Update for ZeroGPU

app.py

@@ -81,7 +81,7 @@ The values can be interpreted as the probability of interaction between the drug
 
 Thank you for using <span style='font-variant:small-caps;'>BarlowDTI</span>!
 
-Note: Inference may take longer, you can upgrade to a paid GPU-enabled plan for faster inference.
+*Note: Thanks to ZeroGPU, you can run this model on a GPU for free.*
 """
 
 article = """
@@ -93,7 +93,7 @@ in combination with
 [BioSNAP](https://snap.stanford.edu/index.html), and 
 [DAVIS](https://doi.org/10.1038/nbt.1990).
 
-If you use our approach in your research, please cite our paper:
+If you use our model in your research, please cite our paper:
 ```
 @misc{schuh2024barlowtwinsdeepneural,
       title={Barlow Twins Deep Neural Network for Advanced 1D Drug-Target Interaction Prediction}, 
@@ -115,8 +115,8 @@ theme = gr.themes.Base(
 iface = gr.Interface(
     fn=predict_and_plot,
     inputs=[
-        gr.Textbox(label="Protein Sequence", info="Just one sequence is allowed. Remove FASTA syntax (e.g. >ABC)."), 
-        gr.Textbox(label="Molecule SMILES", info="One per line, multiple allowed."),
+        gr.Textbox(label="Protein Sequence", info="Just one sequence is allowed. Remove FASTA syntax (e.g. > ABC).", placeholder="MRSWSTVMLAVLATAATVFGHDADPEMKMTTPQIIMRWGYPAMIYDVTTEDGYILELHRI"), 
+        gr.Textbox(label="Molecule SMILES", info="One per line, multiple allowed.", placeholder="C1CSSC1CCCCC(=O)O\nCC1=CC(=C(C=C1)C(=O)O)O"),
         gr.CheckboxGroup(choices=dataset_names, label="Select Models for Prediction", value="BarlowDTI XXL")
     ],
     outputs=[