--- license: apache-2.0 tags: - generated_from_trainer metrics: - accuracy model-index: - name: output_v3 results: [] widget: - text: >- <|endoftext|>MAADGYLPDWLEDNLSEGIREWWALKPGAPQPKANQQHQDNARGLVLPGYKYLGPGNGL --- # output_v3 This model is a fine-tuned version of [avuhong/ParvoGPT2](https://huggingface.co./avuhong/ParvoGPT2) on an unknown dataset. It achieves the following results on the evaluation set: - Loss: 0.4775 - Accuracy: 0.9290 ## Model description This model is a GPT2-like model for generating capsid amino acid sequences. It was trained exclusively on capsid aa_seqs of Piccovirales members. ## Intended uses & limitations As a typical GPT model, it can be used to generate new sequences or used to evaluate the perplexity of given sequences. ### Generate novel sequences for viral capsid proteins ```python from transformers import pipeline protgpt2 = pipeline('text-generation', model="avuhong/PiccoviralesGPT") sequences = protgpt2("<|endoftext|>", max_length=750, do_sample=True, top_k=950, repetition_penalty=1.2, num_return_sequences=10, eos_token_id=0) ``` ### Calculate the perplexity of a protein sequence ```python def calculatePerplexity(sequence, model, tokenizer): input_ids = torch.tensor(tokenizer.encode(sequence)).unsqueeze(0) input_ids = input_ids.to(device) with torch.no_grad(): outputs = model(input_ids, labels=input_ids) loss, logits = outputs[:2] return math.exp(loss) def split_sequence(sequence): chunks = [] max_i = 0 for i in range(0, len(sequence), 60): chunk = sequence[i:i+60] if i == 0: chunk = '<|endoftext|>' + chunk chunks.append(chunk) max_i = i chunks = '\n'.join(chunks) if max_i+61==len(sequence): chunks = chunks+"\n<|endoftext|>" else: chunks = chunks+"<|endoftext|>" return chunks seq = "MAADGYLPDWLEDNLSEGIREWWALKPGAPQPKANQQHQDNARGLVLPGYKYLGPGNGLDKGEPVNAADAAALEHDKAYDQQLKAGDNPYLKYNHADAEFQERLKEDTSFGGNLGRAVFQAKKRLLEPLGLVEEAAKTAPGKKRPVEQSPQEPDSSAGIGKSGAQPAKKRLNFGQTGDTESVPDPQPIGEPPAAPSGVGSLTMASGGGAPVADNNEGADGVGSSSGNWHCDSQWLGDRVITTSTRTWALPTYNNHLYKQISNSTSGGSSNDNAYFGYSTPWGYFDFNRFHCHFSPRDWQRLINNNWGFRPKRLNFKLFNIQVKEVTDNNGVKTIANNLTSTVQVFTDSDYQLPYVLGSAHEGCLPPFPADVFMIPQYGYLTLNDGSQAVGRSSFYCLEYFPSQMLRTGNNFQFSYEFENVPFHSSYAHSQSLDRLMNPLIDQYLYYLSKTINGSGQNQQTLKFSVAGPSNMAVQGRNYIPGPSYRQQRVSTTVTQNNNSEFAWPGASSWALNGRNSLMNPGPAMASHKEGEDRFFPLSGSLIFGKQGTGRDNVDADKVMITNEEEIKTTNPVATESYGQVATNHQSAQAQAQTGWVQNQGILPGMVWQDRDVYLQGPIWAKIPHTDGNFHPSPLMGGFGMKHPPPQILIKNTPVPADPPTAFNKDKLNSFITQYSTGQVSVEIEWELQKENSKRWNPEIQYTSNYYKSNNVEFAVNTEGVYSEPRPIGTRYLTRNL" seq = split_sequence(seq) print(f"{calculatePerplexity(seq, model, tokenizer):.2f}") ``` ## Training and evaluation data Traning script is included in bash file in this repository. ## Training procedure ### Training hyperparameters The following hyperparameters were used during training: - learning_rate: 5e-05 - train_batch_size: 1 - eval_batch_size: 1 - seed: 42 - distributed_type: multi-GPU - num_devices: 2 - gradient_accumulation_steps: 4 - total_train_batch_size: 8 - total_eval_batch_size: 2 - optimizer: Adam with betas=(0.9,0.999) and epsilon=1e-08 - lr_scheduler_type: linear - num_epochs: 32.0 - mixed_precision_training: Native AMP ### Training results | Training Loss | Epoch | Step | Validation Loss | Accuracy | |:-------------:|:-----:|:----:|:---------------:|:--------:| | No log | 1.0 | 220 | 1.1623 | 0.8225 | | No log | 2.0 | 440 | 0.9566 | 0.8539 | | 1.1942 | 3.0 | 660 | 0.8456 | 0.8709 | | 1.1942 | 4.0 | 880 | 0.7719 | 0.8801 | | 0.7805 | 5.0 | 1100 | 0.7224 | 0.8872 | | 0.7805 | 6.0 | 1320 | 0.6895 | 0.8928 | | 0.6257 | 7.0 | 1540 | 0.6574 | 0.8972 | | 0.6257 | 8.0 | 1760 | 0.6289 | 0.9014 | | 0.6257 | 9.0 | 1980 | 0.6054 | 0.9045 | | 0.5385 | 10.0 | 2200 | 0.5881 | 0.9077 | | 0.5385 | 11.0 | 2420 | 0.5709 | 0.9102 | | 0.4778 | 12.0 | 2640 | 0.5591 | 0.9121 | | 0.4778 | 13.0 | 2860 | 0.5497 | 0.9143 | | 0.427 | 14.0 | 3080 | 0.5385 | 0.9161 | | 0.427 | 15.0 | 3300 | 0.5258 | 0.9180 | | 0.394 | 16.0 | 3520 | 0.5170 | 0.9195 | | 0.394 | 17.0 | 3740 | 0.5157 | 0.9212 | | 0.394 | 18.0 | 3960 | 0.5038 | 0.9221 | | 0.363 | 19.0 | 4180 | 0.4977 | 0.9234 | | 0.363 | 20.0 | 4400 | 0.4976 | 0.9236 | | 0.3392 | 21.0 | 4620 | 0.4924 | 0.9247 | | 0.3392 | 22.0 | 4840 | 0.4888 | 0.9255 | | 0.33 | 23.0 | 5060 | 0.4890 | 0.9262 | | 0.33 | 24.0 | 5280 | 0.4856 | 0.9268 | | 0.3058 | 25.0 | 5500 | 0.4803 | 0.9275 | | 0.3058 | 26.0 | 5720 | 0.4785 | 0.9277 | | 0.3058 | 27.0 | 5940 | 0.4813 | 0.9281 | | 0.2973 | 28.0 | 6160 | 0.4799 | 0.9282 | | 0.2973 | 29.0 | 6380 | 0.4773 | 0.9285 | | 0.2931 | 30.0 | 6600 | 0.4778 | 0.9286 | | 0.2931 | 31.0 | 6820 | 0.4756 | 0.9290 | | 0.2879 | 32.0 | 7040 | 0.4775 | 0.9290 | ### Framework versions - Transformers 4.26.1 - Pytorch 1.13.1+cu117 - Datasets 2.9.0 - Tokenizers 0.13.2