|
--- |
|
license: apache-2.0 |
|
tags: |
|
- generated_from_trainer |
|
metrics: |
|
- accuracy |
|
model-index: |
|
- name: output_v3 |
|
results: [] |
|
widget: |
|
- text: >- |
|
<|endoftext|>MAADGYLPDWLEDNLSEGIREWWALKPGAPQPKANQQHQDNARGLVLPGYKYLGPGNGL |
|
--- |
|
|
|
<!-- This model card has been generated automatically according to the information the Trainer had access to. You |
|
should probably proofread and complete it, then remove this comment. --> |
|
|
|
# output_v3 |
|
|
|
This model is a fine-tuned version of [avuhong/ParvoGPT2](https://huggingface.co./avuhong/ParvoGPT2) on an unknown dataset. |
|
It achieves the following results on the evaluation set: |
|
- Loss: 0.4775 |
|
- Accuracy: 0.9290 |
|
|
|
## Model description |
|
|
|
This model is a GPT2-like model for generating capsid amino acid sequences. It was trained exclusively on capsid aa_seqs of Piccovirales members. |
|
|
|
## Intended uses & limitations |
|
|
|
As a typical GPT model, it can be used to generate new sequences or used to evaluate the perplexity of given sequences. |
|
|
|
### Generate novel sequences for viral capsid proteins |
|
|
|
```python |
|
from transformers import pipeline |
|
protgpt2 = pipeline('text-generation', model="avuhong/PiccoviralesGPT") |
|
sequences = protgpt2("<|endoftext|>", max_length=750, do_sample=True, top_k=950, repetition_penalty=1.2, num_return_sequences=10, eos_token_id=0) |
|
``` |
|
|
|
### Calculate the perplexity of a protein sequence |
|
|
|
```python |
|
def calculatePerplexity(sequence, model, tokenizer): |
|
input_ids = torch.tensor(tokenizer.encode(sequence)).unsqueeze(0) |
|
input_ids = input_ids.to(device) |
|
with torch.no_grad(): |
|
outputs = model(input_ids, labels=input_ids) |
|
loss, logits = outputs[:2] |
|
return math.exp(loss) |
|
|
|
def split_sequence(sequence): |
|
chunks = [] |
|
max_i = 0 |
|
for i in range(0, len(sequence), 60): |
|
chunk = sequence[i:i+60] |
|
|
|
if i == 0: |
|
chunk = '<|endoftext|>' + chunk |
|
chunks.append(chunk) |
|
max_i = i |
|
|
|
chunks = '\n'.join(chunks) |
|
|
|
if max_i+61==len(sequence): |
|
chunks = chunks+"\n<|endoftext|>" |
|
else: |
|
chunks = chunks+"<|endoftext|>" |
|
return chunks |
|
|
|
seq = "MAADGYLPDWLEDNLSEGIREWWALKPGAPQPKANQQHQDNARGLVLPGYKYLGPGNGLDKGEPVNAADAAALEHDKAYDQQLKAGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQAKKRLLEPLGLVEEAAKTAPGKKRPVEQSPQEPDSSAGIGKSGAQPAKKRLNFGQTGDTESVPDPQPIGEPPAAPSGVGSLTMASGGGAPVADNNEGADGVGSSSGNWHCDSQWLGDRVITTSTRTWALPTYNNHLYKQISNSTSGGSSNDNAYFGYSTPWGYFDFNRFHCHFSPRDWQRLINNNWGFRPKRLNFKLFNIQVKEVTDNNGVKTIANNLTSTVQVFTDSDYQLPYVLGSAHEGCLPPFPADVFMIPQYGYLTLNDGSQAVGRSSFYCLEYFPSQMLRTGNNFQFSYEFENVPFHSSYAHSQSLDRLMNPLIDQYLYYLSKTINGSGQNQQTLKFSVAGPSNMAVQGRNYIPGPSYRQQRVSTTVTQNNNSEFAWPGASSWALNGRNSLMNPGPAMASHKEGEDRFFPLSGSLIFGKQGTGRDNVDADKVMITNEEEIKTTNPVATESYGQVATNHQSAQAQAQTGWVQNQGILPGMVWQDRDVYLQGPIWAKIPHTDGNFHPSPLMGGFGMKHPPPQILIKNTPVPADPPTAFNKDKLNSFITQYSTGQVSVEIEWELQKENSKRWNPEIQYTSNYYKSNNVEFAVNTEGVYSEPRPIGTRYLTRNL" |
|
seq = split_sequence(seq) |
|
print(f"{calculatePerplexity(seq, model, tokenizer):.2f}") |
|
``` |
|
|
|
## Training and evaluation data |
|
|
|
Traning script is included in bash file in this repository. |
|
|
|
## Training procedure |
|
|
|
### Training hyperparameters |
|
|
|
The following hyperparameters were used during training: |
|
- learning_rate: 5e-05 |
|
- train_batch_size: 1 |
|
- eval_batch_size: 1 |
|
- seed: 42 |
|
- distributed_type: multi-GPU |
|
- num_devices: 2 |
|
- gradient_accumulation_steps: 4 |
|
- total_train_batch_size: 8 |
|
- total_eval_batch_size: 2 |
|
- optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08 |
|
- lr_scheduler_type: linear |
|
- num_epochs: 32.0 |
|
- mixed_precision_training: Native AMP |
|
|
|
### Training results |
|
|
|
| Training Loss | Epoch | Step | Validation Loss | Accuracy | |
|
|:-------------:|:-----:|:----:|:---------------:|:--------:| |
|
| No log | 1.0 | 220 | 1.1623 | 0.8225 | |
|
| No log | 2.0 | 440 | 0.9566 | 0.8539 | |
|
| 1.1942 | 3.0 | 660 | 0.8456 | 0.8709 | |
|
| 1.1942 | 4.0 | 880 | 0.7719 | 0.8801 | |
|
| 0.7805 | 5.0 | 1100 | 0.7224 | 0.8872 | |
|
| 0.7805 | 6.0 | 1320 | 0.6895 | 0.8928 | |
|
| 0.6257 | 7.0 | 1540 | 0.6574 | 0.8972 | |
|
| 0.6257 | 8.0 | 1760 | 0.6289 | 0.9014 | |
|
| 0.6257 | 9.0 | 1980 | 0.6054 | 0.9045 | |
|
| 0.5385 | 10.0 | 2200 | 0.5881 | 0.9077 | |
|
| 0.5385 | 11.0 | 2420 | 0.5709 | 0.9102 | |
|
| 0.4778 | 12.0 | 2640 | 0.5591 | 0.9121 | |
|
| 0.4778 | 13.0 | 2860 | 0.5497 | 0.9143 | |
|
| 0.427 | 14.0 | 3080 | 0.5385 | 0.9161 | |
|
| 0.427 | 15.0 | 3300 | 0.5258 | 0.9180 | |
|
| 0.394 | 16.0 | 3520 | 0.5170 | 0.9195 | |
|
| 0.394 | 17.0 | 3740 | 0.5157 | 0.9212 | |
|
| 0.394 | 18.0 | 3960 | 0.5038 | 0.9221 | |
|
| 0.363 | 19.0 | 4180 | 0.4977 | 0.9234 | |
|
| 0.363 | 20.0 | 4400 | 0.4976 | 0.9236 | |
|
| 0.3392 | 21.0 | 4620 | 0.4924 | 0.9247 | |
|
| 0.3392 | 22.0 | 4840 | 0.4888 | 0.9255 | |
|
| 0.33 | 23.0 | 5060 | 0.4890 | 0.9262 | |
|
| 0.33 | 24.0 | 5280 | 0.4856 | 0.9268 | |
|
| 0.3058 | 25.0 | 5500 | 0.4803 | 0.9275 | |
|
| 0.3058 | 26.0 | 5720 | 0.4785 | 0.9277 | |
|
| 0.3058 | 27.0 | 5940 | 0.4813 | 0.9281 | |
|
| 0.2973 | 28.0 | 6160 | 0.4799 | 0.9282 | |
|
| 0.2973 | 29.0 | 6380 | 0.4773 | 0.9285 | |
|
| 0.2931 | 30.0 | 6600 | 0.4778 | 0.9286 | |
|
| 0.2931 | 31.0 | 6820 | 0.4756 | 0.9290 | |
|
| 0.2879 | 32.0 | 7040 | 0.4775 | 0.9290 | |
|
|
|
|
|
### Framework versions |
|
|
|
- Transformers 4.26.1 |
|
- Pytorch 1.13.1+cu117 |
|
- Datasets 2.9.0 |
|
- Tokenizers 0.13.2 |
|
|