*a*,<=*b*,<=*c*,<=*d*<=≤<=1000). | Print the answer to the problem as "p/q", where *p* is a non-negative integer, *q* is a positive integer and numbers *p* and *q* don't have a common divisor larger than 1. | [
"1 1 3 2\n",
"4 3 2 2\n"
] | [
"1/3\n",
"1/4\n"
] | Sample 1. Manao's monitor has a square screen. The movie has 3:2 horizontal to vertical length ratio. Obviously, the movie occupies most of the screen if the width of the picture coincides with the width of the screen. In this case, only 2/3 of the monitor will project the movie in the horizontal dimension: <img class="tex-graphics" src="https://espresso.codeforces.com/ce823413ad27813e27496a0d8bd4231e94b47662.png" style="max-width: 100.0%;max-height: 100.0%;"/>
Sample 2. This time the monitor's width is 4/3 times larger than its height and the movie's frame is square. In this case, the picture must take up the whole monitor in the vertical dimension and only 3/4 in the horizontal dimension: <img class="tex-graphics" src="https://espresso.codeforces.com/c2bcb3b1f64810812eee368ff180e3e148d24c67.png" style="max-width: 100.0%;max-height: 100.0%;"/> | 1,000 | [
{
"input": "1 1 3 2",
"output": "1/3"
},
{
"input": "4 3 2 2",
"output": "1/4"
},
{
"input": "3 4 2 3",
"output": "1/9"
},
{
"input": "4 4 5 5",
"output": "0/1"
},
{
"input": "1 1 1 1",
"output": "0/1"
},
{
"input": "1000 1000 1000 1000",
"output": "0/1"
},
{
"input": "125 992 14 25",
"output": "10763/13888"
},
{
"input": "999 998 997 996",
"output": "1/497503"
},
{
"input": "984 286 976 284",
"output": "10/8733"
},
{
"input": "999 1000 1000 999",
"output": "1999/1000000"
},
{
"input": "999 1000 998 999",
"output": "1/998001"
},
{
"input": "1 1000 1000 1",
"output": "999999/1000000"
},
{
"input": "1 999 1000 1",
"output": "998999/999000"
},
{
"input": "50 80 6 3",
"output": "11/16"
},
{
"input": "114 891 20 3",
"output": "971/990"
},
{
"input": "10 13 75 57",
"output": "27/65"
},
{
"input": "21 35 34 51",
"output": "1/10"
},
{
"input": "41 95 82 30",
"output": "16/19"
},
{
"input": "123 150 82 60",
"output": "2/5"
},
{
"input": "100 175 164 82",
"output": "5/7"
},
{
"input": "101 202 37 72",
"output": "1/37"
},
{
"input": "103 305 34 61",
"output": "67/170"
},
{
"input": "100 131 70 77",
"output": "21/131"
},
{
"input": "193 246 82 95",
"output": "1837/20172"
},
{
"input": "188 199 121 123",
"output": "955/24079"
},
{
"input": "289 361 162 198",
"output": "70/3249"
},
{
"input": "294 356 178 185",
"output": "4489/31684"
},
{
"input": "201 335 268 402",
"output": "1/10"
},
{
"input": "202 404 404 505",
"output": "3/8"
},
{
"input": "206 412 309 515",
"output": "1/6"
},
{
"input": "803 949 657 730",
"output": "7/117"
},
{
"input": "804 938 871 938",
"output": "1/13"
},
{
"input": "826 944 826 885",
"output": "1/16"
},
{
"input": "603 938 804 871",
"output": "17/56"
}
] | 1,690,818,421 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 4 | 92 | 0 | a,b,c,d=map(int,input().split())
m1=max(a,b)
m2=max(c,d)
if a==d and b==c:
print(str(min(c,d)+min(a,b)+1)+'/'+str(max(a,b)*max(a,b)))
else:
a=a*m2
b=b*m2
c=c*m1
d=d*m1
l=[a,b,c,d]
l.sort()
l=l[:2]
for i in range(2,l[0]):
while l[0]%i==0 and l[1]%i==0:
l[0]=l[0]//i
l[1]=l[1]//i
print(str(max(l)-min(l))+'/'+str(max(l)))
| Title: Routine Problem
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Manao has a monitor. The screen of the monitor has horizontal to vertical length ratio *a*:*b*. Now he is going to watch a movie. The movie's frame has horizontal to vertical length ratio *c*:*d*. Manao adjusts the view in such a way that the movie preserves the original frame ratio, but also occupies as much space on the screen as possible and fits within it completely. Thus, he may have to zoom the movie in or out, but Manao will always change the frame proportionally in both dimensions.
Calculate the ratio of empty screen (the part of the screen not occupied by the movie) to the total screen size. Print the answer as an irreducible fraction *p*<=/<=*q*.
Input Specification:
A single line contains four space-separated integers *a*, *b*, *c*, *d* (1<=≤<=*a*,<=*b*,<=*c*,<=*d*<=≤<=1000).
Output Specification:
Print the answer to the problem as "p/q", where *p* is a non-negative integer, *q* is a positive integer and numbers *p* and *q* don't have a common divisor larger than 1.
Demo Input:
['1 1 3 2\n', '4 3 2 2\n']
Demo Output:
['1/3\n', '1/4\n']
Note:
Sample 1. Manao's monitor has a square screen. The movie has 3:2 horizontal to vertical length ratio. Obviously, the movie occupies most of the screen if the width of the picture coincides with the width of the screen. In this case, only 2/3 of the monitor will project the movie in the horizontal dimension: <img class="tex-graphics" src="https://espresso.codeforces.com/ce823413ad27813e27496a0d8bd4231e94b47662.png" style="max-width: 100.0%;max-height: 100.0%;"/>
Sample 2. This time the monitor's width is 4/3 times larger than its height and the movie's frame is square. In this case, the picture must take up the whole monitor in the vertical dimension and only 3/4 in the horizontal dimension: <img class="tex-graphics" src="https://espresso.codeforces.com/c2bcb3b1f64810812eee368ff180e3e148d24c67.png" style="max-width: 100.0%;max-height: 100.0%;"/> | ```python
a,b,c,d=map(int,input().split())
m1=max(a,b)
m2=max(c,d)
if a==d and b==c:
print(str(min(c,d)+min(a,b)+1)+'/'+str(max(a,b)*max(a,b)))
else:
a=a*m2
b=b*m2
c=c*m1
d=d*m1
l=[a,b,c,d]
l.sort()
l=l[:2]
for i in range(2,l[0]):
while l[0]%i==0 and l[1]%i==0:
l[0]=l[0]//i
l[1]=l[1]//i
print(str(max(l)-min(l))+'/'+str(max(l)))
``` | 0 |
|
581 | A | Vasya the Hipster | PROGRAMMING | 800 | [
"implementation",
"math"
] | null | null | One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks.
According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot.
Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them.
Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Can you help him? | The single line of the input contains two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100) — the number of red and blue socks that Vasya's got. | Print two space-separated integers — the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day. | [
"3 1\n",
"2 3\n",
"7 3\n"
] | [
"1 1\n",
"2 0\n",
"3 2\n"
] | In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day. | 500 | [
{
"input": "3 1",
"output": "1 1"
},
{
"input": "2 3",
"output": "2 0"
},
{
"input": "7 3",
"output": "3 2"
},
{
"input": "100 100",
"output": "100 0"
},
{
"input": "4 10",
"output": "4 3"
},
{
"input": "6 10",
"output": "6 2"
},
{
"input": "6 11",
"output": "6 2"
},
{
"input": "10 40",
"output": "10 15"
},
{
"input": "11 56",
"output": "11 22"
},
{
"input": "34 30",
"output": "30 2"
},
{
"input": "33 33",
"output": "33 0"
},
{
"input": "100 45",
"output": "45 27"
},
{
"input": "100 23",
"output": "23 38"
},
{
"input": "45 12",
"output": "12 16"
},
{
"input": "1 1",
"output": "1 0"
},
{
"input": "1 100",
"output": "1 49"
},
{
"input": "100 1",
"output": "1 49"
},
{
"input": "68 59",
"output": "59 4"
},
{
"input": "45 99",
"output": "45 27"
},
{
"input": "99 100",
"output": "99 0"
},
{
"input": "100 98",
"output": "98 1"
},
{
"input": "59 12",
"output": "12 23"
},
{
"input": "86 4",
"output": "4 41"
},
{
"input": "68 21",
"output": "21 23"
},
{
"input": "100 11",
"output": "11 44"
},
{
"input": "100 10",
"output": "10 45"
},
{
"input": "15 45",
"output": "15 15"
},
{
"input": "11 32",
"output": "11 10"
},
{
"input": "34 96",
"output": "34 31"
},
{
"input": "89 89",
"output": "89 0"
}
] | 1,663,080,688 | 2,147,483,647 | Python 3 | OK | TESTS | 30 | 46 | 0 | a, b = map(int,input().split())
p = min(a,b)
left = (a+b)-(2*p)
left = left//2
print(f"{p} {left}") | Title: Vasya the Hipster
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
One day Vasya the Hipster decided to count how many socks he had. It turned out that he had *a* red socks and *b* blue socks.
According to the latest fashion, hipsters should wear the socks of different colors: a red one on the left foot, a blue one on the right foot.
Every day Vasya puts on new socks in the morning and throws them away before going to bed as he doesn't want to wash them.
Vasya wonders, what is the maximum number of days when he can dress fashionable and wear different socks, and after that, for how many days he can then wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Can you help him?
Input Specification:
The single line of the input contains two positive integers *a* and *b* (1<=≤<=*a*,<=*b*<=≤<=100) — the number of red and blue socks that Vasya's got.
Output Specification:
Print two space-separated integers — the maximum number of days when Vasya can wear different socks and the number of days when he can wear the same socks until he either runs out of socks or cannot make a single pair from the socks he's got.
Keep in mind that at the end of the day Vasya throws away the socks that he's been wearing on that day.
Demo Input:
['3 1\n', '2 3\n', '7 3\n']
Demo Output:
['1 1\n', '2 0\n', '3 2\n']
Note:
In the first sample Vasya can first put on one pair of different socks, after that he has two red socks left to wear on the second day. | ```python
a, b = map(int,input().split())
p = min(a,b)
left = (a+b)-(2*p)
left = left//2
print(f"{p} {left}")
``` | 3 |
|
938 | D | Buy a Ticket | PROGRAMMING | 2,000 | [
"data structures",
"graphs",
"shortest paths"
] | null | null | Musicians of a popular band "Flayer" have announced that they are going to "make their exit" with a world tour. Of course, they will visit Berland as well.
There are *n* cities in Berland. People can travel between cities using two-directional train routes; there are exactly *m* routes, *i*-th route can be used to go from city *v**i* to city *u**i* (and from *u**i* to *v**i*), and it costs *w**i* coins to use this route.
Each city will be visited by "Flayer", and the cost of the concert ticket in *i*-th city is *a**i* coins.
You have friends in every city of Berland, and they, knowing about your programming skills, asked you to calculate the minimum possible number of coins they have to pay to visit the concert. For every city *i* you have to compute the minimum number of coins a person from city *i* has to spend to travel to some city *j* (or possibly stay in city *i*), attend a concert there, and return to city *i* (if *j*<=≠<=*i*).
Formally, for every you have to calculate , where *d*(*i*,<=*j*) is the minimum number of coins you have to spend to travel from city *i* to city *j*. If there is no way to reach city *j* from city *i*, then we consider *d*(*i*,<=*j*) to be infinitely large. | The first line contains two integers *n* and *m* (2<=≤<=*n*<=≤<=2·105, 1<=≤<=*m*<=≤<=2·105).
Then *m* lines follow, *i*-th contains three integers *v**i*, *u**i* and *w**i* (1<=≤<=*v**i*,<=*u**i*<=≤<=*n*,<=*v**i*<=≠<=*u**i*, 1<=≤<=*w**i*<=≤<=1012) denoting *i*-th train route. There are no multiple train routes connecting the same pair of cities, that is, for each (*v*,<=*u*) neither extra (*v*,<=*u*) nor (*u*,<=*v*) present in input.
The next line contains *n* integers *a*1,<=*a*2,<=... *a**k* (1<=≤<=*a**i*<=≤<=1012) — price to attend the concert in *i*-th city. | Print *n* integers. *i*-th of them must be equal to the minimum number of coins a person from city *i* has to spend to travel to some city *j* (or possibly stay in city *i*), attend a concert there, and return to city *i* (if *j*<=≠<=*i*). | [
"4 2\n1 2 4\n2 3 7\n6 20 1 25\n",
"3 3\n1 2 1\n2 3 1\n1 3 1\n30 10 20\n"
] | [
"6 14 1 25 \n",
"12 10 12 \n"
] | none | 0 | [
{
"input": "4 2\n1 2 4\n2 3 7\n6 20 1 25",
"output": "6 14 1 25 "
},
{
"input": "3 3\n1 2 1\n2 3 1\n1 3 1\n30 10 20",
"output": "12 10 12 "
},
{
"input": "7 7\n1 6 745325\n2 3 3581176\n2 4 19\n3 6 71263060078\n5 4 141198\n7 4 163953\n5 6 15994\n1 297404206755 82096176217 14663411 187389745 21385 704393",
"output": "1 335807 7498159 335769 53373 21385 663675 "
}
] | 1,588,171,646 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 93 | 307,200 | import numpy as np
n,m = input().split()
n = int(n)
m = int(m)
ciudades = np.zeros((n,n))
for i in range(m):
u,v,w = input().split()
u = int(u)
v = int(v)
w = int (w)
ciudades[u-1][v-1] = w
ciudades[v-1][u-1] = w
costo = input()
costos = costo.split()
for i in range(n):
costos[i] = int(costos[i])
for i in range(n):
for j in range(n):
if (ciudades[i][j] != 0):
cost = 2* ciudades[i][j] + costos[j]
if(cost < int(costos[i])):
costos[i] = int(cost)
print(*costos)
| Title: Buy a Ticket
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Musicians of a popular band "Flayer" have announced that they are going to "make their exit" with a world tour. Of course, they will visit Berland as well.
There are *n* cities in Berland. People can travel between cities using two-directional train routes; there are exactly *m* routes, *i*-th route can be used to go from city *v**i* to city *u**i* (and from *u**i* to *v**i*), and it costs *w**i* coins to use this route.
Each city will be visited by "Flayer", and the cost of the concert ticket in *i*-th city is *a**i* coins.
You have friends in every city of Berland, and they, knowing about your programming skills, asked you to calculate the minimum possible number of coins they have to pay to visit the concert. For every city *i* you have to compute the minimum number of coins a person from city *i* has to spend to travel to some city *j* (or possibly stay in city *i*), attend a concert there, and return to city *i* (if *j*<=≠<=*i*).
Formally, for every you have to calculate , where *d*(*i*,<=*j*) is the minimum number of coins you have to spend to travel from city *i* to city *j*. If there is no way to reach city *j* from city *i*, then we consider *d*(*i*,<=*j*) to be infinitely large.
Input Specification:
The first line contains two integers *n* and *m* (2<=≤<=*n*<=≤<=2·105, 1<=≤<=*m*<=≤<=2·105).
Then *m* lines follow, *i*-th contains three integers *v**i*, *u**i* and *w**i* (1<=≤<=*v**i*,<=*u**i*<=≤<=*n*,<=*v**i*<=≠<=*u**i*, 1<=≤<=*w**i*<=≤<=1012) denoting *i*-th train route. There are no multiple train routes connecting the same pair of cities, that is, for each (*v*,<=*u*) neither extra (*v*,<=*u*) nor (*u*,<=*v*) present in input.
The next line contains *n* integers *a*1,<=*a*2,<=... *a**k* (1<=≤<=*a**i*<=≤<=1012) — price to attend the concert in *i*-th city.
Output Specification:
Print *n* integers. *i*-th of them must be equal to the minimum number of coins a person from city *i* has to spend to travel to some city *j* (or possibly stay in city *i*), attend a concert there, and return to city *i* (if *j*<=≠<=*i*).
Demo Input:
['4 2\n1 2 4\n2 3 7\n6 20 1 25\n', '3 3\n1 2 1\n2 3 1\n1 3 1\n30 10 20\n']
Demo Output:
['6 14 1 25 \n', '12 10 12 \n']
Note:
none | ```python
import numpy as np
n,m = input().split()
n = int(n)
m = int(m)
ciudades = np.zeros((n,n))
for i in range(m):
u,v,w = input().split()
u = int(u)
v = int(v)
w = int (w)
ciudades[u-1][v-1] = w
ciudades[v-1][u-1] = w
costo = input()
costos = costo.split()
for i in range(n):
costos[i] = int(costos[i])
for i in range(n):
for j in range(n):
if (ciudades[i][j] != 0):
cost = 2* ciudades[i][j] + costos[j]
if(cost < int(costos[i])):
costos[i] = int(cost)
print(*costos)
``` | -1 |
|
1 | A | Theatre Square | PROGRAMMING | 1,000 | [
"math"
] | A. Theatre Square | 1 | 256 | Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square. | The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109). | Write the needed number of flagstones. | [
"6 6 4\n"
] | [
"4\n"
] | none | 0 | [
{
"input": "6 6 4",
"output": "4"
},
{
"input": "1 1 1",
"output": "1"
},
{
"input": "2 1 1",
"output": "2"
},
{
"input": "1 2 1",
"output": "2"
},
{
"input": "2 2 1",
"output": "4"
},
{
"input": "2 1 2",
"output": "1"
},
{
"input": "1 1 3",
"output": "1"
},
{
"input": "2 3 4",
"output": "1"
},
{
"input": "1000000000 1000000000 1",
"output": "1000000000000000000"
},
{
"input": "12 13 4",
"output": "12"
},
{
"input": "222 332 5",
"output": "3015"
},
{
"input": "1000 1000 10",
"output": "10000"
},
{
"input": "1001 1000 10",
"output": "10100"
},
{
"input": "100 10001 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 1000000000",
"output": "1"
},
{
"input": "1000000000 1000000000 999999999",
"output": "4"
},
{
"input": "1000000000 1000000000 192",
"output": "27126743055556"
},
{
"input": "1000000000 987654321 1",
"output": "987654321000000000"
},
{
"input": "456784567 1000000000 51",
"output": "175618850864484"
},
{
"input": "39916800 134217728 40320",
"output": "3295710"
}
] | 1,664,808,748 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 46 | 0 | numbers= input().split()
n = numbers[0]
m = numbers[1]
a = numbers[2]
s1 = n * m
s2 = a * a
if s1 % s2 == 0:
count = s1 / s2
else:
s1_ = s1 / 2
count = s1_ // s2 + 1
print(count) | Title: Theatre Square
Time Limit: 1 seconds
Memory Limit: 256 megabytes
Problem Description:
Theatre Square in the capital city of Berland has a rectangular shape with the size *n*<=×<=*m* meters. On the occasion of the city's anniversary, a decision was taken to pave the Square with square granite flagstones. Each flagstone is of the size *a*<=×<=*a*.
What is the least number of flagstones needed to pave the Square? It's allowed to cover the surface larger than the Theatre Square, but the Square has to be covered. It's not allowed to break the flagstones. The sides of flagstones should be parallel to the sides of the Square.
Input Specification:
The input contains three positive integer numbers in the first line: *n*,<=<=*m* and *a* (1<=≤<=<=*n*,<=*m*,<=*a*<=≤<=109).
Output Specification:
Write the needed number of flagstones.
Demo Input:
['6 6 4\n']
Demo Output:
['4\n']
Note:
none | ```python
numbers= input().split()
n = numbers[0]
m = numbers[1]
a = numbers[2]
s1 = n * m
s2 = a * a
if s1 % s2 == 0:
count = s1 / s2
else:
s1_ = s1 / 2
count = s1_ // s2 + 1
print(count)
``` | -1 |
143 | A | Help Vasilisa the Wise 2 | PROGRAMMING | 1,000 | [
"brute force",
"math"
] | null | null | Vasilisa the Wise from the Kingdom of Far Far Away got a magic box with a secret as a present from her friend Hellawisa the Wise from the Kingdom of A Little Closer. However, Vasilisa the Wise does not know what the box's secret is, since she cannot open it again. She hopes that you will help her one more time with that.
The box's lock looks as follows: it contains 4 identical deepenings for gems as a 2<=×<=2 square, and some integer numbers are written at the lock's edge near the deepenings. The example of a lock is given on the picture below.
The box is accompanied with 9 gems. Their shapes match the deepenings' shapes and each gem contains one number from 1 to 9 (each number is written on exactly one gem). The box will only open after it is decorated with gems correctly: that is, each deepening in the lock should be filled with exactly one gem. Also, the sums of numbers in the square's rows, columns and two diagonals of the square should match the numbers written at the lock's edge. For example, the above lock will open if we fill the deepenings with gems with numbers as is shown on the picture below.
Now Vasilisa the Wise wants to define, given the numbers on the box's lock, which gems she should put in the deepenings to open the box. Help Vasilisa to solve this challenging task. | The input contains numbers written on the edges of the lock of the box. The first line contains space-separated integers *r*1 and *r*2 that define the required sums of numbers in the rows of the square. The second line contains space-separated integers *c*1 and *c*2 that define the required sums of numbers in the columns of the square. The third line contains space-separated integers *d*1 and *d*2 that define the required sums of numbers on the main and on the side diagonals of the square (1<=≤<=*r*1,<=*r*2,<=*c*1,<=*c*2,<=*d*1,<=*d*2<=≤<=20). Correspondence between the above 6 variables and places where they are written is shown on the picture below. For more clarifications please look at the second sample test that demonstrates the example given in the problem statement. | Print the scheme of decorating the box with stones: two lines containing two space-separated integers from 1 to 9. The numbers should be pairwise different. If there is no solution for the given lock, then print the single number "-1" (without the quotes).
If there are several solutions, output any. | [
"3 7\n4 6\n5 5\n",
"11 10\n13 8\n5 16\n",
"1 2\n3 4\n5 6\n",
"10 10\n10 10\n10 10\n"
] | [
"1 2\n3 4\n",
"4 7\n9 1\n",
"-1\n",
"-1\n"
] | Pay attention to the last test from the statement: it is impossible to open the box because for that Vasilisa the Wise would need 4 identical gems containing number "5". However, Vasilisa only has one gem with each number from 1 to 9. | 500 | [
{
"input": "3 7\n4 6\n5 5",
"output": "1 2\n3 4"
},
{
"input": "11 10\n13 8\n5 16",
"output": "4 7\n9 1"
},
{
"input": "1 2\n3 4\n5 6",
"output": "-1"
},
{
"input": "10 10\n10 10\n10 10",
"output": "-1"
},
{
"input": "5 13\n8 10\n11 7",
"output": "3 2\n5 8"
},
{
"input": "12 17\n10 19\n13 16",
"output": "-1"
},
{
"input": "11 11\n17 5\n12 10",
"output": "9 2\n8 3"
},
{
"input": "12 11\n11 12\n16 7",
"output": "-1"
},
{
"input": "5 9\n7 7\n8 6",
"output": "3 2\n4 5"
},
{
"input": "10 7\n4 13\n11 6",
"output": "-1"
},
{
"input": "18 10\n16 12\n12 16",
"output": "-1"
},
{
"input": "13 6\n10 9\n6 13",
"output": "-1"
},
{
"input": "14 16\n16 14\n18 12",
"output": "-1"
},
{
"input": "16 10\n16 10\n12 14",
"output": "-1"
},
{
"input": "11 9\n12 8\n11 9",
"output": "-1"
},
{
"input": "5 14\n10 9\n10 9",
"output": "-1"
},
{
"input": "2 4\n1 5\n3 3",
"output": "-1"
},
{
"input": "17 16\n14 19\n18 15",
"output": "-1"
},
{
"input": "12 12\n14 10\n16 8",
"output": "9 3\n5 7"
},
{
"input": "15 11\n16 10\n9 17",
"output": "7 8\n9 2"
},
{
"input": "8 10\n9 9\n13 5",
"output": "6 2\n3 7"
},
{
"input": "13 7\n10 10\n5 15",
"output": "4 9\n6 1"
},
{
"input": "14 11\n9 16\n16 9",
"output": "-1"
},
{
"input": "12 8\n14 6\n8 12",
"output": "-1"
},
{
"input": "10 6\n6 10\n4 12",
"output": "-1"
},
{
"input": "10 8\n10 8\n4 14",
"output": "-1"
},
{
"input": "14 13\n9 18\n14 13",
"output": "-1"
},
{
"input": "9 14\n8 15\n8 15",
"output": "-1"
},
{
"input": "3 8\n2 9\n6 5",
"output": "-1"
},
{
"input": "14 17\n18 13\n15 16",
"output": "-1"
},
{
"input": "16 14\n15 15\n17 13",
"output": "9 7\n6 8"
},
{
"input": "14 11\n16 9\n13 12",
"output": "9 5\n7 4"
},
{
"input": "13 10\n11 12\n7 16",
"output": "4 9\n7 3"
},
{
"input": "14 8\n11 11\n13 9",
"output": "8 6\n3 5"
},
{
"input": "12 11\n13 10\n10 13",
"output": "-1"
},
{
"input": "6 5\n2 9\n5 6",
"output": "-1"
},
{
"input": "7 8\n8 7\n12 3",
"output": "-1"
},
{
"input": "7 11\n7 11\n6 12",
"output": "-1"
},
{
"input": "8 5\n11 2\n8 5",
"output": "-1"
},
{
"input": "10 16\n14 12\n14 12",
"output": "-1"
},
{
"input": "7 9\n4 12\n5 11",
"output": "-1"
},
{
"input": "11 13\n19 5\n12 12",
"output": "-1"
},
{
"input": "8 12\n5 15\n11 9",
"output": "2 6\n3 9"
},
{
"input": "16 5\n13 8\n10 11",
"output": "9 7\n4 1"
},
{
"input": "3 14\n8 9\n10 7",
"output": "2 1\n6 8"
},
{
"input": "12 14\n11 15\n9 17",
"output": "3 9\n8 6"
},
{
"input": "13 7\n9 11\n14 6",
"output": "8 5\n1 6"
},
{
"input": "13 8\n15 6\n11 10",
"output": "9 4\n6 2"
},
{
"input": "9 6\n5 10\n3 12",
"output": "1 8\n4 2"
},
{
"input": "12 7\n5 14\n8 11",
"output": "3 9\n2 5"
},
{
"input": "9 12\n3 17\n10 10",
"output": "-1"
},
{
"input": "3 8\n4 6\n5 5",
"output": "-1"
}
] | 1,593,610,479 | 2,147,483,647 | Python 3 | RUNTIME_ERROR | TESTS | 0 | 218 | 307,200 | import sympy as sp
r1, r2 = input("").split() #Rows of square
c1, c2 = input("").split() #colums of square
d1, d2 = input("").split() #diagonals of square
x1, x2, y1, y2 = sp.symbols("x1, x2, y1, y2")
eq1 = sp.Eq(x1 + y1, int(c1))
eq2 = sp.Eq(y1 + y2, int(r2))
eq3 = sp.Eq(x2 + y2, int(c2))
eq4 = sp.Eq(x1 + x2, int(r1))
eq5 = sp.Eq(x1 + y2, int(d1))
eq6 = sp.Eq(x2 + y1, int(d2))
ans = sp.solve((eq1, eq2, eq3, eq4, eq5, eq6), (x1, x2, y1, y2))
print(ans[x1], ans[x2])
print(ans[y1], ans[y2])
| Title: Help Vasilisa the Wise 2
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Vasilisa the Wise from the Kingdom of Far Far Away got a magic box with a secret as a present from her friend Hellawisa the Wise from the Kingdom of A Little Closer. However, Vasilisa the Wise does not know what the box's secret is, since she cannot open it again. She hopes that you will help her one more time with that.
The box's lock looks as follows: it contains 4 identical deepenings for gems as a 2<=×<=2 square, and some integer numbers are written at the lock's edge near the deepenings. The example of a lock is given on the picture below.
The box is accompanied with 9 gems. Their shapes match the deepenings' shapes and each gem contains one number from 1 to 9 (each number is written on exactly one gem). The box will only open after it is decorated with gems correctly: that is, each deepening in the lock should be filled with exactly one gem. Also, the sums of numbers in the square's rows, columns and two diagonals of the square should match the numbers written at the lock's edge. For example, the above lock will open if we fill the deepenings with gems with numbers as is shown on the picture below.
Now Vasilisa the Wise wants to define, given the numbers on the box's lock, which gems she should put in the deepenings to open the box. Help Vasilisa to solve this challenging task.
Input Specification:
The input contains numbers written on the edges of the lock of the box. The first line contains space-separated integers *r*1 and *r*2 that define the required sums of numbers in the rows of the square. The second line contains space-separated integers *c*1 and *c*2 that define the required sums of numbers in the columns of the square. The third line contains space-separated integers *d*1 and *d*2 that define the required sums of numbers on the main and on the side diagonals of the square (1<=≤<=*r*1,<=*r*2,<=*c*1,<=*c*2,<=*d*1,<=*d*2<=≤<=20). Correspondence between the above 6 variables and places where they are written is shown on the picture below. For more clarifications please look at the second sample test that demonstrates the example given in the problem statement.
Output Specification:
Print the scheme of decorating the box with stones: two lines containing two space-separated integers from 1 to 9. The numbers should be pairwise different. If there is no solution for the given lock, then print the single number "-1" (without the quotes).
If there are several solutions, output any.
Demo Input:
['3 7\n4 6\n5 5\n', '11 10\n13 8\n5 16\n', '1 2\n3 4\n5 6\n', '10 10\n10 10\n10 10\n']
Demo Output:
['1 2\n3 4\n', '4 7\n9 1\n', '-1\n', '-1\n']
Note:
Pay attention to the last test from the statement: it is impossible to open the box because for that Vasilisa the Wise would need 4 identical gems containing number "5". However, Vasilisa only has one gem with each number from 1 to 9. | ```python
import sympy as sp
r1, r2 = input("").split() #Rows of square
c1, c2 = input("").split() #colums of square
d1, d2 = input("").split() #diagonals of square
x1, x2, y1, y2 = sp.symbols("x1, x2, y1, y2")
eq1 = sp.Eq(x1 + y1, int(c1))
eq2 = sp.Eq(y1 + y2, int(r2))
eq3 = sp.Eq(x2 + y2, int(c2))
eq4 = sp.Eq(x1 + x2, int(r1))
eq5 = sp.Eq(x1 + y2, int(d1))
eq6 = sp.Eq(x2 + y1, int(d2))
ans = sp.solve((eq1, eq2, eq3, eq4, eq5, eq6), (x1, x2, y1, y2))
print(ans[x1], ans[x2])
print(ans[y1], ans[y2])
``` | -1 |
|
33 | A | What is for dinner? | PROGRAMMING | 1,200 | [
"greedy",
"implementation"
] | A. What is for dinner? | 2 | 256 | In one little known, but very beautiful country called Waterland, lives a lovely shark Valerie. Like all the sharks, she has several rows of teeth, and feeds on crucians. One of Valerie's distinguishing features is that while eating one crucian she uses only one row of her teeth, the rest of the teeth are "relaxing".
For a long time our heroine had been searching the sea for crucians, but a great misfortune happened. Her teeth started to ache, and she had to see the local dentist, lobster Ashot. As a professional, Ashot quickly relieved Valerie from her toothache. Moreover, he managed to determine the cause of Valerie's developing caries (for what he was later nicknamed Cap).
It turned that Valerie eats too many crucians. To help Valerie avoid further reoccurrence of toothache, Ashot found for each Valerie's tooth its residual viability. Residual viability of a tooth is a value equal to the amount of crucians that Valerie can eat with this tooth. Every time Valerie eats a crucian, viability of all the teeth used for it will decrease by one. When the viability of at least one tooth becomes negative, the shark will have to see the dentist again.
Unhappy, Valerie came back home, where a portion of crucians was waiting for her. For sure, the shark couldn't say no to her favourite meal, but she had no desire to go back to the dentist. That's why she decided to eat the maximum amount of crucians from the portion but so that the viability of no tooth becomes negative.
As Valerie is not good at mathematics, she asked you to help her to find out the total amount of crucians that she can consume for dinner.
We should remind you that while eating one crucian Valerie uses exactly one row of teeth and the viability of each tooth from this row decreases by one. | The first line contains three integers *n*, *m*, *k* (1<=≤<=*m*<=≤<=*n*<=≤<=1000,<=0<=≤<=*k*<=≤<=106) — total amount of Valerie's teeth, amount of tooth rows and amount of crucians in Valerie's portion for dinner. Then follow *n* lines, each containing two integers: *r* (1<=≤<=*r*<=≤<=*m*) — index of the row, where belongs the corresponding tooth, and *c* (0<=≤<=*c*<=≤<=106) — its residual viability.
It's guaranteed that each tooth row has positive amount of teeth. | In the first line output the maximum amount of crucians that Valerie can consume for dinner. | [
"4 3 18\n2 3\n1 2\n3 6\n2 3\n",
"2 2 13\n1 13\n2 12\n"
] | [
"11\n",
"13\n"
] | none | 500 | [
{
"input": "4 3 18\n2 3\n1 2\n3 6\n2 3",
"output": "11"
},
{
"input": "2 2 13\n1 13\n2 12",
"output": "13"
},
{
"input": "5 4 8\n4 6\n4 5\n1 3\n2 0\n3 3",
"output": "8"
},
{
"input": "1 1 0\n1 3",
"output": "0"
},
{
"input": "7 1 30\n1 8\n1 15\n1 5\n1 17\n1 9\n1 16\n1 16",
"output": "5"
},
{
"input": "4 2 8\n1 9\n1 10\n1 4\n2 6",
"output": "8"
},
{
"input": "10 4 14\n2 6\n1 5\n2 8\n2 6\n2 5\n4 1\n4 0\n2 4\n3 4\n1 0",
"output": "8"
},
{
"input": "54 22 1009\n15 7\n17 7\n11 9\n5 11\n12 9\n13 8\n13 12\n22 11\n20 9\n20 7\n16 11\n19 12\n3 12\n15 9\n1 12\n2 10\n16 10\n16 10\n14 10\n9 11\n9 9\n14 8\n10 10\n16 12\n1 8\n3 8\n21 11\n18 12\n2 6\n9 11\n11 7\n15 9\n20 11\n6 8\n8 8\n19 11\n15 7\n9 9\n22 7\n12 9\n17 9\n17 11\n12 7\n15 9\n5 11\n11 6\n18 8\n7 10\n4 10\n13 12\n4 8\n20 6\n15 12\n9 7",
"output": "180"
},
{
"input": "1 1 1000000\n1 1000000",
"output": "1000000"
},
{
"input": "4 3 181818\n3 1299\n1 1694\n3 1164\n2 1278",
"output": "4136"
},
{
"input": "50 50 0\n33 0\n26 0\n30 0\n41 0\n38 0\n36 0\n16 0\n7 0\n23 0\n5 0\n39 0\n29 0\n40 0\n47 0\n24 0\n43 0\n14 0\n10 0\n20 0\n3 0\n6 0\n34 0\n13 0\n18 0\n21 0\n9 0\n8 0\n22 0\n25 0\n4 0\n11 0\n17 0\n32 0\n44 0\n49 0\n50 0\n27 0\n28 0\n45 0\n12 0\n35 0\n15 0\n42 0\n31 0\n2 0\n1 0\n48 0\n19 0\n37 0\n46 0",
"output": "0"
},
{
"input": "19 12 199\n7 1\n8 6\n6 14\n1 7\n4 1\n6 6\n3 4\n1 5\n9 2\n5 3\n11 3\n9 4\n1 12\n4 7\n7 3\n12 14\n2 1\n10 8\n6 12",
"output": "54"
}
] | 1,424,962,956 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 0 | 62 | 0 | ## my first python submission ... pretty easy though :P
m,n,k = map(int, input().split())
aa = [10000]*n
print(aa)
for i in range(m):
a,b = map(int , input().split())
aa[a-1] = min(aa[a-1], b)
print(min(sum(aa), k))
| Title: What is for dinner?
Time Limit: 2 seconds
Memory Limit: 256 megabytes
Problem Description:
In one little known, but very beautiful country called Waterland, lives a lovely shark Valerie. Like all the sharks, she has several rows of teeth, and feeds on crucians. One of Valerie's distinguishing features is that while eating one crucian she uses only one row of her teeth, the rest of the teeth are "relaxing".
For a long time our heroine had been searching the sea for crucians, but a great misfortune happened. Her teeth started to ache, and she had to see the local dentist, lobster Ashot. As a professional, Ashot quickly relieved Valerie from her toothache. Moreover, he managed to determine the cause of Valerie's developing caries (for what he was later nicknamed Cap).
It turned that Valerie eats too many crucians. To help Valerie avoid further reoccurrence of toothache, Ashot found for each Valerie's tooth its residual viability. Residual viability of a tooth is a value equal to the amount of crucians that Valerie can eat with this tooth. Every time Valerie eats a crucian, viability of all the teeth used for it will decrease by one. When the viability of at least one tooth becomes negative, the shark will have to see the dentist again.
Unhappy, Valerie came back home, where a portion of crucians was waiting for her. For sure, the shark couldn't say no to her favourite meal, but she had no desire to go back to the dentist. That's why she decided to eat the maximum amount of crucians from the portion but so that the viability of no tooth becomes negative.
As Valerie is not good at mathematics, she asked you to help her to find out the total amount of crucians that she can consume for dinner.
We should remind you that while eating one crucian Valerie uses exactly one row of teeth and the viability of each tooth from this row decreases by one.
Input Specification:
The first line contains three integers *n*, *m*, *k* (1<=≤<=*m*<=≤<=*n*<=≤<=1000,<=0<=≤<=*k*<=≤<=106) — total amount of Valerie's teeth, amount of tooth rows and amount of crucians in Valerie's portion for dinner. Then follow *n* lines, each containing two integers: *r* (1<=≤<=*r*<=≤<=*m*) — index of the row, where belongs the corresponding tooth, and *c* (0<=≤<=*c*<=≤<=106) — its residual viability.
It's guaranteed that each tooth row has positive amount of teeth.
Output Specification:
In the first line output the maximum amount of crucians that Valerie can consume for dinner.
Demo Input:
['4 3 18\n2 3\n1 2\n3 6\n2 3\n', '2 2 13\n1 13\n2 12\n']
Demo Output:
['11\n', '13\n']
Note:
none | ```python
## my first python submission ... pretty easy though :P
m,n,k = map(int, input().split())
aa = [10000]*n
print(aa)
for i in range(m):
a,b = map(int , input().split())
aa[a-1] = min(aa[a-1], b)
print(min(sum(aa), k))
``` | 0 |
275 | A | Lights Out | PROGRAMMING | 900 | [
"implementation"
] | null | null | Lenny is playing a game on a 3<=×<=3 grid of lights. In the beginning of the game all lights are switched on. Pressing any of the lights will toggle it and all side-adjacent lights. The goal of the game is to switch all the lights off. We consider the toggling as follows: if the light was switched on then it will be switched off, if it was switched off then it will be switched on.
Lenny has spent some time playing with the grid and by now he has pressed each light a certain number of times. Given the number of times each light is pressed, you have to print the current state of each light. | The input consists of three rows. Each row contains three integers each between 0 to 100 inclusive. The *j*-th number in the *i*-th row is the number of times the *j*-th light of the *i*-th row of the grid is pressed. | Print three lines, each containing three characters. The *j*-th character of the *i*-th line is "1" if and only if the corresponding light is switched on, otherwise it's "0". | [
"1 0 0\n0 0 0\n0 0 1\n",
"1 0 1\n8 8 8\n2 0 3\n"
] | [
"001\n010\n100\n",
"010\n011\n100\n"
] | none | 500 | [
{
"input": "1 0 0\n0 0 0\n0 0 1",
"output": "001\n010\n100"
},
{
"input": "1 0 1\n8 8 8\n2 0 3",
"output": "010\n011\n100"
},
{
"input": "13 85 77\n25 50 45\n65 79 9",
"output": "000\n010\n000"
},
{
"input": "96 95 5\n8 84 74\n67 31 61",
"output": "011\n011\n101"
},
{
"input": "24 54 37\n60 63 6\n1 84 26",
"output": "110\n101\n011"
},
{
"input": "23 10 40\n15 6 40\n92 80 77",
"output": "101\n100\n000"
},
{
"input": "62 74 80\n95 74 93\n2 47 95",
"output": "010\n001\n110"
},
{
"input": "80 83 48\n26 0 66\n47 76 37",
"output": "000\n000\n010"
},
{
"input": "32 15 65\n7 54 36\n5 51 3",
"output": "111\n101\n001"
},
{
"input": "22 97 12\n71 8 24\n100 21 64",
"output": "100\n001\n100"
},
{
"input": "46 37 13\n87 0 50\n90 8 55",
"output": "111\n011\n000"
},
{
"input": "57 43 58\n20 82 83\n66 16 52",
"output": "111\n010\n110"
},
{
"input": "45 56 93\n47 51 59\n18 51 63",
"output": "101\n011\n100"
},
{
"input": "47 66 67\n14 1 37\n27 81 69",
"output": "001\n001\n110"
},
{
"input": "26 69 69\n85 18 23\n14 22 74",
"output": "110\n001\n010"
},
{
"input": "10 70 65\n94 27 25\n74 66 30",
"output": "111\n010\n100"
},
{
"input": "97 1 74\n15 99 1\n88 68 86",
"output": "001\n011\n000"
},
{
"input": "36 48 42\n45 41 66\n26 64 1",
"output": "001\n111\n010"
},
{
"input": "52 81 97\n29 77 71\n66 11 2",
"output": "100\n100\n111"
},
{
"input": "18 66 33\n19 49 49\n48 46 26",
"output": "011\n100\n000"
},
{
"input": "68 79 52\n51 39 100\n29 14 26",
"output": "110\n000\n111"
},
{
"input": "91 69 77\n91 26 64\n91 88 57",
"output": "001\n011\n110"
},
{
"input": "16 69 64\n48 21 80\n81 51 51",
"output": "010\n101\n111"
},
{
"input": "96 14 2\n100 18 12\n65 34 89",
"output": "111\n010\n010"
},
{
"input": "93 95 90\n8 59 42\n53 13 19",
"output": "100\n001\n111"
},
{
"input": "71 84 18\n100 19 67\n9 76 15",
"output": "010\n010\n001"
},
{
"input": "38 93 85\n21 88 64\n4 96 25",
"output": "111\n011\n000"
},
{
"input": "75 20 20\n60 5 78\n77 4 69",
"output": "011\n001\n000"
},
{
"input": "65 70 96\n19 6 83\n33 37 82",
"output": "100\n000\n011"
},
{
"input": "11 13 60\n17 13 46\n42 21 39",
"output": "000\n011\n101"
},
{
"input": "0 0 0\n0 0 0\n0 0 0",
"output": "111\n111\n111"
},
{
"input": "0 0 0\n0 1 0\n0 0 0",
"output": "101\n000\n101"
},
{
"input": "0 0 0\n0 0 0\n0 0 1",
"output": "111\n110\n100"
}
] | 1,667,796,265 | 2,147,483,647 | PyPy 3-64 | WRONG_ANSWER | TESTS | 0 | 31 | 0 | grid = [[1, 1, 1] for _ in range(3)]
for i in range(3):
inp = list(map(int, input().split()))
for j in range(3):
if inp[j]&1:
grid[i][j] ^= 1
if i-1 > 0:
grid[i-1][j] ^= 1
if j-1 > 0:
grid[i][j-1] ^= 1
if i+1 < 3:
grid[i+1][j] ^= 1
if j+1 < 3:
grid[i][j+1] ^= 1
for i in grid:
print(*i) | Title: Lights Out
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Lenny is playing a game on a 3<=×<=3 grid of lights. In the beginning of the game all lights are switched on. Pressing any of the lights will toggle it and all side-adjacent lights. The goal of the game is to switch all the lights off. We consider the toggling as follows: if the light was switched on then it will be switched off, if it was switched off then it will be switched on.
Lenny has spent some time playing with the grid and by now he has pressed each light a certain number of times. Given the number of times each light is pressed, you have to print the current state of each light.
Input Specification:
The input consists of three rows. Each row contains three integers each between 0 to 100 inclusive. The *j*-th number in the *i*-th row is the number of times the *j*-th light of the *i*-th row of the grid is pressed.
Output Specification:
Print three lines, each containing three characters. The *j*-th character of the *i*-th line is "1" if and only if the corresponding light is switched on, otherwise it's "0".
Demo Input:
['1 0 0\n0 0 0\n0 0 1\n', '1 0 1\n8 8 8\n2 0 3\n']
Demo Output:
['001\n010\n100\n', '010\n011\n100\n']
Note:
none | ```python
grid = [[1, 1, 1] for _ in range(3)]
for i in range(3):
inp = list(map(int, input().split()))
for j in range(3):
if inp[j]&1:
grid[i][j] ^= 1
if i-1 > 0:
grid[i-1][j] ^= 1
if j-1 > 0:
grid[i][j-1] ^= 1
if i+1 < 3:
grid[i+1][j] ^= 1
if j+1 < 3:
grid[i][j+1] ^= 1
for i in grid:
print(*i)
``` | 0 |
|
709 | A | Juicer | PROGRAMMING | 900 | [
"implementation"
] | null | null | Kolya is going to make fresh orange juice. He has *n* oranges of sizes *a*1,<=*a*2,<=...,<=*a**n*. Kolya will put them in the juicer in the fixed order, starting with orange of size *a*1, then orange of size *a*2 and so on. To be put in the juicer the orange must have size not exceeding *b*, so if Kolya sees an orange that is strictly greater he throws it away and continues with the next one.
The juicer has a special section to collect waste. It overflows if Kolya squeezes oranges of the total size strictly greater than *d*. When it happens Kolya empties the waste section (even if there are no more oranges) and continues to squeeze the juice. How many times will he have to empty the waste section? | The first line of the input contains three integers *n*, *b* and *d* (1<=≤<=*n*<=≤<=100<=000, 1<=≤<=*b*<=≤<=*d*<=≤<=1<=000<=000) — the number of oranges, the maximum size of the orange that fits in the juicer and the value *d*, which determines the condition when the waste section should be emptied.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1<=000<=000) — sizes of the oranges listed in the order Kolya is going to try to put them in the juicer. | Print one integer — the number of times Kolya will have to empty the waste section. | [
"2 7 10\n5 6\n",
"1 5 10\n7\n",
"3 10 10\n5 7 7\n",
"1 1 1\n1\n"
] | [
"1\n",
"0\n",
"1\n",
"0\n"
] | In the first sample, Kolya will squeeze the juice from two oranges and empty the waste section afterwards.
In the second sample, the orange won't fit in the juicer so Kolya will have no juice at all. | 500 | [
{
"input": "2 7 10\n5 6",
"output": "1"
},
{
"input": "1 5 10\n7",
"output": "0"
},
{
"input": "3 10 10\n5 7 7",
"output": "1"
},
{
"input": "1 1 1\n1",
"output": "0"
},
{
"input": "2 951637 951638\n44069 951637",
"output": "1"
},
{
"input": "50 100 129\n55 130 91 19 116 3 63 52 104 76 75 27 151 99 149 147 39 148 84 9 132 49 40 112 124 141 144 93 36 32 146 74 48 38 150 55 94 32 107 69 77 81 33 57 62 98 78 127 154 126",
"output": "12"
},
{
"input": "100 1000 1083\n992 616 818 359 609 783 263 989 501 929 362 394 919 1081 870 830 1097 975 62 346 531 367 323 457 707 360 949 334 867 116 478 417 961 963 1029 114 867 1008 988 916 983 1077 959 942 572 961 579 318 721 337 488 717 111 70 416 685 987 130 353 107 61 191 827 849 106 815 211 953 111 398 889 860 801 71 375 320 395 1059 116 222 931 444 582 74 677 655 88 173 686 491 661 186 114 832 615 814 791 464 517 850",
"output": "36"
},
{
"input": "2 6 8\n2 1",
"output": "0"
},
{
"input": "5 15 16\n7 11 5 12 8",
"output": "2"
},
{
"input": "15 759966 759967\n890397 182209 878577 548548 759966 812923 759966 860479 200595 381358 299175 339368 759966 907668 69574",
"output": "4"
},
{
"input": "5 234613 716125\n642626 494941 234613 234613 234613",
"output": "0"
},
{
"input": "50 48547 567054\n529808 597004 242355 559114 78865 537318 631455 733020 655072 645093 309010 855034 306058 625046 524574 834944 27330 664392 443637 821584 338013 490702 289520 675471 885846 258814 134220 571301 84875 94132 200425 928833 375166 521232 317961 175315 947093 89971 322071 174033 48547 998535 954205 704114 943163 438900 48547 538422 48547 48547",
"output": "0"
},
{
"input": "5 10 20\n10 10 10 10 1",
"output": "1"
},
{
"input": "5 10 11\n10 10 10 10 1",
"output": "2"
},
{
"input": "3 10 10\n4 3 3",
"output": "0"
},
{
"input": "3 5 5\n5 5 5",
"output": "1"
},
{
"input": "3 4 14\n5 5 5",
"output": "0"
},
{
"input": "2 7 10\n1234 1234",
"output": "0"
},
{
"input": "1 5 6\n10",
"output": "0"
},
{
"input": "3 4 6\n1 2 3",
"output": "0"
},
{
"input": "5 10 12\n13 13 13 13 13",
"output": "0"
},
{
"input": "3 4 5\n5 7 9",
"output": "0"
},
{
"input": "3 10 100\n5 5 5",
"output": "0"
},
{
"input": "5 1 2\n2 2 2 2 2",
"output": "0"
},
{
"input": "5 5 5\n5 5 5 5 5",
"output": "2"
},
{
"input": "2 2 5\n5 5",
"output": "0"
},
{
"input": "3 1 4\n2 2 2",
"output": "0"
}
] | 1,677,505,665 | 2,147,483,647 | Python 3 | WRONG_ANSWER | TESTS | 4 | 77 | 7,372,800 | n,b,d=map(int,input().split())
m=list(map(int,input().split()))
sum=0
for i in m:
if i <= b:
sum+=i
print(sum//10)
| Title: Juicer
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Kolya is going to make fresh orange juice. He has *n* oranges of sizes *a*1,<=*a*2,<=...,<=*a**n*. Kolya will put them in the juicer in the fixed order, starting with orange of size *a*1, then orange of size *a*2 and so on. To be put in the juicer the orange must have size not exceeding *b*, so if Kolya sees an orange that is strictly greater he throws it away and continues with the next one.
The juicer has a special section to collect waste. It overflows if Kolya squeezes oranges of the total size strictly greater than *d*. When it happens Kolya empties the waste section (even if there are no more oranges) and continues to squeeze the juice. How many times will he have to empty the waste section?
Input Specification:
The first line of the input contains three integers *n*, *b* and *d* (1<=≤<=*n*<=≤<=100<=000, 1<=≤<=*b*<=≤<=*d*<=≤<=1<=000<=000) — the number of oranges, the maximum size of the orange that fits in the juicer and the value *d*, which determines the condition when the waste section should be emptied.
The second line contains *n* integers *a*1,<=*a*2,<=...,<=*a**n* (1<=≤<=*a**i*<=≤<=1<=000<=000) — sizes of the oranges listed in the order Kolya is going to try to put them in the juicer.
Output Specification:
Print one integer — the number of times Kolya will have to empty the waste section.
Demo Input:
['2 7 10\n5 6\n', '1 5 10\n7\n', '3 10 10\n5 7 7\n', '1 1 1\n1\n']
Demo Output:
['1\n', '0\n', '1\n', '0\n']
Note:
In the first sample, Kolya will squeeze the juice from two oranges and empty the waste section afterwards.
In the second sample, the orange won't fit in the juicer so Kolya will have no juice at all. | ```python
n,b,d=map(int,input().split())
m=list(map(int,input().split()))
sum=0
for i in m:
if i <= b:
sum+=i
print(sum//10)
``` | 0 |
|
988 | A | Diverse Team | PROGRAMMING | 800 | [
"brute force",
"implementation"
] | null | null | There are $n$ students in a school class, the rating of the $i$-th student on Codehorses is $a_i$. You have to form a team consisting of $k$ students ($1 \le k \le n$) such that the ratings of all team members are distinct.
If it is impossible to form a suitable team, print "NO" (without quotes). Otherwise print "YES", and then print $k$ distinct numbers which should be the indices of students in the team you form. If there are multiple answers, print any of them. | The first line contains two integers $n$ and $k$ ($1 \le k \le n \le 100$) — the number of students and the size of the team you have to form.
The second line contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$), where $a_i$ is the rating of $i$-th student. | If it is impossible to form a suitable team, print "NO" (without quotes). Otherwise print "YES", and then print $k$ distinct integers from $1$ to $n$ which should be the indices of students in the team you form. All the ratings of the students in the team should be distinct. You may print the indices in any order. If there are multiple answers, print any of them.
Assume that the students are numbered from $1$ to $n$. | [
"5 3\n15 13 15 15 12\n",
"5 4\n15 13 15 15 12\n",
"4 4\n20 10 40 30\n"
] | [
"YES\n1 2 5 \n",
"NO\n",
"YES\n1 2 3 4 \n"
] | All possible answers for the first example:
- {1 2 5} - {2 3 5} - {2 4 5}
Note that the order does not matter. | 0 | [
{
"input": "5 3\n15 13 15 15 12",
"output": "YES\n1 2 5 "
},
{
"input": "5 4\n15 13 15 15 12",
"output": "NO"
},
{
"input": "4 4\n20 10 40 30",
"output": "YES\n1 2 3 4 "
},
{
"input": "1 1\n1",
"output": "YES\n1 "
},
{
"input": "100 53\n16 17 1 2 27 5 9 9 53 24 17 33 35 24 20 48 56 73 12 14 39 55 58 13 59 73 29 26 40 33 22 29 34 22 55 38 63 66 36 13 60 42 10 15 21 9 11 5 23 37 79 47 26 3 79 53 44 8 71 75 42 11 34 39 79 33 10 26 23 23 17 14 54 41 60 31 83 5 45 4 14 35 6 60 28 48 23 18 60 36 21 28 7 34 9 25 52 43 54 19",
"output": "YES\n1 2 3 4 5 6 7 9 10 12 13 15 16 17 18 19 20 21 22 23 24 25 27 28 29 31 33 36 37 38 39 41 42 43 44 45 47 49 50 51 52 54 57 58 59 60 73 74 76 77 79 80 83 "
},
{
"input": "2 2\n100 100",
"output": "NO"
},
{
"input": "2 2\n100 99",
"output": "YES\n1 2 "
},
{
"input": "100 100\n63 100 75 32 53 24 73 98 76 15 70 48 8 81 88 58 95 78 27 92 14 16 72 43 46 39 66 38 64 42 59 9 22 51 4 6 10 94 28 99 68 80 35 50 45 20 47 7 30 26 49 91 77 19 96 57 65 1 11 13 31 12 82 87 93 34 62 3 21 79 56 41 89 18 44 23 74 86 2 33 69 36 61 67 25 83 5 84 90 37 40 29 97 60 52 55 54 71 17 85",
"output": "YES\n1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42 43 44 45 46 47 48 49 50 51 52 53 54 55 56 57 58 59 60 61 62 63 64 65 66 67 68 69 70 71 72 73 74 75 76 77 78 79 80 81 82 83 84 85 86 87 88 89 90 91 92 93 94 95 96 97 98 99 100 "
},
{
"input": "100 41\n54 16 42 3 45 6 9 72 100 13 24 57 35 5 89 13 97 27 43 9 73 89 48 16 48 55 18 15 55 28 30 6 18 41 100 61 9 42 35 54 57 25 73 15 42 54 49 5 72 48 30 55 4 43 94 5 60 92 93 23 89 75 53 92 74 93 89 28 69 6 3 49 15 28 49 57 54 55 30 57 69 18 89 6 25 23 93 74 30 13 87 53 6 42 4 54 60 30 4 35",
"output": "NO"
},
{
"input": "100 2\n70 64 70 32 70 64 32 70 64 32 32 64 70 64 64 32 64 64 64 70 70 64 64 64 64 70 32 64 70 64 32 70 70 70 64 70 64 70 64 32 70 32 70 64 64 64 32 70 64 70 70 32 70 32 32 32 70 32 70 32 64 64 70 32 32 64 70 64 32 32 64 64 32 32 70 70 32 70 32 64 32 70 64 64 32 64 32 64 70 32 70 32 70 64 64 64 70 70 64 70",
"output": "YES\n1 2 "
}
] | 1,642,442,742 | 2,147,483,647 | PyPy 3-64 | OK | TESTS | 10 | 93 | 0 | n,k = map(int,input().split())
a = list(map(int,input().split()))
d = a.copy()
a = list(set(a))
if len(a) < k:
print("NO")
else:
print("YES")
for i in a[:k]:
print(d.index(i)+1, end = " ")
| Title: Diverse Team
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
There are $n$ students in a school class, the rating of the $i$-th student on Codehorses is $a_i$. You have to form a team consisting of $k$ students ($1 \le k \le n$) such that the ratings of all team members are distinct.
If it is impossible to form a suitable team, print "NO" (without quotes). Otherwise print "YES", and then print $k$ distinct numbers which should be the indices of students in the team you form. If there are multiple answers, print any of them.
Input Specification:
The first line contains two integers $n$ and $k$ ($1 \le k \le n \le 100$) — the number of students and the size of the team you have to form.
The second line contains $n$ integers $a_1, a_2, \dots, a_n$ ($1 \le a_i \le 100$), where $a_i$ is the rating of $i$-th student.
Output Specification:
If it is impossible to form a suitable team, print "NO" (without quotes). Otherwise print "YES", and then print $k$ distinct integers from $1$ to $n$ which should be the indices of students in the team you form. All the ratings of the students in the team should be distinct. You may print the indices in any order. If there are multiple answers, print any of them.
Assume that the students are numbered from $1$ to $n$.
Demo Input:
['5 3\n15 13 15 15 12\n', '5 4\n15 13 15 15 12\n', '4 4\n20 10 40 30\n']
Demo Output:
['YES\n1 2 5 \n', 'NO\n', 'YES\n1 2 3 4 \n']
Note:
All possible answers for the first example:
- {1 2 5} - {2 3 5} - {2 4 5}
Note that the order does not matter. | ```python
n,k = map(int,input().split())
a = list(map(int,input().split()))
d = a.copy()
a = list(set(a))
if len(a) < k:
print("NO")
else:
print("YES")
for i in a[:k]:
print(d.index(i)+1, end = " ")
``` | 3 |
|
510 | A | Fox And Snake | PROGRAMMING | 800 | [
"implementation"
] | null | null | Fox Ciel starts to learn programming. The first task is drawing a fox! However, that turns out to be too hard for a beginner, so she decides to draw a snake instead.
A snake is a pattern on a *n* by *m* table. Denote *c*-th cell of *r*-th row as (*r*,<=*c*). The tail of the snake is located at (1,<=1), then it's body extends to (1,<=*m*), then goes down 2 rows to (3,<=*m*), then goes left to (3,<=1) and so on.
Your task is to draw this snake for Fox Ciel: the empty cells should be represented as dot characters ('.') and the snake cells should be filled with number signs ('#').
Consider sample tests in order to understand the snake pattern. | The only line contains two integers: *n* and *m* (3<=≤<=*n*,<=*m*<=≤<=50).
*n* is an odd number. | Output *n* lines. Each line should contain a string consisting of *m* characters. Do not output spaces. | [
"3 3\n",
"3 4\n",
"5 3\n",
"9 9\n"
] | [
"###\n..#\n###\n",
"####\n...#\n####\n",
"###\n..#\n###\n#..\n###\n",
"#########\n........#\n#########\n#........\n#########\n........#\n#########\n#........\n#########\n"
] | none | 500 | [
{
"input": "3 3",
"output": "###\n..#\n###"
},
{
"input": "3 4",
"output": "####\n...#\n####"
},
{
"input": "5 3",
"output": "###\n..#\n###\n#..\n###"
},
{
"input": "9 9",
"output": "#########\n........#\n#########\n#........\n#########\n........#\n#########\n#........\n#########"
},
{
"input": "3 5",
"output": "#####\n....#\n#####"
},
{
"input": "3 6",
"output": "######\n.....#\n######"
},
{
"input": "7 3",
"output": "###\n..#\n###\n#..\n###\n..#\n###"
},
{
"input": "7 4",
"output": "####\n...#\n####\n#...\n####\n...#\n####"
},
{
"input": "49 50",
"output": "##################################################\n.................................................#\n##################################################\n#.................................................\n##################################################\n.................................................#\n##################################################\n#.................................................\n##################################################\n.............................................."
},
{
"input": "43 50",
"output": "##################################################\n.................................................#\n##################################################\n#.................................................\n##################################################\n.................................................#\n##################################################\n#.................................................\n##################################################\n.............................................."
},
{
"input": "43 27",
"output": "###########################\n..........................#\n###########################\n#..........................\n###########################\n..........................#\n###########################\n#..........................\n###########################\n..........................#\n###########################\n#..........................\n###########################\n..........................#\n###########################\n#..........................\n###########################\n....................."
},
{
"input": "11 15",
"output": "###############\n..............#\n###############\n#..............\n###############\n..............#\n###############\n#..............\n###############\n..............#\n###############"
},
{
"input": "11 3",
"output": "###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###"
},
{
"input": "19 3",
"output": "###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###"
},
{
"input": "23 50",
"output": "##################################################\n.................................................#\n##################################################\n#.................................................\n##################################################\n.................................................#\n##################################################\n#.................................................\n##################################################\n.............................................."
},
{
"input": "49 49",
"output": "#################################################\n................................................#\n#################################################\n#................................................\n#################################################\n................................................#\n#################################################\n#................................................\n#################################################\n................................................#\n#..."
},
{
"input": "33 43",
"output": "###########################################\n..........................................#\n###########################################\n#..........................................\n###########################################\n..........................................#\n###########################################\n#..........................................\n###########################################\n..........................................#\n###########################################\n#.................."
},
{
"input": "33 44",
"output": "############################################\n...........................................#\n############################################\n#...........................................\n############################################\n...........................................#\n############################################\n#...........................................\n############################################\n...........................................#\n############################################\n#......."
},
{
"input": "45 45",
"output": "#############################################\n............................................#\n#############################################\n#............................................\n#############################################\n............................................#\n#############################################\n#............................................\n#############################################\n............................................#\n#########################################..."
},
{
"input": "45 49",
"output": "#################################################\n................................................#\n#################################################\n#................................................\n#################################################\n................................................#\n#################################################\n#................................................\n#################################################\n................................................#\n#..."
},
{
"input": "45 3",
"output": "###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###\n..#\n###\n#..\n###"
},
{
"input": "45 4",
"output": "####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####\n...#\n####\n#...\n####"
},
{
"input": "5 4",
"output": "####\n...#\n####\n#...\n####"
},
{
"input": "5 5",
"output": "#####\n....#\n#####\n#....\n#####"
},
{
"input": "5 6",
"output": "######\n.....#\n######\n#.....\n######"
},
{
"input": "7 5",
"output": "#####\n....#\n#####\n#....\n#####\n....#\n#####"
},
{
"input": "7 6",
"output": "######\n.....#\n######\n#.....\n######\n.....#\n######"
},
{
"input": "7 7",
"output": "#######\n......#\n#######\n#......\n#######\n......#\n#######"
}
] | 1,687,033,951 | 2,147,483,647 | Python 3 | OK | TESTS | 28 | 46 | 0 | def Fox_and_Snake(r,c):
next_ = 3
next_2 = 1
for i in range(r):
for j in range(c):
if i %2 == 0:
print('#', end = '')
else:
if i == next_2 and j == (c-1):
print('#', end = '')
next_2 +=4
elif i == next_ and j ==0:
print('#', end = '')
next_ +=4
else :
print('.', end = '')
print()
r, c = map( int, input().split())
Fox_and_Snake(r,c) | Title: Fox And Snake
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Fox Ciel starts to learn programming. The first task is drawing a fox! However, that turns out to be too hard for a beginner, so she decides to draw a snake instead.
A snake is a pattern on a *n* by *m* table. Denote *c*-th cell of *r*-th row as (*r*,<=*c*). The tail of the snake is located at (1,<=1), then it's body extends to (1,<=*m*), then goes down 2 rows to (3,<=*m*), then goes left to (3,<=1) and so on.
Your task is to draw this snake for Fox Ciel: the empty cells should be represented as dot characters ('.') and the snake cells should be filled with number signs ('#').
Consider sample tests in order to understand the snake pattern.
Input Specification:
The only line contains two integers: *n* and *m* (3<=≤<=*n*,<=*m*<=≤<=50).
*n* is an odd number.
Output Specification:
Output *n* lines. Each line should contain a string consisting of *m* characters. Do not output spaces.
Demo Input:
['3 3\n', '3 4\n', '5 3\n', '9 9\n']
Demo Output:
['###\n..#\n###\n', '####\n...#\n####\n', '###\n..#\n###\n#..\n###\n', '#########\n........#\n#########\n#........\n#########\n........#\n#########\n#........\n#########\n']
Note:
none | ```python
def Fox_and_Snake(r,c):
next_ = 3
next_2 = 1
for i in range(r):
for j in range(c):
if i %2 == 0:
print('#', end = '')
else:
if i == next_2 and j == (c-1):
print('#', end = '')
next_2 +=4
elif i == next_ and j ==0:
print('#', end = '')
next_ +=4
else :
print('.', end = '')
print()
r, c = map( int, input().split())
Fox_and_Snake(r,c)
``` | 3 |
|
618 | A | Slime Combining | PROGRAMMING | 800 | [
"implementation"
] | null | null | Your friend recently gave you some slimes for your birthday. You have *n* slimes all initially with value 1.
You are going to play a game with these slimes. Initially, you put a single slime by itself in a row. Then, you will add the other *n*<=-<=1 slimes one by one. When you add a slime, you place it at the right of all already placed slimes. Then, while the last two slimes in the row have the same value *v*, you combine them together to create a slime with value *v*<=+<=1.
You would like to see what the final state of the row is after you've added all *n* slimes. Please print the values of the slimes in the row from left to right. | The first line of the input will contain a single integer, *n* (1<=≤<=*n*<=≤<=100<=000). | Output a single line with *k* integers, where *k* is the number of slimes in the row after you've finished the procedure described in the problem statement. The *i*-th of these numbers should be the value of the *i*-th slime from the left. | [
"1\n",
"2\n",
"3\n",
"8\n"
] | [
"1\n",
"2\n",
"2 1\n",
"4\n"
] | In the first sample, we only have a single slime with value 1. The final state of the board is just a single slime with value 1.
In the second sample, we perform the following steps:
Initially we place a single slime in a row by itself. Thus, row is initially 1.
Then, we will add another slime. The row is now 1 1. Since two rightmost slimes have the same values, we should replace these slimes with one with value 2. Thus, the final state of the board is 2.
In the third sample, after adding the first two slimes, our row is 2. After adding one more slime, the row becomes 2 1.
In the last sample, the steps look as follows:
1. 1 1. 2 1. 2 1 1. 3 1. 3 1 1. 3 2 1. 3 2 1 1. 4 | 500 | [
{
"input": "1",
"output": "1"
},
{
"input": "2",
"output": "2"
},
{
"input": "3",
"output": "2 1"
},
{
"input": "8",
"output": "4"
},
{
"input": "100000",
"output": "17 16 11 10 8 6"
},
{
"input": "12345",
"output": "14 13 6 5 4 1"
},
{
"input": "32",
"output": "6"
},
{
"input": "70958",
"output": "17 13 11 9 6 4 3 2"
},
{
"input": "97593",
"output": "17 15 14 13 12 11 9 6 5 4 1"
},
{
"input": "91706",
"output": "17 15 14 11 10 6 5 4 2"
},
{
"input": "85371",
"output": "17 15 12 11 9 7 6 5 4 2 1"
},
{
"input": "97205",
"output": "17 15 14 13 12 10 9 8 6 5 3 1"
},
{
"input": "34768",
"output": "16 11 10 9 8 7 5"
},
{
"input": "12705",
"output": "14 13 9 8 6 1"
},
{
"input": "30151",
"output": "15 14 13 11 9 8 7 3 2 1"
},
{
"input": "4974",
"output": "13 10 9 7 6 4 3 2"
},
{
"input": "32728",
"output": "15 14 13 12 11 10 9 8 7 5 4"
},
{
"input": "8192",
"output": "14"
},
{
"input": "65536",
"output": "17"
},
{
"input": "32",
"output": "6"
},
{
"input": "256",
"output": "9"
},
{
"input": "4096",
"output": "13"
},
{
"input": "33301",
"output": "16 10 5 3 1"
},
{
"input": "16725",
"output": "15 9 7 5 3 1"
},
{
"input": "149",
"output": "8 5 3 1"
},
{
"input": "16277",
"output": "14 13 12 11 10 9 8 5 3 1"
},
{
"input": "99701",
"output": "17 16 11 9 7 6 5 3 1"
}
] | 1,456,675,000 | 2,147,483,647 | Python 3 | OK | TESTS | 27 | 62 | 0 | N = int(input())
ans = []
i = 0
while N >> i:
if (N >> i) & 1:
ans.append(i + 1)
i += 1
print(*ans[::-1]) | Title: Slime Combining
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
Your friend recently gave you some slimes for your birthday. You have *n* slimes all initially with value 1.
You are going to play a game with these slimes. Initially, you put a single slime by itself in a row. Then, you will add the other *n*<=-<=1 slimes one by one. When you add a slime, you place it at the right of all already placed slimes. Then, while the last two slimes in the row have the same value *v*, you combine them together to create a slime with value *v*<=+<=1.
You would like to see what the final state of the row is after you've added all *n* slimes. Please print the values of the slimes in the row from left to right.
Input Specification:
The first line of the input will contain a single integer, *n* (1<=≤<=*n*<=≤<=100<=000).
Output Specification:
Output a single line with *k* integers, where *k* is the number of slimes in the row after you've finished the procedure described in the problem statement. The *i*-th of these numbers should be the value of the *i*-th slime from the left.
Demo Input:
['1\n', '2\n', '3\n', '8\n']
Demo Output:
['1\n', '2\n', '2 1\n', '4\n']
Note:
In the first sample, we only have a single slime with value 1. The final state of the board is just a single slime with value 1.
In the second sample, we perform the following steps:
Initially we place a single slime in a row by itself. Thus, row is initially 1.
Then, we will add another slime. The row is now 1 1. Since two rightmost slimes have the same values, we should replace these slimes with one with value 2. Thus, the final state of the board is 2.
In the third sample, after adding the first two slimes, our row is 2. After adding one more slime, the row becomes 2 1.
In the last sample, the steps look as follows:
1. 1 1. 2 1. 2 1 1. 3 1. 3 1 1. 3 2 1. 3 2 1 1. 4 | ```python
N = int(input())
ans = []
i = 0
while N >> i:
if (N >> i) & 1:
ans.append(i + 1)
i += 1
print(*ans[::-1])
``` | 3 |
|
242 | B | Big Segment | PROGRAMMING | 1,100 | [
"implementation",
"sortings"
] | null | null | A coordinate line has *n* segments, the *i*-th segment starts at the position *l**i* and ends at the position *r**i*. We will denote such a segment as [*l**i*,<=*r**i*].
You have suggested that one of the defined segments covers all others. In other words, there is such segment in the given set, which contains all other ones. Now you want to test your assumption. Find in the given set the segment which covers all other segments, and print its number. If such a segment doesn't exist, print -1.
Formally we will assume that segment [*a*,<=*b*] covers segment [*c*,<=*d*], if they meet this condition *a*<=≤<=*c*<=≤<=*d*<=≤<=*b*. | The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of segments. Next *n* lines contain the descriptions of the segments. The *i*-th line contains two space-separated integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=109) — the borders of the *i*-th segment.
It is guaranteed that no two segments coincide. | Print a single integer — the number of the segment that covers all other segments in the set. If there's no solution, print -1.
The segments are numbered starting from 1 in the order in which they appear in the input. | [
"3\n1 1\n2 2\n3 3\n",
"6\n1 5\n2 3\n1 10\n7 10\n7 7\n10 10\n"
] | [
"-1\n",
"3\n"
] | none | 1,000 | [
{
"input": "3\n1 1\n2 2\n3 3",
"output": "-1"
},
{
"input": "6\n1 5\n2 3\n1 10\n7 10\n7 7\n10 10",
"output": "3"
},
{
"input": "4\n1 5\n2 2\n2 4\n2 5",
"output": "1"
},
{
"input": "5\n3 3\n1 3\n2 2\n2 3\n1 2",
"output": "2"
},
{
"input": "7\n7 7\n8 8\n3 7\n1 6\n1 7\n4 7\n2 8",
"output": "-1"
},
{
"input": "3\n2 5\n3 4\n2 3",
"output": "1"
},
{
"input": "16\n15 15\n8 12\n6 9\n15 16\n8 14\n3 12\n7 19\n9 13\n5 16\n9 17\n10 15\n9 14\n9 9\n18 19\n5 15\n6 19",
"output": "-1"
},
{
"input": "9\n1 10\n7 8\n6 7\n1 4\n5 9\n2 8\n3 10\n1 1\n2 3",
"output": "1"
},
{
"input": "1\n1 100000",
"output": "1"
},
{
"input": "6\n2 2\n3 3\n3 5\n4 5\n1 1\n1 5",
"output": "6"
},
{
"input": "33\n2 18\n4 14\n2 16\n10 12\n4 6\n9 17\n2 8\n4 12\n8 20\n1 10\n11 14\n11 17\n8 15\n3 16\n3 4\n6 9\n6 19\n4 17\n17 19\n6 16\n3 12\n1 7\n6 20\n8 16\n12 19\n1 3\n12 18\n6 11\n7 20\n16 18\n4 15\n3 15\n15 19",
"output": "-1"
},
{
"input": "34\n3 8\n5 9\n2 9\n1 4\n3 7\n3 3\n8 9\n6 10\n4 7\n6 7\n5 8\n5 10\n1 5\n8 8\n2 5\n3 5\n7 7\n2 8\n4 5\n1 1\n7 9\n5 6\n2 3\n1 2\n2 4\n8 10\n7 8\n1 3\n4 8\n9 10\n1 7\n10 10\n2 2\n1 8",
"output": "-1"
},
{
"input": "55\n3 4\n6 8\n9 10\n3 9\n9 9\n2 5\n4 8\n3 8\n8 10\n1 1\n4 9\n10 10\n6 6\n8 8\n1 8\n5 5\n4 5\n5 9\n2 2\n3 10\n4 6\n3 6\n1 6\n1 7\n6 10\n2 6\n3 7\n2 4\n4 4\n5 10\n1 4\n2 9\n1 3\n7 9\n7 8\n1 9\n1 10\n2 8\n8 9\n6 7\n1 2\n6 9\n7 7\n4 7\n3 3\n2 7\n4 10\n7 10\n2 3\n2 10\n5 7\n3 5\n5 8\n1 5\n5 6",
"output": "37"
},
{
"input": "1\n999999999 1000000000",
"output": "1"
},
{
"input": "3\n1 20\n2 22\n3 18",
"output": "-1"
},
{
"input": "1\n1000000000 1000000000",
"output": "1"
},
{
"input": "2\n100001 100008\n100005 100006",
"output": "1"
},
{
"input": "1\n1000000 10000000",
"output": "1"
},
{
"input": "3\n3 6\n2 4\n1 5",
"output": "-1"
},
{
"input": "2\n3 5\n1 2",
"output": "-1"
}
] | 1,609,619,544 | 2,147,483,647 | Python 3 | TIME_LIMIT_EXCEEDED | TESTS | 43 | 2,000 | 5,836,800 | a = []
b = []
def allseg(a,b):
result = -1
min_a = min(a)
max_b = max(b)
x = find_all(min_a,a)
y = find_all(max_b,b)
for i in range (len(x)):
if x[i] in y:
result = x[i]+1
break
return result
def find_all(n,str):
result = []
for i in range (len(str)):
if str[i] == n:
result.append(i)
return result
t = int(input())
for i in range (t):
seg = input().split()
a.append(int(seg[0]))
b.append(int(seg[1]))
result = allseg(a,b)
print (result)
| Title: Big Segment
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
A coordinate line has *n* segments, the *i*-th segment starts at the position *l**i* and ends at the position *r**i*. We will denote such a segment as [*l**i*,<=*r**i*].
You have suggested that one of the defined segments covers all others. In other words, there is such segment in the given set, which contains all other ones. Now you want to test your assumption. Find in the given set the segment which covers all other segments, and print its number. If such a segment doesn't exist, print -1.
Formally we will assume that segment [*a*,<=*b*] covers segment [*c*,<=*d*], if they meet this condition *a*<=≤<=*c*<=≤<=*d*<=≤<=*b*.
Input Specification:
The first line contains integer *n* (1<=≤<=*n*<=≤<=105) — the number of segments. Next *n* lines contain the descriptions of the segments. The *i*-th line contains two space-separated integers *l**i*,<=*r**i* (1<=≤<=*l**i*<=≤<=*r**i*<=≤<=109) — the borders of the *i*-th segment.
It is guaranteed that no two segments coincide.
Output Specification:
Print a single integer — the number of the segment that covers all other segments in the set. If there's no solution, print -1.
The segments are numbered starting from 1 in the order in which they appear in the input.
Demo Input:
['3\n1 1\n2 2\n3 3\n', '6\n1 5\n2 3\n1 10\n7 10\n7 7\n10 10\n']
Demo Output:
['-1\n', '3\n']
Note:
none | ```python
a = []
b = []
def allseg(a,b):
result = -1
min_a = min(a)
max_b = max(b)
x = find_all(min_a,a)
y = find_all(max_b,b)
for i in range (len(x)):
if x[i] in y:
result = x[i]+1
break
return result
def find_all(n,str):
result = []
for i in range (len(str)):
if str[i] == n:
result.append(i)
return result
t = int(input())
for i in range (t):
seg = input().split()
a.append(int(seg[0]))
b.append(int(seg[1]))
result = allseg(a,b)
print (result)
``` | 0 |
|
805 | B | 3-palindrome | PROGRAMMING | 1,000 | [
"constructive algorithms"
] | null | null | In the beginning of the new year Keivan decided to reverse his name. He doesn't like palindromes, so he changed Naviek to Navick.
He is too selfish, so for a given *n* he wants to obtain a string of *n* characters, each of which is either 'a', 'b' or 'c', with no palindromes of length 3 appearing in the string as a substring. For example, the strings "abc" and "abca" suit him, while the string "aba" doesn't. He also want the number of letters 'c' in his string to be as little as possible. | The first line contains single integer *n* (1<=≤<=*n*<=≤<=2·105) — the length of the string. | Print the string that satisfies all the constraints.
If there are multiple answers, print any of them. | [
"2\n",
"3\n"
] | [
"aa\n",
"bba\n"
] | A palindrome is a sequence of characters which reads the same backward and forward. | 1,000 | [
{
"input": "2",
"output": "aa"
},
{
"input": "3",
"output": "aab"
},
{
"input": "38",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaa"
},
{
"input": "47",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "59",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "67",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab"
},
{
"input": "77",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "89",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "98",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaa"
},
{
"input": "109",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "117",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabba"
},
{
"input": "1",
"output": "a"
},
{
"input": "200000",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "100000",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "143670",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "104217",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "17879",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "131809",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "140873",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "77859",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "153022",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "179227",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "182801",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "5188",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "86539",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "12802",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "120289",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "132866",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "133377",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "31775",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "160397",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "161415",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "163623",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "22942",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "134767",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "52257",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "64905",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "183758",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "60131",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "146883",
"output": "aabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaabbaab..."
},
{
"input": "6",
"output": "aabbaa"
},
{
"input": "4",
"output": "aabb"
}
] | 1,640,419,968 | 2,147,483,647 | PyPy 3 | WRONG_ANSWER | TESTS | 1 | 46 | 0 | n=int(input())
s='abc'*(n//3)
r=n%3
if(r==1):
s+='a'
elif(r==2):
s+='ab'
print(s)
| Title: 3-palindrome
Time Limit: None seconds
Memory Limit: None megabytes
Problem Description:
In the beginning of the new year Keivan decided to reverse his name. He doesn't like palindromes, so he changed Naviek to Navick.
He is too selfish, so for a given *n* he wants to obtain a string of *n* characters, each of which is either 'a', 'b' or 'c', with no palindromes of length 3 appearing in the string as a substring. For example, the strings "abc" and "abca" suit him, while the string "aba" doesn't. He also want the number of letters 'c' in his string to be as little as possible.
Input Specification:
The first line contains single integer *n* (1<=≤<=*n*<=≤<=2·105) — the length of the string.
Output Specification:
Print the string that satisfies all the constraints.
If there are multiple answers, print any of them.
Demo Input:
['2\n', '3\n']
Demo Output:
['aa\n', 'bba\n']
Note:
A palindrome is a sequence of characters which reads the same backward and forward. | ```python
n=int(input())
s='abc'*(n//3)
r=n%3
if(r==1):
s+='a'
elif(r==2):
s+='ab'
print(s)
``` | 0 |